Ig-like domain-containing protein

Overview
NameIg-like domain-containing protein
Smed IDSMED30003110
Length (bp)1891
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ig-like domain-containing protein (SMED30003110) t-SNE clustered cells

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30003110) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ig-like domain-containing protein (SMED30003110) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30003110) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003110

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30003110SMESG000018621.1 SmedASXL_008962SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30003110SMESG000018621.1 dd_Smed_v6_10688_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30003110SMESG000018621.1 OX_Smed_1.0.11557ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30003110SMESG000018621.1 dd_Smed_v4_10688_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: LRRC4B (leucine rich repeat containing 4B [Source:HGNC Symbol;Acc:HGNC:25042])

HSP 1 Score: 61.6178 bits (148), Expect = 3.231e-9
Identity = 70/292 (23.97%), Postives = 112/292 (38.36%), Query Frame = 3
Query:  399 VFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXX-XXXXXXXXFSINAFVDL-TVESLHMSQSSIFELPYDXXXXXXXXXXXXXXXXXXXXSLDPRFQVPFKNLQTLYLQGNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQLKIDFQ--SATETELSCSAVQKVDQAPMTVNWFTD----IINGIGEKMFSILNSKSNPTTDRNVHVETVLIQKNNSTDSFQCIAKNLNGNATA 1250
            V L YL +   N+K I  +T   L  L  L+L+ N    I  GSF GL       L +        NAF DL ++E L++S +++  LP+D                            P   L+ ++L  N + C+C + WL+           + K T          C  P  ++G+++ E+  S F C  P + +   D         EL C    +   +  +VNW T     + +G      S+L+       D  ++   V +Q    T  + C+  N  GN TA
Sbjct:  207 VNLRYLNLGMCNLKDIPNLT--ALVRLEELELSGNRLDLIRPGSFQGLTSLRKLWLMHAQVATIERNAFDDLKSLEELNLSHNNLMSLPHD-------------------------LFTPLHRLERVHLNHNPWHCNCDVLWLSW----------WLKETVPSNTTCCARCHAPAGLKGRYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKC----RTGTSMTSVNWLTPNGTLMTHGSYRVRISVLH-------DGTLNFTNVTVQ---DTGQYTCMVTNSAGNTTA 447          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: LRRC4B (leucine rich repeat containing 4B [Source:HGNC Symbol;Acc:HGNC:25042])

HSP 1 Score: 61.6178 bits (148), Expect = 3.231e-9
Identity = 70/292 (23.97%), Postives = 112/292 (38.36%), Query Frame = 3
Query:  399 VFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXX-XXXXXXXXFSINAFVDL-TVESLHMSQSSIFELPYDXXXXXXXXXXXXXXXXXXXXSLDPRFQVPFKNLQTLYLQGNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQLKIDFQ--SATETELSCSAVQKVDQAPMTVNWFTD----IINGIGEKMFSILNSKSNPTTDRNVHVETVLIQKNNSTDSFQCIAKNLNGNATA 1250
            V L YL +   N+K I  +T   L  L  L+L+ N    I  GSF GL       L +        NAF DL ++E L++S +++  LP+D                            P   L+ ++L  N + C+C + WL+           + K T          C  P  ++G+++ E+  S F C  P + +   D         EL C    +   +  +VNW T     + +G      S+L+       D  ++   V +Q    T  + C+  N  GN TA
Sbjct:  207 VNLRYLNLGMCNLKDIPNLT--ALVRLEELELSGNRLDLIRPGSFQGLTSLRKLWLMHAQVATIERNAFDDLKSLEELNLSHNNLMSLPHD-------------------------LFTPLHRLERVHLNHNPWHCNCDVLWLSW----------WLKETVPSNTTCCARCHAPAGLKGRYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKC----RTGTSMTSVNWLTPNGTLMTHGSYRVRISVLH-------DGTLNFTNVTVQ---DTGQYTCMVTNSAGNTTA 447          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: LRRC4B (leucine rich repeat containing 4B [Source:HGNC Symbol;Acc:HGNC:25042])

HSP 1 Score: 61.6178 bits (148), Expect = 3.231e-9
Identity = 70/292 (23.97%), Postives = 112/292 (38.36%), Query Frame = 3
Query:  399 VFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXX-XXXXXXXXFSINAFVDL-TVESLHMSQSSIFELPYDXXXXXXXXXXXXXXXXXXXXSLDPRFQVPFKNLQTLYLQGNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQLKIDFQ--SATETELSCSAVQKVDQAPMTVNWFTD----IINGIGEKMFSILNSKSNPTTDRNVHVETVLIQKNNSTDSFQCIAKNLNGNATA 1250
            V L YL +   N+K I  +T   L  L  L+L+ N    I  GSF GL       L +        NAF DL ++E L++S +++  LP+D                            P   L+ ++L  N + C+C + WL+           + K T          C  P  ++G+++ E+  S F C  P + +   D         EL C    +   +  +VNW T     + +G      S+L+       D  ++   V +Q    T  + C+  N  GN TA
Sbjct:  207 VNLRYLNLGMCNLKDIPNLT--ALVRLEELELSGNRLDLIRPGSFQGLTSLRKLWLMHAQVATIERNAFDDLKSLEELNLSHNNLMSLPHD-------------------------LFTPLHRLERVHLNHNPWHCNCDVLWLSW----------WLKETVPSNTTCCARCHAPAGLKGRYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKC----RTGTSMTSVNWLTPNGTLMTHGSYRVRISVLH-------DGTLNFTNVTVQ---DTGQYTCMVTNSAGNTTA 447          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: si:cabz01090165.1 (si:cabz01090165.1 [Source:ZFIN;Acc:ZDB-GENE-161017-71])

HSP 1 Score: 62.3882 bits (150), Expect = 1.162e-9
Identity = 99/425 (23.29%), Postives = 157/425 (36.94%), Query Frame = 3
Query:  258 SISCTKPGFKEMPQQMSKTTKRFILISQQFTNNFLSRENLTKISPPNVFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXXXXXX-XXXXFSINAFVDL--TVESLHMSQSSIFELPYDXXXXXXX-------------------------XXXXXXXXXXXXXSLDPRF-QVPF------KNLQTLYLQ--GNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQL--KIDFQSATETELSCSAVQKVDQAPMTVNWFTDIINGIGEKMFSILNSKSNPTTDRNVHVET----VLIQKNNSTDSFQCIAKNLNGNATAIVRISWPPSEKF-----PNPNRNVYQSTIDSWQKSEEDNYFFQKRFTLLEM 1388
            ++ C K G   +P  + + T    L+    T+  L   +   +S     L +LT+ ++ I  I+P  F+DL  L AL L  N    +D     GL      +  N      S  AF D   T+E L +S +++ +LP+D +  +                               +  N    I  DP F ++P         L  L L   GN   C+C + WL              + T  D+++   TC  P+ + GK+   I    F C+PP +T+   K+      E  L C +V   D  P+ V+W +              + K    T R V  +     +L      +  F CIA N  G ATA V +   PS  +     P P  +   ++I S            +R T+ E+
Sbjct:   37 TVLCAKTGLLFVPPNIDRQTAELRLMDNFITS--LRHRDFANMSS----LIHLTLSRNTISQIRPYAFADLQDLHALHLDANRLTVLDDTHLQGLVNLRHLILANNQIHSISEGAFQDFLETLEDLDLSYNNLVDLPWDTIAMLASVNTLSLDHNLIEFVPEGIFSNLHKLARLDMTSNKLKKIPPDPLFLRIPVYAKMKGSPLTALVLSFGGNPLHCNCELVWL-------------RRLTREDDLE---TCASPRELAGKYFWTIREEEFVCEPPMITRHTSKMFVMEGQEVSLRCRSVG--DPEPI-VHWISP-------------DGKLIANTSRTVCYDNGSLDILTATVKDSGVFTCIASNAAGEATAPVELVVNPSPHYDPKLEPEPGPSDMPTSIKSNSSGSGGQNRADQRVTVSEI 423          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: si:cabz01090165.1 (si:cabz01090165.1 [Source:ZFIN;Acc:ZDB-GENE-161017-71])

HSP 1 Score: 62.3882 bits (150), Expect = 1.162e-9
Identity = 99/425 (23.29%), Postives = 157/425 (36.94%), Query Frame = 3
Query:  258 SISCTKPGFKEMPQQMSKTTKRFILISQQFTNNFLSRENLTKISPPNVFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXXXXXX-XXXXFSINAFVDL--TVESLHMSQSSIFELPYDXXXXXXX-------------------------XXXXXXXXXXXXXSLDPRF-QVPF------KNLQTLYLQ--GNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQL--KIDFQSATETELSCSAVQKVDQAPMTVNWFTDIINGIGEKMFSILNSKSNPTTDRNVHVET----VLIQKNNSTDSFQCIAKNLNGNATAIVRISWPPSEKF-----PNPNRNVYQSTIDSWQKSEEDNYFFQKRFTLLEM 1388
            ++ C K G   +P  + + T    L+    T+  L   +   +S     L +LT+ ++ I  I+P  F+DL  L AL L  N    +D     GL      +  N      S  AF D   T+E L +S +++ +LP+D +  +                               +  N    I  DP F ++P         L  L L   GN   C+C + WL              + T  D+++   TC  P+ + GK+   I    F C+PP +T+   K+      E  L C +V   D  P+ V+W +              + K    T R V  +     +L      +  F CIA N  G ATA V +   PS  +     P P  +   ++I S            +R T+ E+
Sbjct:   37 TVLCAKTGLLFVPPNIDRQTAELRLMDNFITS--LRHRDFANMSS----LIHLTLSRNTISQIRPYAFADLQDLHALHLDANRLTVLDDTHLQGLVNLRHLILANNQIHSISEGAFQDFLETLEDLDLSYNNLVDLPWDTIAMLASVNTLSLDHNLIEFVPEGIFSNLHKLARLDMTSNKLKKIPPDPLFLRIPVYAKMKGSPLTALVLSFGGNPLHCNCELVWL-------------RRLTREDDLE---TCASPRELAGKYFWTIREEEFVCEPPMITRHTSKMFVMEGQEVSLRCRSVG--DPEPI-VHWISP-------------DGKLIANTSRTVCYDNGSLDILTATVKDSGVFTCIASNAAGEATAPVELVVNPSPHYDPKLEPEPGPSDMPTSIKSNSSGSGGQNRADQRVTVSEI 423          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: lrrc4ba (leucine rich repeat containing 4Ba [Source:ZFIN;Acc:ZDB-GENE-080327-25])

HSP 1 Score: 61.2326 bits (147), Expect = 2.556e-9
Identity = 66/293 (22.53%), Postives = 111/293 (37.88%), Query Frame = 3
Query:  393 PNVFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXXXXXXXXXXFSINAFVDL-TVESLHMSQSSIFELPYDXXXXXXXXXXXXXXXXXXXXSLDPRFQVPFKNLQTLYLQGNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQLKIDFQ--SATETELSCSAVQKVDQAPMTVNWFTD----IINGIGEKMFSILNSKSNPTTDRNVHVETVLIQKNNSTDSFQCIAKNLNGNATA 1250
            P V LE L +  + +++I+P +F  L  LR L L ++    I+                        NAF DL  +E L++S +S+  LP+D                            P + L+ ++L  N + C+C + WL+           + K T          C  P Y++GK++ E+  S F C  P + +   D         EL C    +   +  +VNW T     + +G      S+L+       D  ++   V ++    T  + C+  N  GN TA
Sbjct:  210 PLVRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMSVIER-----------------------NAFDDLKNLEELNLSHNSLHSLPHD-------------------------LFTPLQKLERVHLNHNPWVCNCDVLWLSW----------WLKETVPSNTTCCARCHAPPYLKGKYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKC----RTGTSMTSVNWITPNGTLMTHGSYRVRISVLH-------DGTLNFTNVTLR---DTGQYTCMVTNSAGNTTA 430          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: lrrc4ba (leucine rich repeat containing 4Ba [Source:ZFIN;Acc:ZDB-GENE-080327-25])

