DUF659 domain-containing protein

Overview
NameDUF659 domain-containing protein
Smed IDSMED30003149
Length (bp)2415
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DUF659 domain-containing protein (SMED30003149) t-SNE clustered cells

Violin plots show distribution of expression levels for DUF659 domain-containing protein (SMED30003149) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DUF659 domain-containing protein (SMED30003149) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DUF659 domain-containing protein (SMED30003149) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003149

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testisSMED30003149SMESG000079803.1 SMESG000019442.1 SMESG000037000.1 Contig5397newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30003149SMESG000079803.1 SMESG000019442.1 SMESG000037000.1 Contig5397uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30003149SMESG000019746.1 Contig5397newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30003149SMESG000019746.1 Contig5397uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DUF659 domain-containing protein vs. TrEMBL
Match: A0A177AU62 (Uncharacterized protein OS=Intoshia linei OX=1819745 GN=A3Q56_07514 PE=4 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.096e-20
Identity = 45/130 (34.62%), Postives = 66/130 (50.77%), Query Frame = 1
Query: 1300 NVKTSSFMMLFSDAASYLKNAGEVYKSRNH-----------DFLHVKCLTHLIHNSSMRIRAAYKNIDKVIGSLKALTIKNKERQNPFSEIGSPPSVVLTRWTSWLQVVIYYCKSLLAIKNIV*NIGDDG 1656
            N+  ++F++L +DAASY+   GE  K               +  HV C+ HL HN S +I + YKN + ++ S+     K+K R   F  I   P+   TR+  WL+V+ Y+ K  L IKNIV     DG
Sbjct:   70 NLNPNNFILLITDAASYMVLGGEKLKYEKFILENNVEIAFKNLFHVTCVVHLYHNMSAKIASYYKNANNLVISMNLALSKSKARNKLFKNIPLHPTFCKTRFGDWLKVIEYFSKYYLYIKNIVDAFETDG 199          

HSP 2 Score: 55.0694 bits (131), Expect = 1.096e-20
Identity = 36/96 (37.50%), Postives = 54/96 (56.25%), Query Frame = 3
Query: 1758 RYNISTAYYEINRLNLK--HDPLEL----NLADNDAKSICELQNENMSPTIYSFLRNCPPTSIVAERSFSMVKRILTISRNFDPKNVANYINVYYN 2027
            +Y IS A  ++N LN K  H  ++L     L ++D K I  L  E+++P+ Y+ L  C  TSI  ER FS++  I    RNF  +N+A Y+ + YN
Sbjct:  239 KYTISDAIDDLNNLNFKRNHASIKLYVEKRLINSDIKGIEHLIREDITPSQYAKLLMCQATSISVERRFSILHTINAKERNFKAENLAEYVLLKYN 334          
BLAST of DUF659 domain-containing protein vs. TrEMBL
Match: A0A1Y1S4J3 (C2H2-type domain-containing protein OS=Enterospora canceri OX=1081671 GN=ECANGB1_289 PE=4 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 4.798e-19
Identity = 50/159 (31.45%), Postives = 90/159 (56.60%), Query Frame = 1
Query: 1084 QVDLKVQSKLQNRKIFIVFDETEILGKRYCNVMCGCIESPHEIWLINSVAITTPANSTLVVSIINNSL*KYNNVKTSSFMMLFSDAASYLKNAGEVYKSRNHDFLHVKCLTHLIHNSSMRIRAAYKNIDKVIGSLKALTIKNKERQNPFSEIGSPPSVV 1560
            +++++++S L N+ +F++FD +   G  Y N+M G IE P + +LIN +       S  + + IN+SL  +N +  +   M+ SD A Y     ++ K +    + + C  HL+HN +M+IR  YK  D+ I S+K +T++  + ++    +G PPSVV
Sbjct:  117 EMNMQIKSHLYNKLLFLMFDGSCKAGLHYINIMAGDIEEPSKKYLINQIVTVESETSERLFTYINDSLSLFN-LHFTDVKMIISDGAPYNTKLKKLIKRQERSIVFITCFMHLLHNCAMKIRQTYKLTDQFIASVKDITVRCNKYRDLIEFVGKPPSVV 274          