HSP 1 Score: 60.8474 bits (146), Expect = 3.222e-9
Identity = 66/293 (22.53%), Postives = 111/293 (37.88%), Query Frame = 3
Query:  393 PNVFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXXXXXXXXXXFSINAFVDL-TVESLHMSQSSIFELPYDXXXXXXXXXXXXXXXXXXXXSLDPRFQVPFKNLQTLYLQGNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQLKIDFQ--SATETELSCSAVQKVDQAPMTVNWFTD----IINGIGEKMFSILNSKSNPTTDRNVHVETVLIQKNNSTDSFQCIAKNLNGNATA 1250
            P V LE L +  + +++I+P +F  L  LR L L ++    I+                        NAF DL  +E L++S +S+  LP+D                            P + L+ ++L  N + C+C + WL+           + K T          C  P Y++GK++ E+  S F C  P + +   D         EL C    +   +  +VNW T     + +G      S+L+       D  ++   V ++    T  + C+  N  GN TA
Sbjct:  210 PLVRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMSVIER-----------------------NAFDDLKNLEELNLSHNSLHSLPHD-------------------------LFTPLQKLERVHLNHNPWVCNCDVLWLSW----------WLKETVPSNTTCCARCHAPPYLKGKYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKC----RTGTSMTSVNWITPNGTLMTHGSYRVRISVLH-------DGTLNFTNVTLR---DTGQYTCMVTNSAGNTTA 430          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: lrrc4ba (leucine rich repeat containing 4Ba [Source:ZFIN;Acc:ZDB-GENE-080327-25])

HSP 1 Score: 60.8474 bits (146), Expect = 3.413e-9
Identity = 66/293 (22.53%), Postives = 111/293 (37.88%), Query Frame = 3
Query:  393 PNVFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXXXXXXXXXXFSINAFVDL-TVESLHMSQSSIFELPYDXXXXXXXXXXXXXXXXXXXXSLDPRFQVPFKNLQTLYLQGNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQLKIDFQ--SATETELSCSAVQKVDQAPMTVNWFTD----IINGIGEKMFSILNSKSNPTTDRNVHVETVLIQKNNSTDSFQCIAKNLNGNATA 1250
            P V LE L +  + +++I+P +F  L  LR L L ++    I+                        NAF DL  +E L++S +S+  LP+D                            P + L+ ++L  N + C+C + WL+           + K T          C  P Y++GK++ E+  S F C  P + +   D         EL C    +   +  +VNW T     + +G      S+L+       D  ++   V ++    T  + C+  N  GN TA
Sbjct:  210 PLVRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMSVIER-----------------------NAFDDLKNLEELNLSHNSLHSLPHD-------------------------LFTPLQKLERVHLNHNPWVCNCDVLWLSW----------WLKETVPSNTTCCARCHAPPYLKGKYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKC----RTGTSMTSVNWITPNGTLMTHGSYRVRISVLH-------DGTLNFTNVTLR---DTGQYTCMVTNSAGNTTA 430          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: lrrc4b (leucine rich repeat containing 4B [Source:NCBI gene;Acc:100124949])

HSP 1 Score: 57.3806 bits (137), Expect = 6.669e-8
Identity = 69/292 (23.63%), Postives = 112/292 (38.36%), Query Frame = 3
Query:  399 VFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXX-XXXXXXXXFSINAFVDL-TVESLHMSQSSIFELPYDXXXXXXXXXXXXXXXXXXXXSLDPRFQVPFKNLQTLYLQGNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQLKIDFQ--SATETELSCSAVQKVDQAPMTVNWFTD----IINGIGEKMFSILNSKSNPTTDRNVHVETVLIQKNNSTDSFQCIAKNLNGNATA 1250
            V L YL +   N+K I  +T   L  L  L+L+ N    I  GSF GL       L +        NAF DL ++E L++S +++  LP+D                            P   L+ ++L  N + C+C + WL+           + K T  +       C  P  ++ +++ E+  S F C  P + +   D         EL C    +   +  +VNW T     + +G      S+L+       D  ++   V +Q    T  + C+  N  GN TA
Sbjct:  192 VNLRYLNLGMCNLKDIPNLT--ALVRLEELELSGNRLEMIRPGSFQGLTSLRKLWLMHAHVTIIERNAFDDLKSLEELNLSHNNLMSLPHD-------------------------LFTPLHRLERVHLNHNPWHCNCDVLWLSW----------WLKETVPNNTTCCARCHSPPNLKMRYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKC----RTGTSMTSVNWLTPNGTLMTHGSYRVRISVLH-------DGTLNFTNVTVQ---DTGQYTCMVTNSAGNTTA 432          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: lrrc4 (leucine rich repeat containing 4 [Source:NCBI gene;Acc:100493671])

HSP 1 Score: 56.6102 bits (135), Expect = 1.000e-7
Identity = 72/291 (24.74%), Postives = 113/291 (38.83%), Query Frame = 3
Query:  405 LEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXX-XXXXXXXXFSINAFVDLT-VESLHMSQSSIFELPYDXXXXXXXXXXXXXXXXXXXXSLDPRFQVPFKNLQTLYLQGNSFDCSCSMKWLT-AVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQLKIDF--QSATETELSCSAVQKVDQAPMTVNWF----TDIINGIGEKMFSILNSKSNPTTDRNVHVETVLIQKNNSTDSFQCIAKNLNGNATA 1250
            L+YL +   NI+ +  +T   L  L  L+++ NN   I  GSF GL+      + N+       NAF DLT +  L+++ +++  LP+D                            P K L  L+L  N +DC C + WL+  +  Y  TN                 C  P +M GK++ E+  S+F C  P +     D         EL C        A  +V W     T + +       +ILN       D  ++   VL+     T  + C+  N+ GN+ A
Sbjct:  192 LKYLNLGMCNIRDMPNLT--PLVGLEELEISGNNFPEIKPGSFHGLRSLKKLWIMNSQINTIERNAFDDLTSLVELNLAHNNVTSLPHD-------------------------LFAPLKYLVELHLHHNPWDCDCDVLWLSWWLREYIPTNST-----------CCGRCHSPPHMRGKYVVEVDHSMFQCSAPFIMDAPRDLNISEGRMAELKCRT-----SAMSSVRWLLPNGTVLTHASNHPRITILN-------DGTLNFSQVLL---TDTGVYTCMVTNVAGNSNA 429          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: rrn3 (RRN3 homolog, RNA polymerase I transcription factor [Source:Xenbase;Acc:XB-GENE-990491])

HSP 1 Score: 55.8398 bits (133), Expect = 1.814e-7
Identity = 92/403 (22.83%), Postives = 159/403 (39.45%), Query Frame = 3
Query:  204 IEAQIDYCGKFCDAC--VEDSIS--CTKPGFKEMPQQMSKTTKRFILISQQFTNNFL---SRENLTKISPPNVFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXXXXXXXXX-XFSINAFVDL--TVESLHMSQSSIFELPYDXXXXXXXXXXXXXXXXXXXXSLDPRFQ----------------------------------VPFKNLQTLYLQGNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQ-----LKIDFQSATETELSCSAVQKVDQAPMTVNWFTDIINGIGEKMFSILNSKSNPTTDRNVHVETVLIQKNNSTDSFQCIAKNLNGNATAIVRIS 1265
            +   ++ C K+C  C  + +S+   C   G   +P  + + T     +  +   NF+   +R++   ++     L  LT+ ++ I  I+P +F DL  LR+L L  N    +    F GL      + NN+ L   + +AF DL  T+E L +S +++  +P+D ++ ++   +    +N      +  FQ                                   PF    +L   GN   C+C + WL  +                D      TC  P  ++G++   +    F C+PP +TQ     L ++ Q+A+   L C AV   D  P+ ++W       IG          S+ TT  +     +LI  +    +F CIA N  G  TA V +S
Sbjct:   13 MAVMVNSCPKYC-VCQNLSESLGTLCPTKGLLFVPMDIDRRT-----VELRLGGNFIISINRQDFANMTG----LVDLTLSRNTISYIQPYSFIDLESLRSLHLDSNRLTNLGDDVFRGLINLQHLIMNNNQLNSIAEDAFEDLLQTLEDLDLSYNNLKTVPWDAVRRMVNLHQLSLDHNLIYYITEGTFQDLNKLARLDLTSNRLQKLPPDPIFARSQISMTSATPFSPPLSLSFGGNPLHCNCELLWLRRL----------------DREDDMETCASPSALKGRYFWYVREEEFVCEPPLITQYTQRLLVLEGQTAS---LKCKAVG--DPLPV-IHWVAPDGRLIG---------NSSRTTVYDNGTLDILITTSKDYGTFTCIAANAAGELTAPVELS 374          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: LRRC4C (leucine rich repeat containing 4C [Source:NCBI gene;Acc:100188921])

HSP 1 Score: 55.4546 bits (132), Expect = 2.114e-7
Identity = 99/462 (21.43%), Postives = 166/462 (35.93%), Query Frame = 3
Query:  405 LEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXX-XXXXXXXXFSINAFVDL-TVESLHMSQSSIFELPYDXXXXXXXXXXXXXXXXXXXXSLDPRFQVPFKNLQTLYLQGNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQLKIDFQ--SATETELSCSAVQKVDQAPMTVNWFTD----IINGIGEKMFSILNSKSNPTTDRNVHVETVLIQKNNSTDSFQCIAKNLNGNATA-------------------IVRISWPPSEKFPNPNRNVYQSTIDSWQKSEEDNYFFQK--RFT--------------------LLEMFGAVFGTF-AITLILFFMIYKFVFINRSTDRKAILPPNGYTTYEAAVYSDSQTYDIPGNSYPQSVLLPMPHLSSTP-DHFIDFKT 1637
            L+YL +   N++ I  +T   L  L  LDL+ N+   +  GSF GL       + ++       NAF DL ++  L+++ +++  LP+D                            P  NLQ + L  N ++C+C + WL+           + K   T        C  P  ++G H+ E+  + F C  P + +   D         EL C A   +      V+W T     + +G  +   S+LN       D  ++   V ++    T  + CI  N  GN TA                    V    P  ++      +V  + +  W+ +        +  RFT                    +++    + G F AITL+   M+  F  + +   RK    P    T E     D  T D P  S+     LPMP +     +H+  +K+
Sbjct:  199 LKYLNLGMCNLRDIPNLT--PLVKLDELDLSGNHLSVLRPGSFQGLTHLQKLWIMHSQIQVIERNAFDDLQSLVELNLAHNNLTLLPHD-------------------------LFTPLHNLQRIQLHHNPWNCNCDILWLSW----------WLKEIVTTGSTCCARCSTPPSLKGTHIAELDHNYFTCYAPVIVEPPADLNVTEGMAAELKCRASTSLTY----VSWITPNGTIMTHGSYKVRISVLN-------DGTLNFTNVTVR---DTGLYTCIVSNSAGNTTASATLNVTASDTGYTYFSTVTVETMEPSQDEARTTETHVGPTPVIDWETTNATTSLMPQSTRFTEKTVTVPVTDANNGMPGIDEVMKTTKIIIGCFVAITLMAAVMLVIFYKMRKQHHRKNHHAPT--RTVEIINVDDELTADTPIESH-----LPMPAIEHEHLNHYNSYKS 602          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: oaz1 (ornithine decarboxylase antizyme 1 [Source:Xenbase;Acc:XB-GENE-490737])

HSP 1 Score: 55.4546 bits (132), Expect = 2.184e-7
Identity = 93/388 (23.97%), Postives = 148/388 (38.14%), Query Frame = 3
Query:  258 SISCTKPGFKEMPQQMSKTTKRFILISQQFTNNFLSRENLTKISPPNVFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXXXXXXXXXXF----SINAFVDLTVESLHMSQSSIFELPYDXXXXXXXXXXX-------------------------XXXXXXXXXSLDPRF-QVPF------KNLQTLYLQ--GNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQL--KIDFQSATETELSCSAVQKVDQAPMTVNWFT---DIINGIGEKMFSILNSKSNPTTDRNVHVETVLIQKNNSTDSFQCIAKNLNGNATAIVRISWPPSEKFPN 1292
            +I CTK G   +P  + + T    L+    T   L R +   ++     L +LT+ ++ I  I P  F DL  L AL L  N    +      GL      + +N+ L +    S + FVD T+E L +S +++ ++P++ +  +                               +  N    I  DP F ++P         L +L L   GN   C+C + WL              + T  D+++   TC  P  + GK+   I    F C+PP +T    K+         L C +V   D     V W +    +++     M     S  N T D    + T+   + N    F CIA N  G +TA V ++  P   FPN
Sbjct:   34 TILCTKTGLLFVPPTIDRRTAELRLMDNFITT--LRRRDFANMTD----LIHLTLSRNTISQIMPYAFVDLKGLHALHLDSNRLTSVSEEHLRGLINLRHLILSNNQLHYIAPGSFDDFVD-TLEDLDLSYNNLVDIPWETIGRLSSVNTVGLDHNLIDYVPEGIFSNLHKLARLDMTSNKLKKIPPDPLFSRIPVYAKSKGSPLTSLVLSFGGNPLHCNCELMWL-------------RRLTREDDLE---TCASPAELMGKYFWSIKEEEFVCEPPMITHRTSKLVIMEGQSASLKCKSVGDPDPY---VRWISPDGKLVSNTSRTM-----SYDNGTLDI---ITTIYADRGN----FTCIASNAAGESTANVELTVNP---FPN 380          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Lrrc4b (leucine rich repeat containing 4B [Source:MGI Symbol;Acc:MGI:3027390])

HSP 1 Score: 61.6178 bits (148), Expect = 2.539e-9
Identity = 70/292 (23.97%), Postives = 112/292 (38.36%), Query Frame = 3
Query:  399 VFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXX-XXXXXXXXFSINAFVDL-TVESLHMSQSSIFELPYDXXXXXXXXXXXXXXXXXXXXSLDPRFQVPFKNLQTLYLQGNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQLKIDFQ--SATETELSCSAVQKVDQAPMTVNWFTD----IINGIGEKMFSILNSKSNPTTDRNVHVETVLIQKNNSTDSFQCIAKNLNGNATA 1250
            V L YL +   N+K I  +T   L  L  L+L+ N    I  GSF GL       L +        NAF DL ++E L++S +++  LP+D                            P   L+ ++L  N + C+C + WL+           + K T          C  P  ++G+++ E+  S F C  P + +   D         EL C    +   +  +VNW T     + +G      S+L+       D  ++   V +Q    T  + C+  N  GN TA
Sbjct:  209 VNLRYLNLGMCNLKDIPNLT--ALVRLEELELSGNRLDLIRPGSFQGLTSLRKLWLMHAQVATIERNAFDDLKSLEELNLSHNNLMSLPHD-------------------------LFTPLHRLERVHLNHNPWHCNCDVLWLSW----------WLKETVPSNTTCCARCHAPAGLKGRYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKC----RTGTSMTSVNWLTPNGTLMTHGSYRVRISVLH-------DGTLNFTNVTVQ---DTGQYTCMVTNSAGNTTA 449          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Igsf10 (immunoglobulin superfamily, member 10 [Source:MGI Symbol;Acc:MGI:1923481])

HSP 1 Score: 57.3806 bits (137), Expect = 5.546e-8
Identity = 65/263 (24.71%), Postives = 107/263 (40.68%), Query Frame = 3
Query:  225 CGKFCDACVEDSISCTKPGFKEMPQQMSKTTKRFILISQQFTNNFLSRENLTKISPPNVFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXXXXXXXXXXFSIN--AFVDLTVESL-HMSQSSIFELPYDXXXXXXXXXXXXXX-------XXXXXXSLDPRFQVPFKNLQTLYLQGNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNL 983
            C + C   V   + CT      +P  +    +R  L     T   L+  + + +S     LE L +  + I  +   TFS L  L+ L ++YN    I+  +  GL+       +++N++F IN  AF  LT+  L H+  + + +L  D    +                ++N L SL         NL++LYL GN + C C +KWL+          K  K       Q  P C  P+  +G+ +  +P   F C  P +
Sbjct:   29 CPRRCACYVPTEVHCTFRYLTSIPDGIPANVERVNLGYNSLTR--LTENDFSGLS----RLELLMLHSNGIHRVSDKTFSGLQSLQVLKMSYNKVQIIEKDTLYGLRSLTRLHLDHNNIEF-INPEAFYGLTLLRLVHLEGNRLTKLHPDTFVSLSYLQIFKTSFIKYLYLSDNFLTSLPKEMVSSMPNLESLYLHGNPWTCDCHLKWLSEWMQGNPDIIKCKKERIPSSPQQCPLCMNPRISKGRSIAMVPSGSFLCTKPTI 284          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Igsf10 (immunoglobulin superfamily, member 10 [Source:MGI Symbol;Acc:MGI:1923481])

HSP 1 Score: 57.3806 bits (137), Expect = 5.546e-8
Identity = 65/263 (24.71%), Postives = 107/263 (40.68%), Query Frame = 3
Query:  225 CGKFCDACVEDSISCTKPGFKEMPQQMSKTTKRFILISQQFTNNFLSRENLTKISPPNVFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXXXXXXXXXXFSIN--AFVDLTVESL-HMSQSSIFELPYDXXXXXXXXXXXXXX-------XXXXXXSLDPRFQVPFKNLQTLYLQGNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNL 983
            C + C   V   + CT      +P  +    +R  L     T   L+  + + +S     LE L +  + I  +   TFS L  L+ L ++YN    I+  +  GL+       +++N++F IN  AF  LT+  L H+  + + +L  D    +                ++N L SL         NL++LYL GN + C C +KWL+          K  K       Q  P C  P+  +G+ +  +P   F C  P +
Sbjct:   29 CPRRCACYVPTEVHCTFRYLTSIPDGIPANVERVNLGYNSLTR--LTENDFSGLS----RLELLMLHSNGIHRVSDKTFSGLQSLQVLKMSYNKVQIIEKDTLYGLRSLTRLHLDHNNIEF-INPEAFYGLTLLRLVHLEGNRLTKLHPDTFVSLSYLQIFKTSFIKYLYLSDNFLTSLPKEMVSSMPNLESLYLHGNPWTCDCHLKWLSEWMQGNPDIIKCKKERIPSSPQQCPLCMNPRISKGRSIAMVPSGSFLCTKPTI 284          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Igsf10 (immunoglobulin superfamily, member 10 [Source:MGI Symbol;Acc:MGI:1923481])

HSP 1 Score: 57.3806 bits (137), Expect = 5.546e-8
Identity = 65/263 (24.71%), Postives = 107/263 (40.68%), Query Frame = 3
Query:  225 CGKFCDACVEDSISCTKPGFKEMPQQMSKTTKRFILISQQFTNNFLSRENLTKISPPNVFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXXXXXXXXXXFSIN--AFVDLTVESL-HMSQSSIFELPYDXXXXXXXXXXXXXX-------XXXXXXSLDPRFQVPFKNLQTLYLQGNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNL 983
            C + C   V   + CT      +P  +    +R  L     T   L+  + + +S     LE L +  + I  +   TFS L  L+ L ++YN    I+  +  GL+       +++N++F IN  AF  LT+  L H+  + + +L  D    +                ++N L SL         NL++LYL GN + C C +KWL+          K  K       Q  P C  P+  +G+ +  +P   F C  P +
Sbjct:   29 CPRRCACYVPTEVHCTFRYLTSIPDGIPANVERVNLGYNSLTR--LTENDFSGLS----RLELLMLHSNGIHRVSDKTFSGLQSLQVLKMSYNKVQIIEKDTLYGLRSLTRLHLDHNNIEF-INPEAFYGLTLLRLVHLEGNRLTKLHPDTFVSLSYLQIFKTSFIKYLYLSDNFLTSLPKEMVSSMPNLESLYLHGNPWTCDCHLKWLSEWMQGNPDIIKCKKERIPSSPQQCPLCMNPRISKGRSIAMVPSGSFLCTKPTI 284          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9NT99|LRC4B_HUMAN (Leucine-rich repeat-containing protein 4B OS=Homo sapiens OX=9606 GN=LRRC4B PE=2 SV=3)