HSP 2 Score: 27.7202 bits (60), Expect = 4.798e-19
Identity = 22/41 (53.66%), Postives = 27/41 (65.85%), Query Frame = 3
Query:  957 VAEAFLLADIPXXXXXXXXXXXXXXRMKHKLPSESTARNYV 1079
            VA+AFL ADIPL+KL    +K LF  M    P+EST R +V
Sbjct:   71 VAKAFLEADIPLKKLRIPAIKELFQSMGFICPAESTTRRFV 111          
BLAST of DUF659 domain-containing protein vs. TrEMBL
Match: A0A2S2Q4D6 (DUF659 domain-containing protein OS=Sipha flava OX=143950 GN=g.77589 PE=4 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 5.608e-19
Identity = 44/117 (37.61%), Postives = 70/117 (59.83%), Query Frame = 1
Query: 1297 NNVKTSSFMMLFSDAASYLKNAGEVYKSRNHDFLHVKCLTHLIHNSSMRIRAAYKNIDKVIGSLKALTIKNKERQNPFS----EIGSPPSVVLTRWTSWLQVVIYYCKSLLAIKNIV 1635
            N VK +  ++ FSDAA Y+K AG+  K+     +HV CL H +HN    +RA Y+++D++IG +K    K  +R   F+    E+ +PP  + TRW +W++ V YYCK    IK+++
Sbjct:   31 NGVKHNDVLLFFSDAAPYMKKAGDCIKALYPKLVHVTCLAHALHNVCEEVRAHYQDVDQLIGGMKKTFFKCPKRTAIFNEKCPELPNPPRPITTRWGTWIKAVQYYCKYFNEIKSVI 147          
BLAST of DUF659 domain-containing protein vs. TrEMBL
Match: A0A2S2R2X5 (DUF659 domain-containing protein OS=Sipha flava OX=143950 GN=g.149130 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 9.090e-19
Identity = 80/315 (25.40%), Postives = 145/315 (46.03%), Query Frame = 1
Query:  721 IPRSKQNDNDLIRRYTQQCTQEFCVGPHKTLYCNICNTSVDFKKKFNVDAHRKTKRHVIPYKTVLTHSLVL*IRNLYLWWRKHFYWL----------IFRLKN*IIQS*RIYFCV*NINYQANRQ---LVIT*AQVDLKVQSKLQNRKIFIVFDETEILGKR-YCNVMCGCI--ESPHEIWLINSVAITTPANSTLVVSIINNSL*KY--NNVKTSSFMMLFSDAASYLKNAGEVYKSRNHDFLHVKCLTHLIHNSSMRIRAAYKNIDKVIGSLKALTIKNKER----QNPFSEIGSPPSVVLTRWTSWLQVVIY 1599
            +P+ KQN N  +++Y  +  +         LYC IC+  V  +KKF++  H    +H      +     +    N   +     Y L          + +L N + +S    +C  NI  ++  +         +V LK++  +   KI++  DET    +R   N++ G +  ESP   +L+++  +    NS+ +  + +  L      NVK  + ++  SDAA Y+K AG   +    + +H+ CL H  HN    +RA YKN+D++I  +K   +K  +R    +    E+ +PP  ++TRW++W+  V Y
Sbjct:    1 MPKIKQNHNSKLKKYVSEFGENIFSIDGLILYCKICDVKVSSEKKFHIQQHIGRDKHKNALTKIENSIKIQPFINKNTFKSDFNYDLCNALVAANIPMNKLNNDVFRSFLSKYCNKNIPCESTLRKGYFDKCYEEVLLKIREAVGEHKIWVCIDETTDSERRNVANIIVGILQPESPGNFYLLHTDYLDK-VNSSTITQLFDKVLHILWPTNVKYDNILLFISDAAPYMKKAGSTIQPLYPNIIHLTCLAHACHNVCEEVRAYYKNVDQLISEMKKTFLKCPKRIAVLKEKCPELPNPPRPIITRWSTWINAVKY 314          
BLAST of DUF659 domain-containing protein vs. TrEMBL
Match: J9M5B4 (DUF659 domain-containing protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=2)