HSP 1 Score: 61.6178 bits (148), Expect = 1.552e-8
Identity = 70/292 (23.97%), Postives = 112/292 (38.36%), Query Frame = 3
Query:  399 VFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXX-XXXXXXXXFSINAFVDL-TVESLHMSQSSIFELPYDXXXXXXXXXXXXXXXXXXXXSLDPRFQVPFKNLQTLYLQGNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQLKIDFQ--SATETELSCSAVQKVDQAPMTVNWFTD----IINGIGEKMFSILNSKSNPTTDRNVHVETVLIQKNNSTDSFQCIAKNLNGNATA 1250
            V L YL +   N+K I  +T   L  L  L+L+ N    I  GSF GL       L +        NAF DL ++E L++S +++  LP+D                            P   L+ ++L  N + C+C + WL+           + K T          C  P  ++G+++ E+  S F C  P + +   D         EL C    +   +  +VNW T     + +G      S+L+       D  ++   V +Q    T  + C+  N  GN TA
Sbjct:  207 VNLRYLNLGMCNLKDIPNLT--ALVRLEELELSGNRLDLIRPGSFQGLTSLRKLWLMHAQVATIERNAFDDLKSLEELNLSHNNLMSLPHD-------------------------LFTPLHRLERVHLNHNPWHCNCDVLWLSW----------WLKETVPSNTTCCARCHAPAGLKGRYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKC----RTGTSMTSVNWLTPNGTLMTHGSYRVRISVLH-------DGTLNFTNVTVQ---DTGQYTCMVTNSAGNTTA 447          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|P0C192|LRC4B_MOUSE (Leucine-rich repeat-containing protein 4B OS=Mus musculus OX=10090 GN=Lrrc4b PE=1 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.776e-8
Identity = 70/292 (23.97%), Postives = 112/292 (38.36%), Query Frame = 3
Query:  399 VFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXX-XXXXXXXXFSINAFVDL-TVESLHMSQSSIFELPYDXXXXXXXXXXXXXXXXXXXXSLDPRFQVPFKNLQTLYLQGNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQLKIDFQ--SATETELSCSAVQKVDQAPMTVNWFTD----IINGIGEKMFSILNSKSNPTTDRNVHVETVLIQKNNSTDSFQCIAKNLNGNATA 1250
            V L YL +   N+K I  +T   L  L  L+L+ N    I  GSF GL       L +        NAF DL ++E L++S +++  LP+D                            P   L+ ++L  N + C+C + WL+           + K T          C  P  ++G+++ E+  S F C  P + +   D         EL C    +   +  +VNW T     + +G      S+L+       D  ++   V +Q    T  + C+  N  GN TA
Sbjct:  209 VNLRYLNLGMCNLKDIPNLT--ALVRLEELELSGNRLDLIRPGSFQGLTSLRKLWLMHAQVATIERNAFDDLKSLEELNLSHNNLMSLPHD-------------------------LFTPLHRLERVHLNHNPWHCNCDVLWLSW----------WLKETVPSNTTCCARCHAPAGLKGRYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKC----RTGTSMTSVNWLTPNGTLMTHGSYRVRISVLH-------DGTLNFTNVTVQ---DTGQYTCMVTNSAGNTTA 449          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|P0CC10|LRC4B_RAT (Leucine-rich repeat-containing protein 4B OS=Rattus norvegicus OX=10116 GN=Lrrc4b PE=1 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.791e-8
Identity = 70/292 (23.97%), Postives = 112/292 (38.36%), Query Frame = 3
Query:  399 VFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXX-XXXXXXXXFSINAFVDL-TVESLHMSQSSIFELPYDXXXXXXXXXXXXXXXXXXXXSLDPRFQVPFKNLQTLYLQGNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQLKIDFQ--SATETELSCSAVQKVDQAPMTVNWFTD----IINGIGEKMFSILNSKSNPTTDRNVHVETVLIQKNNSTDSFQCIAKNLNGNATA 1250
            V L YL +   N+K I  +T   L  L  L+L+ N    I  GSF GL       L +        NAF DL ++E L++S +++  LP+D                            P   L+ ++L  N + C+C + WL+           + K T          C  P  ++G+++ E+  S F C  P + +   D         EL C    +   +  +VNW T     + +G      S+L+       D  ++   V +Q    T  + C+  N  GN TA
Sbjct:  209 VNLRYLNLGMCNLKDIPNLT--ALVRLEELELSGNRLDLIRPGSFQGLTSLRKLWLMHAQVATIERNAFDDLKSLEELNLSHNNLMSLPHD-------------------------LFTPLHRLERVHLNHNPWHCNCDVLWLSW----------WLKETVPSNTTCCARCHAPAGLKGRYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKC----RTGTSMTSVNWLTPNGTLMTHGSYRVRISVLH-------DGTLNFTNVTVQ---DTGQYTCMVTNSAGNTTA 449          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A5P8I4L0 (PXDN-like protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 3.436e-46
Identity = 146/507 (28.80%), Postives = 249/507 (49.11%), Query Frame = 3
Query:  198 GQIEAQIDYCGKFCD--ACVEDSISCTKPGFKEMPQQMSKTTKRFILISQQFTNNFLSRENLTKISPPNVFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXXXXXXXXXXFSINAFVDLTVESLHMSQSSIFELPYDXXXXXXXXXXXXXXXXXXXXSLDPRFQVPFKNLQTLYLQGNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQLKIDFQSATETELSCSAVQKVDQAPMTVNWFTDIINGIGEKMFSILNSKSNPTTDRNVHVETVLIQKNNSTDSFQCIAKNLNGNATAIVRISWP-----------------PSEK---FPNPNRNVYQSTIDSWQKSEEDNYFFQKRFTLLEMFGAVFGTFAITLILFFMIYKFVFIN-RSTDRKAILPPNGYTTYEAAVYSDSQTYDIPGNS---YPQSVLLPMPHLSSTPDHFIDFKTQ 1640
             +  A  + C   C   AC    ++CT  G  ++P  + + T + I+ +Q+F++  L+  N +   PPN  +E + ++   +  I    FS LT LR LDL++N    I   +F  L L+ L+LD+N  ++F   +F  L V  L +   ++ EL +++   I   LKKL + NN L  +D RF++ F+NL  L +  N F+C+C+++WL +V V R    K    + +  I +   C  P  ++GK + ++ L  F+CD P L  + +   S +  +L+C +  K   +P  + W T+  N    ++ SI  +             ++ + + +  D ++C+ KN N   T ++ I WP                 P++     PN N  ++  ++           F++K+FTLLEM G V GTF IT+ILF  IY+ + +  +  D+K       Y +YE A+ SDSQTYDIP N+   Y    LL  P+   +P  ++D+ + 
Sbjct:   17 AKTSAHFNPCPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALHLQFLRLDDNKMIQFHRFSFRGLNVAELSLFDCNLTELDFEVFSEISERLKKLILTNNKLNVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSR---KKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRLKLIDVFMTSTSSAKLTCISEPKAHSSPDVI-WMTEHKNTYVPEIQSIEKA-------------SLSVLRKSRIDKYKCVIKNNNDYVTVVISIHWPVKRVNNASQSLNTLGVSPNDMIPYLPNANSTLHVRSV-----------FYEKQFTLLEMIGGVVGTFTITMILFLCIYRHLAMTMKRNDKK-----KWYLSYETAIGSDSQTYDIPNNTAGLYFPGQLLTNPY---SPARYLDYNSH 487          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A0R3SAT8 (Ig-like domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS1502 PE=4 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 4.802e-41
Identity = 153/520 (29.42%), Postives = 231/520 (44.42%), Query Frame = 3
Query:  207 EAQIDYCGKFCDACVEDSISCTKPGFKEM-PQQMSKTTKRFILISQQFTNNFLSRENLTKISPPNVFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXXXXXXXXXXFSINAFVDLTVESLHMSQSSIFELPYDXXX--XXXXXXXXXXXXXXXXXSLDPRFQVPFKNLQTLYLQGNSFDCSCSMKWLTAVY--VYRTTNGKYNKGTFTDEI-----QSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQLKIDFQS-------ATETELSCSAVQKVDQAP-MTVNWFTDIINGIGEKMFSILNSKSNPTTDRNVHVETVLIQKNNSTDS------FQCIAKNLNGNATAIVRISWP-----PSEKFPNPNRNV-----------YQSTIDSWQKSEEDNYFFQKRFTLLEMFGAVFGTFAITLILFFMIYKFVFINRSTDRKAILPPNGYTTYEAAVYSDSQTYDIPGNSYPQSVLLPMPHLSSTPDHFIDFKTQKR 1646
            E + D   + CD C+  SISC + G   M P  +    ++ I++SQ+F + FLSR N++  S P   ++ LTI    ++ I+  TFS L  L  LDL+ N+   I   +FSGL+L LL+LD+N  L     AF +LTV SL M    +  L +++ +       L  L + +N+L +LD RF+  F+NL  L L  N F C C + WL+ +     R  N         D +        P C+ P  + GK +  +  S F C PP +  L++DF S       A  T            +P M + WF     G G    S L   S    +  V V   L+ KN+++DS      F C+  +  GN +A + + WP      + K  +P++              +     +Q    D +FF K+FT+LE+ GAV GTF  T++LF M Y  +++              Y     A       Y +   S PQ       HL +  +H  D  T+KR
Sbjct:   25 EVRADEVCQICDGCIYGSISCQEAGRLHMLPNDLPSGIRKVIIVSQRFDSQFLSRPNISSYSLPGSEIQELTIMDCGLRAIESRTFSGLNSLTKLDLSKNSLSRIQGNTFSGLRLDLLRLDDNQGLTLDAEAFENLTVSSLSMQNCGLRSLSFEVFRPLLQSGTLTTLRLTSNSLTTLDARFEPFFRNLSFLSLAKNPFVCDCKLMWLSRILQRKRRADNDDAFPMINDDRLLIEPDDDHPICESPGRLRGKQIVSLASSDFYCGPPQMRALEVDFTSLRVGGSEAVNTTAGILIKCAAQGSPEMQLTWFRRDRWGAGLIPLSGLRQISPGVVE--VSVSRSLLAKNSTSDSEDSGELFTCMGIDTYGNTSADLFLKWPTLPTNSAVKPQSPDKRSSLESSSSDTFYLEGEQQRFQTDRLDEFFFMKKFTILELIGAVVGTFTATIMLFLMGYILLYVRHRQQYPKSPSKTVYPLVSNAGLPKFPDYHVL-ESSPQRQF--QSHLEAIGNHSCDISTEKR 539          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A0R3TNY6 (Ig-like domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS9134 PE=4 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 7.284e-40
Identity = 137/461 (29.72%), Postives = 218/461 (47.29%), Query Frame = 3
Query:  207 EAQIDYCGKFCDACVEDSISCTKPGFKEM-PQQMSKTTKRFILISQQFTNNFLSRENLTKISPPNVFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXXXXXXXXXXFSINAFVDLTVESLHMSQSSIFELPYD--XXXXXXXXXXXXXXXXXXXXSLDPRFQVPFKNLQTLYLQGNSFDCSCSMKWLT-AVYVYRTTNGKYNKGTFTDEI------QSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQLKIDFQS----ATET-------ELSCSAVQKVDQAPMTVNWFTDIINGIGEKMFSILNSKSNPTTDRNVHVETVLIQKNNSTDS------FQCIAKNLNGNATAIVRISWP-----------PSEKFPNP-----NRNVYQSTIDSWQKSEEDNYFFQKRFTLLEMFGAVFGTFAITLILFFMIYKFVFI 1460
            E + D   + CD C+  SISC + G   M P  +    ++ I++SQ+F + FLSR+N++  S P   ++ LTI    ++ I+  TFS L  L  LD++ N+   I   +FSGL+L LL+LD+N  L     AF +LTV SL M    +  L ++          L  L + +N+L +LD RF+  F+NL  L L  N F C C + WL+  +   R  +         D+I         P C+ P  + GK +  +  + F C PP +  L++DF S      ET        + C+A    +   M + WF    +  G  +  +  SK        V +   L+ KN++  S      F C+  +  GN +A + + WP           PS+K  +P     + +  +    S++    D +FF K+FT+LE+ GAV GTF  T++LF M Y  +++
Sbjct:   25 EIKADEVCQICDGCIYGSISCQEAGRLHMLPNDLPPGIRKVIIVSQRFDSQFLSRQNISSYSLPGTVIQELTIMDCGLRAIESRTFSGLNSLTKLDVSKNSLSRIQGNTFSGLRLDLLRLDDNQGLTLDAEAFENLTVSSLSMQNCGLRSLSFEVFRPLLQSGTLTTLRLTSNSLTTLDIRFEPFFRNLSFLSLAKNPFTCDCKLMWLSRTLQRKRREDNDDAFPMINDDILLIEPDDDHPICESPSRLRGKQIVTLASTDFYCGPPQMKALEVDFSSFRVGGGETVNTTAGIVIKCAAQGSPE---MQLAWFQR--DRWGNGLVPLSGSKHVSPGVVEVSISRSLLAKNSTGGSEELGELFTCMGIDTYGNTSADLSLRWPAFQPTSIVPSQPSDKRNSPVPPAGDADYLEVDQKSFKTDRLDEFFFMKKFTVLELIGAVVGTFTATIMLFLMGYILLYM 480          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A068YC11 (Variable lymphocyte receptor OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000739800 PE=4 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 1.636e-38
Identity = 140/462 (30.30%), Postives = 216/462 (46.75%), Query Frame = 3
Query:  198 GQIEAQIDYCGKFCDACVEDSISCTKPGFKEM-PQQMSKTTKRFILISQQFTNNFLSRENLTKISPPNVFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXXXXXXXXXXFSINAFVDLTVESLHMSQSSIFELPYDXXX--XXXXXXXXXXXXXXXXXSLDPRFQVPFKNLQTLYLQGNSFDCSCSMKWL--TAVYVYRTTNGKYNKGTFTDEI-----QSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQLKIDF------QSATETELSCSAVQKVDQAP--MTVNWFTDIINGIGEKMFSILNSKSNPTTDRNVHVETVLIQKNNSTDS------FQCIAKNLNGNATAIVRISWPPSEKFPNP-------NRNVYQ-STIDS---------WQKSEEDNYFFQKRFTLLEMFGAVFGTFAITLILFFMIYKFVFI 1460
            G+I A  D   + C+ C   SISC +     M P  +    ++ I++SQ+F + FLSR+N++  + P V +  LTI    ++ I+  TFS L+ L  LDL+ N+   I   +FSGL+L LL+LD+N  L     AF +LTV SL M    +  L Y++ +       L  L + +N+L +LD RF+  F+NL  L L  N F C C + WL  T     R  +    +    D +        P C+ P ++ GKH+  +    F C PP +  L++DF      QS T        ++   Q    M + WF     G        L   ++   +  V +   L  KN+ +++      F C+  +  GN +A + + WP               NRN  + S+ DS         +Q    D YFF K+FT+LE+ GAV GTF  T++LF M Y  +++
Sbjct:   24 GEITA--DEVCRICEGCTYGSISCQEADLLHMLPNNLPNGIEKVIIVSQRFDSQFLSRQNISSYTLPGVNIHELTIMHCGLRAIEAGTFSGLSSLTKLDLSKNSLSRIQGHTFSGLRLDLLRLDDNQGLTLDSEAFENLTVSSLSMQNCGLRSLSYEVFQPLVQSRSLTTLRLTSNSLTTLDARFEPFFRNLSFLSLARNPFVCDCKLVWLSRTLQRKRRADSDDAFRRLNDDRLLIVPDDDHPVCESPNHLRGKHIVSLSTRDFFCGPPQMRALEVDFSDLRVGQSETFNMTGVVLIKCAAQGSPEMQLAWFRRDRRGGEPIRLPGLRQVASGVVE--VSISHSLFAKNSKSETEDAGQLFTCLGVDTYGNTSADLSLRWPALPLLSPLPSSPTSNNRNPMEPSSGDSKYLNNDKGYFQSDRLDEYFFMKKFTILELIGAVVGTFTATILLFLMGYILLYM 481          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: W6U6F3 (Immunoglobulin superfamily member OS=Echinococcus granulosus OX=6210 GN=EGR_08348 PE=4 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 3.990e-38
Identity = 138/462 (29.87%), Postives = 219/462 (47.40%), Query Frame = 3
Query:  198 GQIEAQIDYCGKFCDACVEDSISCTKPGFKEM-PQQMSKTTKRFILISQQFTNNFLSRENLTKISPPNVFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXXXXXXXXXXFSINAFVDLTVESLHMSQSSIFELPYDXXX--XXXXXXXXXXXXXXXXXSLDPRFQVPFKNLQTLYLQGNSFDCSCSMKWL--TAVYVYRTTNGKYNKGTFTDEI-----QSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQLKIDF------QSATETELSCSAVQKVDQAP--MTVNWFTDIINGIGEKMFSILNSKSNPTTDRNVHVETVLIQKNNSTDS------FQCIAKNLNGNATAIVRISWPPSEKFPNP-------NRNVYQ-STIDS---------WQKSEEDNYFFQKRFTLLEMFGAVFGTFAITLILFFMIYKFVFI 1460
            G+I A  D   + C+ C   SISC +     M P  +    ++ I++SQ+F + FLSR+N++  + P V +  LTI    ++ I+  TFS L+ L  LDL+ N+   I   +FSGL+L LL+LD+N  L     AF +LTV SL M    +  L Y++ +       L  L + +N+L +LD RF+  F+NL  L L  N F C C + WL  T     R  +    +    D +        P C+ P  + GK +  +    F C PP +  L++DF      QS T        ++   Q    M + WF    +G G++   +   +   +    V +   L+ KN+++++      F C+  +  GN +A + + WP               NRN  + S+ DS         +Q    D +FF K+FT+LE+ GAV GTF  T++LF M Y  +++
Sbjct:   24 GEITA--DEVCRICEGCTYGSISCQEADLLHMLPNDLPNGIEKVIIVSQRFDSQFLSRQNISSYTLPGVNIHELTIMHCGLRAIEAGTFSGLSSLTKLDLSKNSLSRIQGHTFSGLRLDLLRLDDNQGLTLDSEAFENLTVSSLSMQNCGLRSLSYEVFQPLVQSRSLTTLRLTSNSLTTLDARFEPFFRNLSFLSLARNPFVCDCKLVWLSQTLQRKRRADSDDAFRRLNDDRLLIVPDDDHPVCESPNRLRGKQIVSLSTRDFFCGPPQMRTLEVDFSDLRVGQSETFNMTGVVLIKCAAQGSPEMQLAWFRR--DGRGDEPIRLPGLRQVASGVVEVSISHSLLAKNSNSETEDAGQLFTCLGVDTYGNTSADLSLRWPALPLLSPLPSSPTSNNRNPMEPSSGDSKYLNNDKGYFQSDHLDEFFFMKKFTILELIGAVVGTFTATILLFLMGYILLYM 481          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: lrfn4b (leucine rich repeat and fibronectin type III domain containing 4b [Source:ZFIN;Acc:ZDB-GENE-070705-473])