HSP 1 Score: 98.5969 bits (244), Expect = 3.945e-18
Identity = 55/195 (28.21%), Postives = 101/195 (51.79%), Query Frame = 1
Query: 1096 KVQSKLQNRKIFIVFDETEILGKRY-CNVMCGCIES--PHEIWLINSVAITTPANSTLVVSIINNSL*KY--NNVKTSSFMMLFSDAASYLKNAGEVYKSRNHDFLHVKCLTHLIHNSSMRIRAAYKNIDKVIGSLKALTIKNKER----QNPFSEIGSPPSVVLTRWTSWLQVVIYYCKSLLAIKNIV*NIGDD 1653
            K++  ++  KI++  DET  +  RY  NV+ G +++  P +++L+N+  +   AN + +  + + S+     + ++     +  SDAA Y+  AG   K+     +HV CL H +H  +  IR  +  IDK+I  +K + +K   R    +N   +   PP  ++TRW +WL+   YYCK    +K++V  +  D
Sbjct:  141 KIRDNIKGNKIWVSIDETTDVNGRYVANVVIGTLQTDQPGKVYLLNT-EVLDKANYSTITKLFDKSMFLLWPDGIRHDDVFLFLSDAAPYMIKAGTTIKALYSKMVHVTCLAHGMHRVAEVIRGKFPEIDKLIAKIKQIFLKAPSRTILFKNKVPDTPLPPQPIITRWGTWLEAASYYCKYFNEVKSVVQELDPD 334          
BLAST of DUF659 domain-containing protein vs. Planmine SMEST
Match: SMESG000069957.1 (SMESG000069957.1)

HSP 1 Score: 264.618 bits (675), Expect = 3.581e-108
Identity = 133/160 (83.12%), Postives = 143/160 (89.38%), Query Frame = 1
Query: 1180 MCGCIESPHEIWLINSVAITTPANSTLVVSIINNSL*KYNNVKTSSFMMLFSDAASYLKNAGEVYKSRNHDFLHVKCLTHLIHNSSMRIRAAYKNIDKVIGSLKALTIKNKERQNPFSEIGSPPSVVLTRWTSWLQVVIYYCKSLLAIKNIV*NIGDDGV 1659
            MC CIESPHEIWLIN VAITTP NSTLVVSII++ L K NNVKTSSFMML SDA SY+K AGEVYKSRNHDFLHVKCL +LI+N SMRIRAAY+NIDKVIGSLKALTIKNKERQN FSEI SPPSVVLTRWTSWL+ VIYYC +L A+KNIV NIG+DGV
Sbjct:    1 MCVCIESPHEIWLINPVAITTPENSTLVVSIIDDFLEK-NNVKTSSFMMLISDATSYMKKAGEVYKSRNHDFLHVKCLAYLIYNCSMRIRAAYENIDKVIGSLKALTIKNKERQNLFSEIESPPSVVLTRWTSWLRAVIYYCNNLPALKNIVSNIGNDGV 159          

HSP 2 Score: 148.288 bits (373), Expect = 3.581e-108
Identity = 80/119 (67.23%), Postives = 91/119 (76.47%), Query Frame = 3
Query: 1659 AKSA*AEPNLMKDLLV-KKCYEVLIYTLENLAQDRYNISTAYYEINRLNLKHDPLELN------LADNDAKSICELQNENMSPTIYSFLRNCPPTSIVAERSFSMVKRILTISRNFDPK 1994
            AKSA AEPNLMKDLLV K+CYEVL+Y LENL Q RYNISTAY EINRLNLKH+ LEL       LADND +SIC++QNEN+SPTIYSFLRNCPP    + + F   +R +  SRNFD K
Sbjct:  164 AKSALAEPNLMKDLLVVKECYEVLMYRLENLEQGRYNISTAYEEINRLNLKHNLLELKNYISQRLADNDVRSICKIQNENISPTIYSFLRNCPPYIDCSRKEFLNAERNIGHSRNFDHK 282          
BLAST of DUF659 domain-containing protein vs. Planmine SMEST
Match: SMESG000013476.1 (SMESG000013476.1)

HSP 1 Score: 204.527 bits (519), Expect = 1.223e-84
Identity = 104/145 (71.72%), Postives = 116/145 (80.00%), Query Frame = 3
Query: 1659 AKSA*AEPNLMKDL-LVKKCYEVLIYTLENLAQDRYNISTAYYEINRLNLKHDPLELN------LADNDAKSICELQNENMSPTIYSFLRNCPPTSIVAERSFSMVKRILTISRNFDPKNVANYINVYYNQKVEDANLQDQQEND 2072
            AKSA AEPNLMKDL +VK+CYEVL+Y +          S AY EINRLNLKHDPLEL       LADND +SICELQNENMSPTIY FLRNCPPTSIV ERS+S+ K+IL + RNF+PKN+ANYINVYYNQKVEDANLQD+QE D
Sbjct:   79 AKSAFAEPNLMKDLRVVKECYEVLLYYIRKSRARPIKFSIAYEEINRLNLKHDPLELKNYISIRLADNDVRSICELQNENMSPTIYFFLRNCPPTSIVVERSYSIPKKILVVGRNFNPKNMANYINVYYNQKVEDANLQDKQEKD 223          

HSP 2 Score: 129.798 bits (325), Expect = 1.223e-84
Identity = 63/74 (85.14%), Postives = 67/74 (90.54%), Query Frame = 1
Query: 1438 MRIRAAYKNIDKVIGSLKALTIKNKERQNPFSEIGSPPSVVLTRWTSWLQVVIYYCKSLLAIKNIV*NIGDDGV 1659
            MRI A Y+NIDKVIGSLKALTIKNKERQN FSEIGSPPSVVLTRWTSWL+ VIY+C +L AIKNIV NIGDDGV
Sbjct:    1 MRIHATYENIDKVIGSLKALTIKNKERQNLFSEIGSPPSVVLTRWTSWLRAVIYFCNNLRAIKNIVSNIGDDGV 74          
BLAST of DUF659 domain-containing protein vs. Planmine SMEST
Match: SMESG000049900.1 (SMESG000049900.1)

HSP 1 Score: 230.72 bits (587), Expect = 1.912e-64
Identity = 136/210 (64.76%), Postives = 151/210 (71.90%), Query Frame = 3
Query: 1473 SYWEFKSANNKK*RKTKSVFRNRKSAVSGFDKV---DKLVTSGNLLL*KPPRD*EYCMKYRR*WCAKSA*AEPNLMKDLL-VKKCYEVLIYTLENLAQDRYNISTAYYEINRLNLKHDPLELN------LADNDAKSICELQNENMSPTIYSFLRNCPPTSIVAERSFSMVKRILTISRNFDPKNVANYINVYYNQKVEDANLQDQQEND 2072
            SY EFKSANNKK RKT+S+FRN KSAVSGFDK+   DKLV S         RD +  +       AKSA AE NL+KDLL VK+CYEVLIY LENL Q RYNIST Y EI RLNLKHD LEL       LAD D +SIC L N+NMSPTIYSFLR         + SFSM+K+IL + RNFDP+NVANYINVYYNQKVEDANLQD+QEND
Sbjct:  498 SYLEFKSANNKKLRKTESIFRNWKSAVSGFDKMEKWDKLVAS---------RDEDVLVNK-----AKSALAELNLIKDLLGVKECYEVLIYALENLEQGRYNISTVYKEIKRLNLKHDALELKSYISQRLADKDVRSICGLPNQNMSPTIYSFLR---------KNSFSMLKKILAVGRNFDPENVANYINVYYNQKVEDANLQDKQEND 684          
BLAST of DUF659 domain-containing protein vs. Planmine SMEST
Match: SMESG000037883.1 (SMESG000037883.1)