HSP 1 Score: 63.1586 bits (152), Expect = 7.148e-10
Identity = 80/336 (23.81%), Postives = 138/336 (41.07%), Query Frame = 3
Query:  414 LTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXXXXXXXXXX-FSINAFVD--LTVESLHMSQSSIFELPYDXXXXXXX-------------------------XXXXXXXXXXXXXSLDPRFQ---------VPFKNLQTLYLQGNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQ--LKIDFQSATETELSCSAVQKVDQAPMTVNWFTDIINGIGEKMFSILNSKSNPTTDRNVHVETVLIQKNNSTDSFQCIAKNLNGNATAIVRISWPPSEKFPNPNRN 1304
            LT+ ++ I  IKPM F DL  LR+L L  N  + +      G+      + NN+ L   S +AF D  LT+E L +S +++ + P+D ++ +                               +  N    +  DP F           P+ ++ +L   GN   C+C + WL  +               +D+++   TC  P ++ G++   IP   F C+PP +T+   K+         L C A+   D  P+ V+W +            I+ + S  T+ RN  +E +L+       ++ CIA N  G ATA++ +     +  P P+R 
Sbjct:  176 LTLSRNTINFIKPMAFGDLESLRSLHLDGNRLMSLGPRDLMGMLNLQHLILNNNQLINISSDAFDDFLLTLEDLDLSYNNLRKAPWDAIQNMASLHTLNLDHNLIDQIAEGSFSELYKLARLDMTSNRLQTLPPDPLFARSQTGVISPTPYNSVVSLNFGGNPLHCNCELLWLRRLI-------------RSDDME---TCATPIHLAGRYFWSIPEEEFICEPPLITRHTHKLWVLEGQRATLKCRAIG--DPEPV-VHWVS--------PDDRIIANSSRTTSFRNGTLE-LLVTVARDDGAYTCIAINAAGEATAVIDL-----KVIPLPHRG 478          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: lrrc4ba (leucine-rich repeat-containing protein 4B-like [Source:NCBI gene;Acc:103034410])

HSP 1 Score: 62.7734 bits (151), Expect = 7.460e-10
Identity = 66/293 (22.53%), Postives = 112/293 (38.23%), Query Frame = 3
Query:  393 PNVFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXXXXXXXXXXFSINAFVDL-TVESLHMSQSSIFELPYDXXXXXXXXXXXXXXXXXXXXSLDPRFQVPFKNLQTLYLQGNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQLKIDFQ--SATETELSCSAVQKVDQAPMTVNWFTD----IINGIGEKMFSILNSKSNPTTDRNVHVETVLIQKNNSTDSFQCIAKNLNGNATA 1250
            P V LE L +  + +++I+P +F  L  LR L L ++    I+                        NAF DL ++E L++S +S+  LP+D                            P + L+ ++L  N + C+C + WL+           + K T          C  P Y++GK++ E+  S F C  P + +   D         EL C    +   +  +VNW T     + +G      S+L+       D  ++   V ++    T  + C+  N  GN TA
Sbjct:  210 PLVRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMTVIER-----------------------NAFDDLKSLEELNLSHNSLHSLPHD-------------------------LFTPLQKLERVHLNHNPWVCNCDVLWLSW----------WLKETVPSNTTCCARCHAPPYLKGKYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKC----RTGTSMTSVNWITPNGTLMTHGSYRVRISVLH-------DGTLNFTNVTLRD---TGQYTCMVTNSAGNTTA 430          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: lrrc4ba (leucine-rich repeat-containing protein 4B-like [Source:NCBI gene;Acc:103034410])

HSP 1 Score: 62.7734 bits (151), Expect = 7.460e-10
Identity = 66/293 (22.53%), Postives = 112/293 (38.23%), Query Frame = 3
Query:  393 PNVFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXXXXXXXXXXFSINAFVDL-TVESLHMSQSSIFELPYDXXXXXXXXXXXXXXXXXXXXSLDPRFQVPFKNLQTLYLQGNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQLKIDFQ--SATETELSCSAVQKVDQAPMTVNWFTD----IINGIGEKMFSILNSKSNPTTDRNVHVETVLIQKNNSTDSFQCIAKNLNGNATA 1250
            P V LE L +  + +++I+P +F  L  LR L L ++    I+                        NAF DL ++E L++S +S+  LP+D                            P + L+ ++L  N + C+C + WL+           + K T          C  P Y++GK++ E+  S F C  P + +   D         EL C    +   +  +VNW T     + +G      S+L+       D  ++   V ++    T  + C+  N  GN TA
Sbjct:  210 PLVRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMTVIER-----------------------NAFDDLKSLEELNLSHNSLHSLPHD-------------------------LFTPLQKLERVHLNHNPWVCNCDVLWLSW----------WLKETVPSNTTCCARCHAPPYLKGKYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKC----RTGTSMTSVNWITPNGTLMTHGSYRVRISVLH-------DGTLNFTNVTLRD---TGQYTCMVTNSAGNTTA 430          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: lrrc4ba (leucine-rich repeat-containing protein 4B-like [Source:NCBI gene;Acc:103034410])

HSP 1 Score: 62.3882 bits (150), Expect = 1.054e-9
Identity = 66/293 (22.53%), Postives = 112/293 (38.23%), Query Frame = 3
Query:  393 PNVFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXXXXXXXXXXFSINAFVDL-TVESLHMSQSSIFELPYDXXXXXXXXXXXXXXXXXXXXSLDPRFQVPFKNLQTLYLQGNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQLKIDFQ--SATETELSCSAVQKVDQAPMTVNWFTD----IINGIGEKMFSILNSKSNPTTDRNVHVETVLIQKNNSTDSFQCIAKNLNGNATA 1250
            P V LE L +  + +++I+P +F  L  LR L L ++    I+                        NAF DL ++E L++S +S+  LP+D                            P + L+ ++L  N + C+C + WL+           + K T          C  P Y++GK++ E+  S F C  P + +   D         EL C    +   +  +VNW T     + +G      S+L+       D  ++   V ++    T  + C+  N  GN TA
Sbjct:  197 PLVRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMTVIER-----------------------NAFDDLKSLEELNLSHNSLHSLPHD-------------------------LFTPLQKLERVHLNHNPWVCNCDVLWLSW----------WLKETVPSNTTCCARCHAPPYLKGKYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKC----RTGTSMTSVNWITPNGTLMTHGSYRVRISVLH-------DGTLNFTNVTLR---DTGQYTCMVTNSAGNTTA 417          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: lrfn2b (leucine-rich repeat and fibronectin type-III domain-containing protein 2 [Source:NCBI gene;Acc:103024250])

HSP 1 Score: 53.9138 bits (128), Expect = 4.722e-7
Identity = 93/395 (23.54%), Postives = 159/395 (40.25%), Query Frame = 3
Query:  225 CGKFCDAC--VEDSIS--CTKPGFKEMPQQMSKTTKRFILISQQFTNNFLSRENLTKISPPNVF-LEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXXXXXX-XXXXFSINAFVDL--TVESLHMSQSSIFELPYDXXXXX-------------------------XXXXXXXXXXXXXXXSLDPRFQ---------VPFKNLQTLYLQGNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQ-----LKIDFQSATETELSCSAVQKVDQAPMTVNWFTDIINGIGEKMFSILNSKSNPTTDRNVHVE-TVLIQKNNSTDSFQCIAKNLNGNATAIVRIS 1265
            C K+C  C  + +S+   C   G   +P  + + T     +  +   NF+ R  +T+    N+  L  LT+ ++ I  I+P +F DL  LR+L +  N  + + +    GL      + NN    + +  AF DL   +E L +S +++  LP+D ++ +                               L  N    +  DP F           PF    +L + GN   C+C + W             + +    D+++   TC  P  ++G++   +    F C+ P +TQ     L ++ Q+A+   L C A+   D AP T++W              +L + S     RN  +E T+   K N    F CIA N+ G +TA V +S
Sbjct:   21 CPKYC-MCQNLSESLGTLCPAKGLLFVPPDIDRRT-----VELRLGGNFILR--ITQQDFANMSDLVDLTLSRNTISYIQPFSFGDLETLRSLHMDNNRLVELGADDLRGLVNLQHLILNNNQLGRINERAFEDLVAALEDLDLSYNNLQALPWDSVRQMVNLHQLSLDHNLLDYIPEGTFVDLERLARLDLTSNRLQKLPPDPIFARAQDSSLMTTPFAPQLSLSVGGNPLHCNCELLW-------------FRRLERDDDLE---TCASPPGLKGRYFWNVREDEFMCEQPLITQHTHRLLVLEGQTAS---LRCEAIG--DPAP-TIHWVA--------PDDRLLGNSSRTVVHRNGTLEITITTSKENGV--FTCIAANVAGESTASVELS 375          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: lrfn5a (leucine rich repeat and fibronectin type III domain containing 5a [Source:ZFIN;Acc:ZDB-GENE-080327-17])

HSP 1 Score: 50.8322 bits (120), Expect = 7.727e-7
Identity = 49/185 (26.49%), Postives = 76/185 (41.08%), Query Frame = 3
Query:  771 LYLQGNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQ-----LKIDFQSATETELSCSAVQKVDQAPMTVNWFTDIINGIGEKMFSILNSKSNPTTDRNVHVETVLIQKNNSTDSFQCIAKNLNGNATAIVRISWPPSEKFPNPNRNVY 1310
            L   GN   C+C + WL              + T  D+++   TC  P+ + GK+   IP   F C+PP +T+     L ++ Q AT   L C A+   D     V+W +       EK+ S   + +      N  +E +L+       +F CIA N  G +T  V +S        N   NV+
Sbjct:  236 LNFGGNPLHCNCELLWL-------------RRLTREDDLE---TCASPQALVGKYFWSIPEEEFVCEPPLITRHTHRLLVLEGQRAT---LKCKAIGDPDPW---VHWISP-----DEKVIS---NTTRTVVHDNGTLE-ILVTTTKDDGTFTCIASNPAGESTTFVELSIIHLPHLSNITHNVH 389          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: si:cabz01090165.1 (leucine-rich repeat and fibronectin type III domain-containing protein 1-like protein [Source:NCBI gene;Acc:101172994])

HSP 1 Score: 67.3958 bits (163), Expect = 2.605e-11
Identity = 103/405 (25.43%), Postives = 157/405 (38.77%), Query Frame = 3
Query:  258 SISCTKPGFKEMPQQMSKTTKRFILISQQFTNNFLSRENLTKISPPNVFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXXXXXX-XXXXFSINAFVDL--TVESLHMSQSSIFELPYDXXXXXXX-------------------------XXXXXXXXXXXXXSLDPRF-QVPF------KNLQTLYLQ--GNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQL--KIDFQSATETELSCSAVQKVDQAPMTVNWFTDIINGIGEKMFSILNSKSNPTTDRNVHVE--TVLIQKNNSTDS--FQCIAKNLNGNATAIVRISWPPSEKF-----PNPNRNVYQSTIDS 1328
            ++ C K G   +P  + + T    L+    T   L   +   +S     L +LT+ ++ I  I+P TF+DL  L AL +  N    +D   F GL      +  N      S  AF D   T+E L +S +++ ++P+D +  ++                              +  N    I  DP F ++P         L  L L   GN   C+C + WL  V             T  D+++   TC  PK + GK+   I    F C+PP +T+   K+      E  L C ++   D  P T +W +     IG              T R V  E  ++ I K +  DS  F CIA N  G ATA V +   PS  F     P+P  +   ++I S
Sbjct:   40 TVLCAKTGLLFVPPNIDRQTAELRLMDNFITT--LRHRDFANMSS----LIHLTLSRNTISQIRPYTFADLQELHALHMDANRLTVLDDSHFQGLVNLRHLILANNQLHSISEGAFQDFLETLEDLDLSYNNLVDIPWDTIALLVSVNTLSLDHNLIESVPEGIFSNLHKLARLDMTSNKLKKIPPDPLFLRIPVYAKMKGSPLTALVLSFGGNPLHCNCELVWLRRV-------------TREDDLE---TCASPKDLAGKYFWTIREEEFVCEPPMITRHTSKMFVMEGQEVSLRCKSIG--DPEPST-HWVSPDGKLIGN-------------TSRTVCYENGSLDILKASVKDSGKFTCIASNAAGEATAPVELVVNPSPHFDPKLDPDPGPSDIPTSIKS 406          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: lrfn4b (leucine-rich repeat and fibronectin type-III domain-containing protein 4 [Source:NCBI gene;Acc:105356388])

HSP 1 Score: 62.7734 bits (151), Expect = 5.604e-10
Identity = 93/388 (23.97%), Postives = 153/388 (39.43%), Query Frame = 3
Query:  258 SISCTKPGFKEMPQQMSKTTKRFIL----ISQQFTNNFLSRENLTKISPPNVFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXXXXXX-XXXXFSINAFVD--LTVESLHMSQSSIFELPYDXXXXXXX-------------------------XXXXXXXXXXXXXSLDPRFQ-----VPFKNLQTLYLQGNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQ--LKIDFQSATETELSCSAVQKVDQAPMTVNWFTDIINGIGEKMFSILNSKSNPTTDRNVHVETVLIQKNNSTDSFQCIAKNLNGNATAIVRISWPPSEKFPNPNRN 1304
            S  C   G   +P  + + T    L    I++   N+F++   L            LT+ ++ I LI+PM F+DL  LR+L L  N    I     +GL      + NN   +K S  AF D  LT+E L +S +++ ++P++ ++ +                               +  N    +  DP F       P+  + +L   GN   C+C + WL      R   G        D+++   TC  P ++  ++   IP   F C+PP +T+   K+         L C A+   D  P+ V+W +     +     S  +S SN T D       +L+       ++ CIA N  G ATA V +     +  P P+R 
Sbjct:   28 STLCADKGLLFVPPHVDRRTVELRLADNFITEVGGNDFVNMSGLVD----------LTLSRNTIHLIRPMAFADLESLRSLHLDGNRLTTIGPRDLAGLVNLQHLIINNNQLVKVSTQAFDDFLLTLEDLDLSYNNLRKVPWESIQNMASLHTLNLDHNLIDNIAEGVFGELYKLARLDMTSNRLRTLPPDPLFTGAISPTPYNAVISLNFGGNPLHCNCELLWL-----RRLARG--------DDME---TCATPAHLAARYFWTIPEEEFTCEPPLITRHTHKLWVLEGQRATLKCRAIG--DPEPV-VHWVSPDDRIVANS--SRTSSFSNGTLD-------MLVTVARDDGAYTCIAINAAGEATATVDL-----KIIPLPHRG 372          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: lrrc4bb (leucine-rich repeat-containing protein 4B [Source:NCBI gene;Acc:101159140])

HSP 1 Score: 59.3066 bits (142), Expect = 9.787e-9
Identity = 67/302 (22.19%), Postives = 116/302 (38.41%), Query Frame = 3
Query:  393 PNVFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXXXXXXXXXXFSINAFVDL-TVESLHMSQSSIFELPYDXXXXXXXXXXXXXXXXXXXXSLDPRFQVPFKNLQTLYLQGNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQLKIDFQ--SATETELSCSAVQKVDQAPMTVNWFTD----IINGIGEKMFSILNSKSNPTTDRNVHVETVLIQKNNSTDSFQCIAKNLNGN--ATAIVRISWP 1271
            P V LE L +  + + +++P +F  L  LR L L ++    I+                        NAF +L ++E L++S +S+  LP+D                            P   L+ ++L  N + C+C + WL+           + K T          C  P  ++GK++ E+  S F C  P + +   D         EL C    +   +  +VNWFT     + +G      S+L+       D  ++   V +Q    T  + C+  N  GN  A+A++ +S P
Sbjct:  209 PLVKLEELELSGNQLGIVRPGSFQGLVSLRKLWLMHSRVSVIER-----------------------NAFDELKSLEELNLSHNSLHSLPHD-------------------------LFTPLHQLERVHLNHNPWVCNCDVLWLSW----------WLKETVPSNTTCCARCHAPPGLKGKYIGELDQSHFPCYAPVIVEPPTDLNVTEGMAAELKC----RTGTSMTSVNWFTPNGTLMTHGSYRVRISVLH-------DGTLNFTNVTVQ---DTGQYTCMVTNSAGNTTASAVLNVSAP 438          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: lrfn2b (leucine-rich repeat and fibronectin type-III domain-containing protein 2 [Source:NCBI gene;Acc:101157661])

HSP 1 Score: 54.6842 bits (130), Expect = 2.864e-7
Identity = 79/318 (24.84%), Postives = 125/318 (39.31%), Query Frame = 3
Query:  360 LSRENLTKISPPN----VFLEYLTIRKSNIKLIKPMTFSD-LTVLRALDLTYNNNLFIDSGSFSGXXXXXXXXXXXXXXXF-SINAFVDL-TVESLHMSQSSIFELPYDXXXXXXXXXXXXXXXXXXXXSLDPRFQVPFKNLQTLYLQGNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQ-----LKIDFQSATETELSCSAVQKVDQAPMTVNWFT--DIINGIGEKMFSILNSKSNPTTDRNVHVETVLIQKNNSTDS--FQCIAKNLNGNATAIVRIS 1265
            L    LTKI   +    V L++L +  + +  I    F D +  L  LDL+YNN + +   S   +        +++ L+F     F DL  +E + ++ + + +LP D +      L              P    P     +L L GN   C+C M WL  +                D      TC  P  ++G+H  ++    F C PP   Q     + ++ Q+AT   L C A    D +P  ++W +  D+          +L + S     RN    T+ I   +S D   F CIA N+ G  TA V +S
Sbjct:  107 LDNNRLTKIGSDDFRGLVNLQHLVLNNNQLGRIHDKAFEDPMGALEDLDLSYNNLVSLPWNSVRQMVNLHQLSADHNLLEFIPEGTFADLEMLERVDLASNRLQKLPPDPIFARAQDL--------------PTLSTPETAQLSLSLGGNPLHCNCEMLWLRRL----------------DRENDLETCASPPPLKGRHFWDVKEEEFVCQPPLFIQQTHKVVVLEGQTAT---LRCEATG--DPSP-AIHWISPDDL----------LLGNSSRTQVYRN---GTMRIPITSSKDHGIFTCIAANVAGETTASVEVS 375          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: lrrc4ba (leucine rich repeat containing 4B [Source:NCBI gene;Acc:101164310])

HSP 1 Score: 53.5286 bits (127), Expect = 6.391e-7
Identity = 60/279 (21.51%), Postives = 102/279 (36.56%), Query Frame = 3
Query:  435 IKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXXXXXXXXXXFSINAFVDL-TVESLHMSQSSIFELPYDXXXXXXXXXXXXXXXXXXXXSLDPRFQVPFKNLQTLYLQGNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQLKIDFQ--SATETELSCSAVQKVDQAPMTVNWFTD----IINGIGEKMFSILNSKSNPTTDRNVHVETVLIQKNNSTDSFQCIAKNLNGNATA 1250
            +++I+P +F  L  LR L L ++    I+                        NAF DL  +E L++S +S+  LP+D                            P   L+ ++L  N + C+C + WL+           + K T          C  P  ++GK++ E+  S F C  P + +   D         EL C    +   +  +VNW T     + +G      S+L+       D  ++   V ++    T  + C+  N  GN TA
Sbjct:  224 LEIIRPGSFQGLGALRKLWLMHSQVSVIER-----------------------NAFDDLKNLEELNLSHNSLHSLPHD-------------------------LFTPLHQLERVHLNHNPWVCNCDVLWLSW----------WLKETVPSNTTCCARCHAPPILKGKYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKC----RTSTSTTSVNWITPNGTLMTHGSYRVRISVLH-------DGTLNFTNVTLR---DTGQYTCMVTNAAGNTTA 430          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000018621.1 (SMESG000018621.1)