HSP 1 Score: 191.045 bits (484), Expect = 3.525e-56
Identity = 109/165 (66.06%), Postives = 118/165 (71.52%), Query Frame = 1
Query: 1180 MCGCIESPHEIWLINSVAITTPANSTLVVSIINNSL*KYNNVKTSSFMMLFSDAASYLKNAGEVYKSRNHDFLHVKCLTHLIHNSSMRIRAAYKNIDKVIGSLKALTIKNKERQ-----NPFSEIGSPPSVVLTRWTSWLQVVIYYCKSLLAIKNIV*NIGDDGV 1659
            MCGCIESPHE W+INSVA+TTPANSTLVVSII++SL K NNVKTSSF+ML SDAASY+K  GEVY SRNHDF HVKCL HLI N SM IRAAY+NIDKVIGSLKALTIKN  R      + F EI                       +LLAIKNIV NIGDD V
Sbjct:    1 MCGCIESPHETWIINSVALTTPANSTLVVSIIDDSLEK-NNVKTSSFIMLISDAASYMKKVGEVYISRNHDFPHVKCLDHLIDNCSMCIRAAYENIDKVIGSLKALTIKNNFRNWKSAVSGFDEID----------------------NLLAIKNIVSNIGDDDV 142          

HSP 2 Score: 70.4774 bits (171), Expect = 1.153e-13
Identity = 43/81 (53.09%), Postives = 53/81 (65.43%), Query Frame = 3
Query: 1530 FRNRKSAVSGFDKVDKLVTSGNLLL*KPPRD*EYCMKYRR*WCAKSA*AEPNLMKDLLV-KKCYEVLIYTLENLAQDRYNI 1769
            FRN KSAVSGFD++D L+   N++      D +  +        KSA AEP +MKDLLV K+CY VL+YTLENL Q RYNI
Sbjct:  111 FRNWKSAVSGFDEIDNLLAIKNIV--SNIGDDDVLVNK-----TKSALAEPGVMKDLLVVKECYAVLVYTLENLEQRRYNI 184          
BLAST of DUF659 domain-containing protein vs. Planmine SMEST
Match: SMESG000037000.1 (SMESG000037000.1)

HSP 1 Score: 119.783 bits (299), Expect = 2.127e-38
Identity = 56/67 (83.58%), Postives = 59/67 (88.06%), Query Frame = 1
Query:  721 IPRSKQNDNDLIRRYTQQCTQEFCVGPHKTLYCNICNTSVDFKKKFNVDAHRKTKRHVIPYKTVLTH 921
            +PR KQNDNDLIRRYTQQ  Q+FCVG H TLYCNICNTSVDFKKKFNVDAHRKTK HVIP +TVLT 
Sbjct:    1 MPRPKQNDNDLIRRYTQQYPQKFCVGQHNTLYCNICNTSVDFKKKFNVDAHRKTKGHVIPDRTVLTQ 67          