HSP 1 Score: 922.154 bits (2382), Expect = 0.000e+0
Identity = 486/488 (99.59%), Postives = 488/488 (100.00%), Query Frame = 3
Query:  198 GQIEAQIDYCGKFCDACVEDSISCTKPGFKEMPQQMSKTTKRFILISQQFTNNFLSRENLTKISPPNVFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXXXXXXXXXXFSINAFVDLTVESLHMSQSSIFELPYDXXXXXXXXXXXXXXXXXXXXSLDPRFQVPFKNLQTLYLQGNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQLKIDFQSATETELSCSAVQKVDQAPMTVNWFTDIINGIGEKMFSILNSKSNPTTDRNVHVETVLIQKNNSTDSFQCIAKNLNGNATAIVRISWPPSEKFPNPNRNVYQSTIDSWQKSEEDNYFFQKRFTLLEMFGAVFGTFAITLILFFMIYKFVFINRSTDRKAILPPNGYTTYEAAVYSDSQTYDIPGNSYPQSVLLPMPHLSSTPDHFIDFKTQKRFYQTT 1661
            GQIEAQIDYCGKFCDACVEDSISCTKPGFKEMPQQMSKTTKRFILISQQFTNNFLSRENLTKISPPNVFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGLKLKLLKLDNNDNLKFSINAFVDLTVESLHMSQSSIF+LPYDLLKPILPFLKKLFINNNNLISLDPRFQ+PFKNLQTLYLQGNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQLKIDFQSATETELSCSAVQKVDQAPMTVNWFTDIINGIGEKMFSILNSKSNPTTDRNVHVETVLIQKNNSTDSFQCIAKNLNGNATAIVRISWPPSEKFPNPNRNVYQSTIDSWQKSEEDNYFFQKRFTLLEMFGAVFGTFAITLILFFMIYKFVFINRSTDRKAILPPNGYTTYEAAVYSDSQTYDIPGNSYPQSVLLPMPHLSSTPDHFIDFKTQKRFYQTT
Sbjct:   16 GQIEAQIDYCGKFCDACVEDSISCTKPGFKEMPQQMSKTTKRFILISQQFTNNFLSRENLTKISPPNVFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGLKLKLLKLDNNDNLKFSINAFVDLTVESLHMSQSSIFDLPYDLLKPILPFLKKLFINNNNLISLDPRFQIPFKNLQTLYLQGNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQLKIDFQSATETELSCSAVQKVDQAPMTVNWFTDIINGIGEKMFSILNSKSNPTTDRNVHVETVLIQKNNSTDSFQCIAKNLNGNATAIVRISWPPSEKFPNPNRNVYQSTIDSWQKSEEDNYFFQKRFTLLEMFGAVFGTFAITLILFFMIYKFVFINRSTDRKAILPPNGYTTYEAAVYSDSQTYDIPGNSYPQSVLLPMPHLSSTPDHFIDFKTQKRFYQTT 503          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000079433.1 (SMESG000079433.1)

HSP 1 Score: 256.144 bits (653), Expect = 1.104e-77
Identity = 185/486 (38.07%), Postives = 281/486 (57.82%), Query Frame = 3
Query:  219 DYCGKFCDACVEDSISCTKPGFKEMPQQMSKTTKRFILISQQFTNNFLSRENLTKISPPNVFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXXXXXXXXXXFSINAFVDLTVESLHMSQSSIFELPYDXXXXXXXXXXXXXXXXXXXXSLDPRFQVPFKNLQTLYLQGNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQLKIDFQSATETELSCSAVQKVDQAPMTVNWFTDIINGIGEKMFSILNSK--SNPTTDRNVHVETVLIQKNNSTDSFQCIAKNLNGNATAIVRISWPPSEKFPNPNRNVYQSTIDSW----QKSEEDNYFFQKRFTLLEMFGAVFGTFAITLILFFMIYKFVFINRSTDRKA-ILPPNGYTTYEAAVYSDSQTYDIPGNSYP-QSVLLPMPHLSS-TPDHFIDFKTQKRF 1649
            + C K C  C  D +SCT  G   +P  + ++T +  LI  +F ++ LS+ N +    P   +E L+IR+SNIK+I+  TF DL+ L  LDL+ N  + I + +F+ LKLK LKLD    L     AF  L V SL M  SS+  L +DL++PI   L+ LF++NN++  LD +F+     L  L L GN F C+C + WL+     R   G   + + + +  +FP C  P +++ K++H I  + F+C+PP+L  + I F++    +L CSA      AP+ V W       I +  FS+ +S+   NP  + N+ V   +I+K++S + +QC+AK+ +GNAT  V I+WPP      P  N   ++ ++W     K  E N+FF+++FTLLEM GAV GTF +TL +F ++Y+F     S  +KA  L  +GY+ YE A+YSDSQTYD+P N+Y  QS  L    LSS TP H++D++TQ+R 
Sbjct:   23 EKCPKVCIICFNDHLSCTTGGLLSIPTNIHESTTKITLIGHEFLSSSLSKSNFSGFFKPKYSIEQLSIRQSNIKVIEKDTFYDLSGLDNLDLSENKAIIIRNKAFNNLKLKHLKLDQIQGLVLERGAFDGLAVTSLSMKNSSLKTLSFDLMRPISNNLRSLFLSNNHISELDQKFEPLITQLSHLDLTGNPFQCTCKLVWLSRALEKRMGLGLELEFSNSGQYVNFPLCAGPAHVKDKYIHNITEAEFSCEPPSLDVIDIQFENLDIVKLKCSAKLPFKAAPIQVYW-----QEISDP-FSLKDSQLEKNPNDETNLAV--TVIRKSSSVNLYQCLAKSSSGNATIRVTINWPPVINRTKPLENNTPNSNNNWFGQSNKQTEKNFFFREQFTLLEMLGAVMGTFTVTLTIFLLLYRFCVKATSKVKKANSLKKSGYSIYEPAIYSDSQTYDVPQNNYQIQSPALINNTLSSNTPSHYLDYRTQQRI 500          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000021154.1 (SMESG000021154.1)

HSP 1 Score: 241.506 bits (615), Expect = 3.918e-72
Identity = 167/452 (36.95%), Postives = 265/452 (58.63%), Query Frame = 3
Query:  225 CGKFCDACVEDSISCTKPGFKEMPQQMSKTTKRFILISQQFTNNFLSRENLTKISPPNVFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXXXXXXXXXXFSINAFVDLTVESLHMSQSSIFELPYDXXXXXXXXXXXXXXXXXXXXSLDPRFQVPFKNLQTLYLQGNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQLKIDFQSATETELSCSAVQKVDQAPMTVNWFTDIINGIGEKMFSIL-NSKSNPTTDRNVHVETVLIQKNNSTDSFQCIAKNLNGNATAIVRISWPPS---EKFPNPNRNVYQSTIDSWQKS-EEDNYFFQKRFTLLEMFGAVFGTFAITLILFFMIYKFVFINRSTDRKAILPPNGYTTYEAAVYSDSQTYDIPGNS 1565
            C   C  C+E +I+C   G   +P ++ + T R IL+  +F+  FLSR+N +K + P   +E L+IR+SNI++I+  TF D++ L  LD + N  L+I++ +F  LKLK LKLD   NL+FS +AF  L V SL +++S +  LPY L++P+   L+ LF++NN L SL  +F+  F+ L  L L GN F CSC+M WL     +R    + N  +F++    FP C +P Y+  ++++EIP + FNC PP L ++++ F+S     L C+A  +  +APM ++W   +     E + ++L +SKSN           + I + +  D + C   +  GNA+  V  +WP      + PN + + Y  T  +W+ +  ++NYFF++++TLLE+ G++ GTF IT+++F +IYKF F      +K  L  +G+ TYE   YSDSQTYDIP  S
Sbjct:   35 CPNVCTPCLEHAITCENGGLDGIPTELYEETTRVILVGHKFSQTFLSRQNFSKFTKPKYSIEQLSIRRSNIQIIRSQTFYDVSGLDFLDFSENLKLYIENRAFDNLKLKHLKLDFIGNLEFSEDAFQGLLVASLTIAKSHLQALPYRLIEPLSRELRSLFLSNNKLTSLSSKFESLFRQLTILDLHGNPFICSCNMLWLGVTLKWRQNYYRSNTNSFSEP--QFPKCDKPYYLLNQYLYEIPETEFNCRPPKLDRIEVQFKSQQSAVLKCAASLESKRAPMKISW---LYLSSKEYVPNLLPSSKSNEA--------EIEITQKHYIDQYFCSVSSAAGNASVKVNFNWPTVTNIRQRPNNSIDEYFVTKPTWKTNYYQENYFFREQYTLLELLGSILGTFIITILIFILIYKFYFFKTIKMKKEQLKKSGHVTYETGFYSDSQTYDIPQYS 473          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000030077.1 (SMESG000030077.1)

HSP 1 Score: 232.261 bits (591), Expect = 1.369e-68
Identity = 153/496 (30.85%), Postives = 264/496 (53.23%), Query Frame = 3
Query:  225 CGKFCDACVEDSISCTKPGFKEMPQQMSKTTKRFILISQQFTNNFLSRENLTKISPPNVFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXXXXXXXXXXFSINAFVDLTVESLHMSQSSIFELPYDXXXXXXXXXXXXXXXXXXXXSLDPRFQVPFKNLQTLYLQGNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQLKIDFQSATETELSCSAVQKVDQAPMTVNWFTDIINGIGEKMFSILNSKSNPTTDRNVHVETVLIQKNNSTDSFQCIAKNLNGNATAIVRISWP-------PSEKFPNPNRNVYQSTI--DSWQKSEEDNYFFQKRFTLLEMFGAVFGTFAITLILFFMIYKFVFI----------NRSTDRKAILPPNGYTTYEAAVYSDSQTYDIPGNSYPQSVLLPMPHLSSTPDHFIDFKTQKRFYQ 1655
            C   C  C ++++ C+ PG   +P+Q+S T ++  +  Q+F    L+ EN T+ +PP++ L+ L IR  N++ I+   FS LT L +LDL+ N+NL I + +F+GLK++ L ++N + L    + F  L V SL +    I  + Y+ L P++  L KLF+  N++ +L+P+  + F+ L +L L  N F C+CS+KWL+  Y  R  +  +N   F +     P C  P Y+  + +  +      C+ P +++L +   S +  +L CS  Q   QAPM ++W+ +  + +GE+M       S    ++    +TV ++       ++C+  N  G ATAIVRI WP          +F    R+     +   +W+       FF++RFTLLE+  A+ GT   T +LF +I++F+ I           + + +  +   +  T+YE A+YS+SQTYD+PG  +  S L  +P  +++   F+DFKTQ++ Y+
Sbjct:   26 CPHLCQPCFKETVVCSTPGRINLPEQISLTVQKLTITDQRFFVTTLTTENFTQFAPPHISLKQLFIRNCNVQKIESRAFSALTKLESLDLSNNSNLTISNDAFNGLKIRHLIINNINILVLEKDVFRGLDVTSLSLMNCGIESIGYNTLHPLIKSLSKLFLQENHIKTLEPKLGLIFQQLDSLELSENLFHCNCSIKWLSDFYKQRRNDPNFNDNKFQNA-NIIPKCVSPYYLSNRFLTHVNNEELICENPKISELNLKLNSLSNAKLVCSGYQASWQAPMQISWYNE--SSVGEQM------DSEIFINQTKSSKTVSVKYIKDIGHYKCVINNSLGEATAIVRIDWPNFFNTVSGDGEFEPIIRDTLSPNVKMKTWR-----TVFFERRFTLLEIIAAITGTVLFTGLLFILIHRFIMIKCVWVKKKNSGKKSRQSNLATLSLTTSYEPAIYSNSQTYDLPGVGHTGSNLY-LPATANSSQQFLDFKTQRKIYR 506          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000001555.1 (SMESG000001555.1)

HSP 1 Score: 205.297 bits (521), Expect = 3.971e-58
Identity = 178/536 (33.21%), Postives = 262/536 (48.88%), Query Frame = 3
Query:  222 YCGKFCDACVEDSISCTKPGFKEMPQQMSKTTKRFILISQQFTNNFLSRENLTKISPPNVFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGXXXXXXXXXXXXXXXFSINAFVDLTVESLHMSQSSIFELPYDXXXXXXXXXXXXXXXXXXXXSLDPRFQVPFKNLQTLYLQGNSFDCSCSMKWLTAVY-----VYRTTNG-KYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQLKIDFQSATETELSCSAV--QKVDQAPMTVNWFTDIINGIGEKMFSILNSKSNPTTDRNVHVETVLI-----------QKNNSTDSFQCIAKNLNGNATAIVRISWPPSEKFPN------PNRNVYQSTID------SWQKSEEDNYFFQKRFTLLEMFGAVFGTFAITLILFFMIYKFVFINR-------------------STDRKAIL----PPNGYTTYEAAV-YSD-SQTYD-IPGNS-YPQSVLLPMPHLSSTPD-HFIDFKTQKRFY 1652
            YC   C  C+   ISCT      +P Q+   T+   L  Q   +  LS  N T ++ P   +  L+IR  +I  +   TFS L +L+ LDL+ N  L I S SFSGL LK+LKLD+   L  S ++F DL+ ESL M  S +  L +++ +PI   LK L I NN +  LD  F+  F  L+++ L+ N+F C C + WL+         Y++ N     K     ++ +FP C  P Y+  + +  I  S FNC  P + Q++ID  S     +SCS    +K  + P  V W  +  +    K+F  +  KS    D    +E   I            +N + ++F C+A+N  G +   V+ISWP   KF N      PN    +S          W    + +YFF K++TLLEM  A+ GTF IT+++F + YKF F  R                   S+++++++    P  GYT YE ++ YSD SQTYD IP N+ YPQ        +S++P  HFID+KT K  Y
Sbjct:   27 YCPMHCSICLPSHISCTTGSLTSIPNQLQPKTETITLSGQLQFHPVLSSANFTDLAYPKYQIHTLSIRSCSIYELSSHTFSQLVMLKILDLSENQRLTIMSSSFSGLHLKVLKLDDIGKLMLSPDSFSDLSTESLSMKASRLQSLNFNIFQPISHSLKHLNIENNQIKILDQSFEPLFYRLESVNLKDNTFICYCDLLWLSKALRSKLSFYKSQNRFSDGKADSNSDVNNFPKCVGPTYLRDRQLQTISESEFNCQVPQIAQIEIDLLSVFGGMMSCSIKPEEKGHKIPTKVFW--EKQHPQNGKVFQRVYEKSQNAVDGFSLLENNGIAEFSSKIKFDSDRNKNQENFNCVAENKAGRSLVSVQISWP---KFNNSLDSSQPNSPTTESEKKQPTDHYQWNTPNQKSYFFTKQYTLLEMTAAIAGTFMITVVIFLVFYKFYFRKRNGYKSGKPSMKYSIAAELPSSNKRSLMAFHGPRGGYTVYETSMHYSDNSQTYDSIPHNAVYPQQQQPLFSTISNSPSAHFIDYKTHKNLY 557          
The following BLAST results are available for this feature:
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
LRRC4B3.231e-923.97leucine rich repeat containing 4B [Source:HGNC Sym... [more]
LRRC4B3.231e-923.97leucine rich repeat containing 4B [Source:HGNC Sym... [more]
LRRC4B3.231e-923.97leucine rich repeat containing 4B [Source:HGNC Sym... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:cabz01090165.11.162e-923.29si:cabz01090165.1 [Source:ZFIN;Acc:ZDB-GENE-161017... [more]
si:cabz01090165.11.162e-923.29si:cabz01090165.1 [Source:ZFIN;Acc:ZDB-GENE-161017... [more]
lrrc4ba2.556e-922.53leucine rich repeat containing 4Ba [Source:ZFIN;Ac... [more]
lrrc4ba3.222e-922.53leucine rich repeat containing 4Ba [Source:ZFIN;Ac... [more]
lrrc4ba3.413e-922.53leucine rich repeat containing 4Ba [Source:ZFIN;Ac... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc4b6.669e-823.63leucine rich repeat containing 4B [Source:NCBI gen... [more]
lrrc41.000e-724.74leucine rich repeat containing 4 [Source:NCBI gene... [more]
rrn31.814e-722.83RRN3 homolog, RNA polymerase I transcription facto... [more]
LRRC4C2.114e-721.43leucine rich repeat containing 4C [Source:NCBI gen... [more]
oaz12.184e-723.97ornithine decarboxylase antizyme 1 [Source:Xenbase... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Lrrc4b2.539e-923.97leucine rich repeat containing 4B [Source:MGI Symb... [more]
Igsf105.546e-824.71immunoglobulin superfamily, member 10 [Source:MGI ... [more]
Igsf105.546e-824.71immunoglobulin superfamily, member 10 [Source:MGI ... [more]
Igsf105.546e-824.71immunoglobulin superfamily, member 10 [Source:MGI ... [more]
back to top
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q9NT99|LRC4B_HUMAN1.552e-823.97Leucine-rich repeat-containing protein 4B OS=Homo ... [more]
sp|P0C192|LRC4B_MOUSE1.776e-823.97Leucine-rich repeat-containing protein 4B OS=Mus m... [more]
sp|P0CC10|LRC4B_RAT1.791e-823.97Leucine-rich repeat-containing protein 4B OS=Rattu... [more]
back to top
BLAST of Ig-like domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5P8I4L03.436e-4628.80PXDN-like protein OS=Schmidtea mediterranea OX=793... [more]
A0A0R3SAT84.802e-4129.42Ig-like domain-containing protein OS=Hymenolepis d... [more]
A0A0R3TNY67.284e-4029.72Ig-like domain-containing protein OS=Rodentolepis ... [more]
A0A068YC111.636e-3830.30Variable lymphocyte receptor OS=Echinococcus multi... [more]
W6U6F33.990e-3829.87Immunoglobulin superfamily member OS=Echinococcus ... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrfn4b7.148e-1023.81leucine rich repeat and fibronectin type III domai... [more]
lrrc4ba7.460e-1022.53leucine-rich repeat-containing protein 4B-like [So... [more]
lrrc4ba7.460e-1022.53leucine-rich repeat-containing protein 4B-like [So... [more]
lrrc4ba1.054e-922.53leucine-rich repeat-containing protein 4B-like [So... [more]
lrfn2b4.722e-723.54leucine-rich repeat and fibronectin type-III domai... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
lrfn5a7.727e-726.49leucine rich repeat and fibronectin type III domai... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:cabz01090165.12.605e-1125.43leucine-rich repeat and fibronectin type III domai... [more]
lrfn4b5.604e-1023.97leucine-rich repeat and fibronectin type-III domai... [more]
lrrc4bb9.787e-922.19leucine-rich repeat-containing protein 4B [Source:... [more]
lrfn2b2.864e-724.84leucine-rich repeat and fibronectin type-III domai... [more]
lrrc4ba6.391e-721.51leucine rich repeat containing 4B [Source:NCBI gen... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018621.10.000e+099.59SMESG000018621.1[more]
SMESG000079433.11.104e-7738.07SMESG000079433.1[more]
SMESG000021154.13.918e-7236.95SMESG000021154.1[more]
SMESG000030077.11.369e-6830.85SMESG000030077.1[more]
SMESG000001555.13.971e-5833.21SMESG000001555.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003110 ID=SMED30003110|Name=Ig-like domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1891bp
TTTCAGTTCTATTGTTAAATTCAACAAATTAATATTAACAAATCCAATGC
TGTGAAATGTTCATTTTTATTTTACTACTGTCATTTTTGTAAATGATGTT
TTCAATTTCATTGCAAATAATTTCTCTGGAATTCTAGTTTTAATTTCTAG
AAATGCTTATTTTACTTCTTACGACTTCAATACTCATTATTATATTTGGT
CAAATTGAAGCTCAAATTGATTATTGTGGAAAGTTTTGTGACGCTTGTGT
GGAAGATTCAATATCTTGCACTAAACCTGGTTTCAAGGAAATGCCACAGC
AAATGAGTAAAACGACAAAACGATTTATTTTAATCAGTCAACAGTTTACA
AATAATTTTCTGTCTCGAGAAAATCTCACTAAAATCAGCCCTCCAAATGT
TTTTCTTGAATATTTAACAATTAGAAAATCCAATATCAAACTCATCAAAC
CGATGACATTTTCTGATTTGACTGTGCTCCGAGCGCTTGATTTAACATAT
AATAATAATTTATTTATAGATTCTGGCTCATTTTCTGGTCTTAAATTAAA
ATTACTCAAACTTGATAATAATGACAATCTTAAATTCTCAATTAATGCTT
TTGTTGATCTGACAGTCGAATCTTTGCACATGTCACAGTCATCAATCTTT
GAGTTGCCCTATGATTTATTAAAACCGATTTTGCCTTTTTTGAAAAAGCT
TTTCATTAATAACAACAATCTTATATCGCTAGATCCAAGATTCCAAGTTC
CATTTAAAAATCTTCAAACCTTATATTTGCAAGGAAATTCGTTTGATTGT
TCATGTTCTATGAAATGGTTAACAGCGGTTTATGTGTATAGAACTACGAA
TGGGAAATATAACAAGGGAACTTTTACTGACGAAATACAAAGCTTTCCAA
CTTGTAAAGAACCGAAATACATGGAAGGGAAACATATGCATGAAATCCCT
CTATCATTATTCAATTGTGATCCCCCGAATCTCACTCAATTGAAAATAGA
TTTCCAGTCTGCAACGGAAACGGAATTAAGTTGCTCAGCTGTTCAAAAGG
TTGACCAAGCTCCAATGACAGTGAACTGGTTTACTGATATTATTAATGGA
ATCGGTGAAAAGATGTTTTCGATTTTAAATTCCAAATCAAATCCGACAAC
TGACAGAAACGTTCATGTGGAAACGGTTTTAATTCAGAAAAACAATTCTA
CAGATTCTTTTCAATGTATCGCAAAAAATCTCAACGGAAATGCCACAGCA
ATCGTTCGAATTAGTTGGCCACCGTCAGAAAAATTTCCCAACCCCAATCG
AAACGTCTACCAATCTACTATTGATAGTTGGCAGAAATCAGAGGAAGATA
ATTATTTCTTTCAAAAACGTTTTACTCTTCTCGAAATGTTTGGTGCCGTG
TTTGGAACATTTGCCATTACTCTTATTTTGTTTTTCATGATTTATAAATT
CGTTTTTATTAATCGAAGCACCGATCGAAAAGCAATCCTGCCACCAAACG
GTTACACTACGTATGAGGCTGCAGTTTACTCGGATAGTCAAACGTATGAT
ATTCCCGGTAACTCATATCCCCAATCAGTCTTATTACCAATGCCTCACTT
ATCAAGCACTCCAGATCATTTTATAGATTTCAAAACACAAAAAAGGTTTT
ATCAAACGACTTAATAACTTTCAGATTTCTTCCAGAACGATTCATGTCAT
TCCAATGCATCAGCGATAAAAATTATGGCATACTGCTGAAACTATTATTT
TAATTTGTAATAAATAAAAATGATCTCGGATAAATGAAAATGCTTCACAA
TTTTATAAACCGTGTTCCAGGCTGTGCCTAAATTTTAATAAAAATATTAT
TCGGACGAAAACAAAATTTTGTTTATTAAATATTAAGATAG
back to top

protein sequence of SMED30003110-orf-1

>SMED30003110-orf-1 ID=SMED30003110-orf-1|Name=SMED30003110-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=504bp
MLILLLTTSILIIIFGQIEAQIDYCGKFCDACVEDSISCTKPGFKEMPQQ
MSKTTKRFILISQQFTNNFLSRENLTKISPPNVFLEYLTIRKSNIKLIKP
MTFSDLTVLRALDLTYNNNLFIDSGSFSGLKLKLLKLDNNDNLKFSINAF
VDLTVESLHMSQSSIFELPYDLLKPILPFLKKLFINNNNLISLDPRFQVP
FKNLQTLYLQGNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPT
CKEPKYMEGKHMHEIPLSLFNCDPPNLTQLKIDFQSATETELSCSAVQKV
DQAPMTVNWFTDIINGIGEKMFSILNSKSNPTTDRNVHVETVLIQKNNST
DSFQCIAKNLNGNATAIVRISWPPSEKFPNPNRNVYQSTIDSWQKSEEDN
YFFQKRFTLLEMFGAVFGTFAITLILFFMIYKFVFINRSTDRKAILPPNG
YTTYEAAVYSDSQTYDIPGNSYPQSVLLPMPHLSSTPDHFIDFKTQKRFY
QTT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001611Leu-rich_rpt
IPR032675LRR_dom_sf
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 22..146
e-value: 4.7E-10
score: 40.8
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 147..274
e-value: 7.5E-19
score: 69.6
IPR001611Leucine-rich repeatPFAMPF13855LRR_8coord: 85..141
e-value: 2.1E-8
score: 33.8
NoneNo IPR availablePANTHERPTHR45842FAMILY NOT NAMEDcoord: 10..369
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.885
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 25..228
NoneNo IPR availableTMHMMTMhelixcoord: 413..435
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 275..371
score: 8.375