HSP 2 Score: 60.077 bits (144), Expect = 2.127e-38
Identity = 44/53 (83.02%), Postives = 47/53 (88.68%), Query Frame = 3
Query:  921 FFSSIDKEFISLVAEAFLLADIPXXXXXXXXXXXXXXRMKHKLPSESTARNYV 1079
            FFS  DKEF  LVA+AFL ADIP+EKLNN+KLKNLFLRMKHKLPSES ARNYV
Sbjct:   69 FFSPTDKEFAFLVAKAFLSADIPIEKLNNAKLKNLFLRMKHKLPSESKARNYV 121          
The following BLAST results are available for this feature:
BLAST of DUF659 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF659 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF659 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF659 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF659 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF659 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF659 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF659 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A177AU621.096e-2034.62Uncharacterized protein OS=Intoshia linei OX=18197... [more]
A0A1Y1S4J34.798e-1931.45C2H2-type domain-containing protein OS=Enterospora... [more]
A0A2S2Q4D65.608e-1937.61DUF659 domain-containing protein OS=Sipha flava OX... [more]
A0A2S2R2X59.090e-1925.40DUF659 domain-containing protein OS=Sipha flava OX... [more]
J9M5B43.945e-1828.21DUF659 domain-containing protein OS=Acyrthosiphon ... [more]
back to top
BLAST of DUF659 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF659 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF659 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF659 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF659 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF659 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069957.13.581e-10883.13SMESG000069957.1[more]
SMESG000013476.11.223e-8471.72SMESG000013476.1[more]
SMESG000049900.11.912e-6464.76SMESG000049900.1[more]
SMESG000037883.13.525e-5666.06SMESG000037883.1[more]
SMESG000037000.12.127e-3883.58SMESG000037000.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003149 ID=SMED30003149|Name=DUF659 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2415bp
CTGCAATATAATTCATCTTAGTAAATGCACGGCAGATGAGTTTCAACAAG
TAAGTATGTTGGACAACTATTACACTATTTAAACAGTCCTGCACGTTTCG
ATGGTGAAATAAGGGTTTCCAGCGACTTGTGTATATAATATGTTAAGTAT
TACGTTGGTATTTACATTGAAAGTATTAGATGACTTGGACCGAAAAACTA
TTATAATGGGAGGGGTTAAAAAATTTGTTAAAAGGTTTTGGAGCCTATCC
TTTTGATCATCGATTTTGAACCAGGGGCTCTTAATTCTATATACGGCTCT
TCTAATTTTTAAAAGAAATATTCACATTCTCCCCTCTAAAAAATAATTTT
CGCTTTGTGACCTGGGTTGAGAAACACTCCTATAGGAGTCCTATAGGACA
TTCCTATGAAATACGCACTAAGAAAAGTTTTGAATTTCAATATTCATTAC
TAAATCTTAAACTTCTCTGCAAAACCAAATTATTTATTTATTTTTTTTTA
ACAATCTAATTTAATTTTTCTACCATCAAATATTTTTATCTCATCTAAGC
TAACAATATCTGATGCATCATCCAAAGTATCATCAATAGCGCGGTTTTTT
GCTATAAATGCTAAAAATGCTATTTATTATAGTTATGTAAAATTTAAACG
ATTCTGGAAAATTTTTAAATTTTAATCAATTTTTTAATCAATCTTTAATG
TTATTTGGTAAATTAAACCCATACCTCGATCAAAACAGAACGATAATGAT
TTGATCAGAAGATACACTCAACAATGCACACAAGAATTCTGCGTTGGACC
ACACAAAACATTATATTGTAATATTTGTAATACCAGTGTAGATTTTAAAA
AGAAGTTTAACGTGGATGCTCATCGAAAGACCAAACGTCATGTTATACCC
TACAAAACTGTTTTAACACATTCTTTAGTTCTATAGATAAGGAATTTATA
TCTTTGGTGGCGGAAGCATTTTTATTGGCTGATATTCCGCTTGAAAAATT
AAATAATTCAAAGTTAAAGAATTTATTTTTGCGTATGAAACATAAATTAC
CAAGCGAATCGACAGCTCGTAATTACGTAAGCGCAAGTTGATTTAAAAGT
ACAAAGTAAATTACAAAACAGAAAGATTTTTATTGTTTTTGATGAAACCG
AAATACTCGGAAAAAGATATTGTAACGTAATGTGTGGGTGCATAGAATCT
CCGCATGAAATCTGGCTTATAAACTCAGTTGCTATAACAACACCGGCAAA
CTCAACCCTTGTTGTAAGTATAATCAATAATTCTCTCTAAAAATATAATA
ATGTTAAAACTTCTAGTTTTATGATGCTTTTTTCGGATGCAGCATCTTAT
TTGAAAAATGCTGGTGAAGTATACAAATCAAGAAATCATGATTTTCTACA
TGTAAAATGTCTTACCCATTTAATTCATAACAGTTCTATGCGCATTCGTG
CGGCCTATAAAAATATTGATAAAGTTATTGGGAGTTTAAAAGCGCTAACA
ATAAAAAATAAAGAAAGACAAAATCCGTTTTCCGAAATCGGAAGTCCGCC
GTCAGTGGTTTTGACAAGGTGGACAAGCTGGTTACAAGTGGTAATTTACT
ACTGTAAAAGCCTCCTCGCGATTAAGAATATTGTATGAAATATAGGAGAT
GATGGTGTGCAAAATCAGCATAGGCAGAACCCAATCTAATGAAGGATTTA
CTGGTTAAAAAGTGCTATGAAGTATTAATATATACATTAGAAAATCTAGC
ACAAGACCGATATAATATTTCAACGGCCTACTACGAAATCAACAGACTAA
ATTTAAAACATGATCCTCTTGAATTAAATCTAGCTGACAACGATGCTAAA
TCTATTTGCGAACTACAAAACGAAAATATGTCACCAACTATTTATTCTTT
TTTAAGAAATTGTCCCCCTACATCGATTGTAGCAGAAAGGAGTTTCTCAA
TGGTGAAGAGAATATTGACCATAAGCAGAAATTTTGATCCTAAAAATGTG
GCCAATTACATAAATGTGTATTACAATCAAAAAGTGGAAGATGCCAATTT
GCAAGATCAACAGGAAAATGATTGTTTATCATTAAAAAAATAAATGCTAT
TTTTACGAAAATAAATACTATAAAAAACCGCCCTAATTATCAGCAATGAT
GACAAATATTATTGGTAAAATTTGAAATTTTCATCAAATTTACATTTTAA
AATGTTTTCTTAAAAAAAATAAATTAGCAAACATGGCAAAGATTTAATTA
CAAGAAAGCACTATTCAAGCACACGTTTTAATATATATTTCGATAGGTGA
TAACAAACCAAAAGTAGTATGGATTTTAATTTACATATACAAATTATTAT
TTTTTTAATCTTTAAAATTTTTAAAATGAAATATTAAAAATTAAAAATTA
TTTAATTAATACACC
back to top

protein sequence of SMED30003149-orf-1

>SMED30003149-orf-1 ID=SMED30003149-orf-1|Name=SMED30003149-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=106bp
MMLFSDAASYLKNAGEVYKSRNHDFLHVKCLTHLIHNSSMRIRAAYKNID
KVIGSLKALTIKNKERQNPFSEIGSPPSVVLTRWTSWLQVVIYYCKSLLA
IKNIV*
back to top

protein sequence of SMED30003149-orf-2

>SMED30003149-orf-2 ID=SMED30003149-orf-2|Name=SMED30003149-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=135bp
MKDLLVKKCYEVLIYTLENLAQDRYNISTAYYEINRLNLKHDPLELNLAD
NDAKSICELQNENMSPTIYSFLRNCPPTSIVAERSFSMVKRILTISRNFD
PKNVANYINVYYNQKVEDANLQDQQENDCLSLKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0006357regulation of transcription from RNA polymerase II promoter
Vocabulary: molecular function
TermDefinition
GO:0001227transcriptional repressor activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003676nucleic acid binding
GO:0003690double-stranded DNA binding
GO:0046983protein dimerization activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus