Dna-binding protein with pd1 dna-binding motif protein

Overview
NameDna-binding protein with pd1 dna-binding motif protein
Smed IDSMED30003101
Uniprot Best hitBifunctional protein GlmU OS=Synechococcus sp. (strain JA-3-3Ab) OX=321327 GN=glmU PE=3 SV=1 (E=4.40818e-21)
Length (bp)2361
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dna-binding protein with pd1 dna-binding motif protein (SMED30003101) t-SNE clustered cells

Violin plots show distribution of expression levels for Dna-binding protein with pd1 dna-binding motif protein (SMED30003101) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dna-binding protein with pd1 dna-binding motif protein (SMED30003101) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dna-binding protein with pd1 dna-binding motif protein (SMED30003101) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003101

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30003101SMESG000024994.1 PL05005A2A03ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
epidermisSMED30003101SMESG000024994.1 dd_Smed_v4_6261_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30003101SMESG000024994.1 dd_Smed_v4_6261_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ventral epidermis progenitor cellSMED30003101SMESG000024994.1 dd_Smed_v4_6261_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dna-binding protein with pd1 dna-binding motif protein vs. Ensembl Xenopus
Match: ENSXETT00000001582.1 (bifunctional protein GlmU-like [Source:NCBI gene;Acc:100496329])

HSP 1 Score: 128.642 bits (322), Expect = 9.032e-34
Identity = 62/134 (46.27%), Postives = 94/134 (70.15%), Query Frame = 3
Query: 1917 LTCHALRFGPGQDLKACLLEYVKKKKISAAFIMTCCGSLNQAKLRMADSGISNTPLEIKKFKKHFEIVSLVGSVFDHDCHLHISLSDCNGNVIGGHVIGDLIIHTTAEVMMGQISGVQMCREPDENTGYSELTF 2318
            L+ +ALR GPG+++   L ++V++K + + F++TC GS+ +A LR+A+S   NT  EI   K+  EIVSLVG++ +   HLHISL D +G  IGGH IGDL + TTAE+++G++S ++  RE DE+TG+ EL  
Sbjct:   27 LSAYALRLGPGEEILTSLFKFVQEKNLKSPFVLTCVGSVTKATLRLANSDALNTN-EIIYLKEKLEIVSLVGTL-NEGAHLHISLGDKDGKTIGGHAIGDLEVFTTAEIVIGELSNLEFTREMDEHTGFPELVI 158          
BLAST of Dna-binding protein with pd1 dna-binding motif protein vs. UniProt
Match: sp|Q2JVA4|GLMU_SYNJA (Bifunctional protein GlmU OS=Synechococcus sp. (strain JA-3-3Ab) OX=321327 GN=glmU PE=3 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 4.408e-21
Identity = 52/148 (35.14%), Postives = 81/148 (54.73%), Query Frame = 3
Query: 1869 PNNQNCVTPKSSAQGSLTCHALRFGPGQDLKACLLEYVKKKKISAAFIMTCCGSLNQAKLRMADSGISNTPLEIKKFKKHFEIVSLVGSVFDHDCHLHISLSDCNGNVIGGHVIGDLIIHTTAEVMMGQISGVQMCREPDENTGYSEL 2312
            P +     P+    GSL  + LR  PGQDLK  L  + +++ + A F+++  GSL+QA LR+AD        E     +  EI++L GS+     HLH++++D  G   GGH+    +I+TTAE+++      +  R+PD  TGY EL
Sbjct:  452 PGSAAAGRPQPLPTGSLRVYPLRLLPGQDLKQELERFARQQPLQAGFVLSAVGSLSQATLRLADQ------TEDYLLSERLEILALSGSLCPDGVHLHLAVADAQGRTWGGHLRPGCLIYTTAEIVLADSLEYRFSRQPDPATGYLEL 593          
BLAST of Dna-binding protein with pd1 dna-binding motif protein vs. UniProt
Match: sp|Q2JII9|GLMU_SYNJB (Bifunctional protein GlmU OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) OX=321332 GN=glmU PE=3 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 6.703e-20
Identity = 50/140 (35.71%), Postives = 78/140 (55.71%), Query Frame = 3
Query: 1893 PKSSAQGSLTCHALRFGPGQDLKACLLEYVKKKKISAAFIMTCCGSLNQAKLRMADSGISNTPLEIKKFKKHFEIVSLVGSVFDHDCHLHISLSDCNGNVIGGHVIGDLIIHTTAEVMMGQISGVQMCREPDENTGYSEL 2312
            P+    GSL  + LR  PGQDLK  L    +++ + A F+++  GSL+QA LR+AD    +         +  EI++L GS+     HLH++++D  G   GGH+    +I+TTAE+++      +  R+PD  TGY EL
Sbjct:  462 PQPMPPGSLKIYPLRLFPGQDLKQELERLARQQPLQAGFVLSAVGSLSQATLRLADQTGDHL------LSERLEILALSGSLCPDGVHLHLTVADARGQTWGGHLRPGCLIYTTAEIVLADSPEYRFSRQPDPATGYLEL 595          
BLAST of Dna-binding protein with pd1 dna-binding motif protein vs. TrEMBL
Match: gnl|BL_ORD_ID|23502050 (tr|A0A210R398|A0A210R398_MIZYE Bifunctional protein GlmU OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT10473 PE=4 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 7.367e-37
Identity = 70/135 (51.85%), Postives = 95/135 (70.37%), Query Frame = 3
Query: 1911 GSLTCHALRFGPGQDLKACLLEYVKKKKISAAFIMTCCGSLNQAKLRMADSGISNTPLEIKKFKKHFEIVSLVGSVFDHDCHLHISLSDCNGNVIGGHVIGDLIIHTTAEVMMGQISGVQMCREPDENTGYSELT 2315
            G +TC+ +R  PG+++K+ LL+ V++  +  AF+M+C GS+ +AKLRM+DS        +KKF+ HFEIVSLVG+      HLHISLSD +G V GGHVIGDL++ TTAEV++G   GV   REPD  TGY+EL 
Sbjct:   12 GPVTCYPVRLRPGEEIKSELLKLVQEHGLQGAFVMSCVGSVTKAKLRMSDS------TTVKKFEGHFEIVSLVGT-LSAGGHLHISLSDVDGRVFGGHVIGDLVVFTTAEVVIGNAGGVVFTREPDTQTGYNELV 139          
BLAST of Dna-binding protein with pd1 dna-binding motif protein vs. TrEMBL
Match: gnl|BL_ORD_ID|175344207 (tr|A0A3B3WX42|A0A3B3WX42_9TELE PPC domain-containing protein OS=Poecilia mexicana OX=48701 PE=4 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 3.555e-36
Identity = 70/150 (46.67%), Postives = 101/150 (67.33%), Query Frame = 3
Query: 1878 QNCVTPKSSAQGS-LTCHALRFGPGQDLKACLLEYVKKKKISAAFIMTCCGSLNQAKLRMADSGISNTPLEIKKFKKHFEIVSLVGSVFDHDCHLHISLSDCNGNVIGGHVIGDLIIHTTAEVMMGQISGVQMCREPDENTGYSELTFST 2324
            Q  + P++ A GS L  HA+RFGPGQ+L   L  +V+++++ A FI+TC GS+ +A LR+A++  +NT  E+ +    +EIVSLVG+  + D HLHISL+D  G  +GGHV+GDL + TTAEV++G    +Q  REPD  TG+ EL   T
Sbjct:   11 QRLLDPQNRAAGSALRVHAVRFGPGQELFGSLQAFVEERRLRAPFIITCVGSVTRATLRLANATATNTN-EVLQLSGRYEIVSLVGT-LNSDAHLHISLADAQGATVGGHVLGDLEVFTTAEVVVGDAVDLQFSREPDPRTGFPELVVLT 158          
BLAST of Dna-binding protein with pd1 dna-binding motif protein vs. TrEMBL
Match: gnl|BL_ORD_ID|175390028 (tr|A0A3Q2DBF6|A0A3Q2DBF6_CYPVA PPC domain-containing protein OS=Cyprinodon variegatus OX=28743 PE=4 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 4.321e-36
Identity = 68/143 (47.55%), Postives = 98/143 (68.53%), Query Frame = 3
Query: 1896 KSSAQGSLTCHALRFGPGQDLKACLLEYVKKKKISAAFIMTCCGSLNQAKLRMADSGISNTPLEIKKFKKHFEIVSLVGSVFDHDCHLHISLSDCNGNVIGGHVIGDLIIHTTAEVMMGQISGVQMCREPDENTGYSELTFST 2324
            K++A  +L  HA RFGPGQ+L  CL  +V+++++ A FI+TC GS+ +A LR+A++  +NT  E+      FEIVSLVG+  + D H+HISLSD  G  +GGHV+GDL I TTAEV++G+ + +   RE D+ TG+ EL   T
Sbjct:    2 KAAAGSALRVHAARFGPGQELLGCLQTFVEERRLRAPFIITCVGSVTKATLRLANATATNTN-EVLHLSGRFEIVSLVGT-LNRDAHVHISLSDAEGRTVGGHVLGDLEIFTTAEVVIGEAADLHFSREMDQQTGFPELVVQT 142          
BLAST of Dna-binding protein with pd1 dna-binding motif protein vs. TrEMBL
Match: gnl|BL_ORD_ID|22580387 (tr|A0A2C9JYS2|A0A2C9JYS2_BIOGL PPC domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106073301 PE=4 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 1.477e-35
Identity = 71/143 (49.65%), Postives = 97/143 (67.83%), Query Frame = 3
Query: 1905 AQGSLTCHALRFGPGQDLKACLLEYVKKKKISAAFIMTCCGSLNQAKLRMADSGISNTPLEIKKFKKHFEIVSLVGSVFDHDC-HLHISLSDCNGNVIGGHVIGDLIIHTTAEVMMGQISGVQMCREPDENTGYSELTFSTAD 2330
            A G L CH LR  PG +L + LL YV+   ++AAFIM+C GS+  A LRMA++ +      I+  + H+EIVSLVG++   D  HLHISLSD +G+VIGGHV+G+L+++TTAEV++G + GVQ  R  D  TGY EL    A+
Sbjct:   13 ASGPLQCHPLRLHPGDELYSTLLHYVRANSLNAAFIMSCVGSVVSADLRMANAEV------IRHLEGHYEIVSLVGTLSGGDGGHLHISLSDEHGDVIGGHVMGNLVVYTTAEVIIGNVEGVQFSRPEDPETGYDELMIEKAE 149          
BLAST of Dna-binding protein with pd1 dna-binding motif protein vs. TrEMBL
Match: gnl|BL_ORD_ID|173621845 (tr|A0A3B3VCG3|A0A3B3VCG3_9TELE PPC domain-containing protein OS=Poecilia latipinna OX=48699 PE=4 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 1.623e-35
Identity = 69/150 (46.00%), Postives = 101/150 (67.33%), Query Frame = 3
Query: 1878 QNCVTPKSSAQGS-LTCHALRFGPGQDLKACLLEYVKKKKISAAFIMTCCGSLNQAKLRMADSGISNTPLEIKKFKKHFEIVSLVGSVFDHDCHLHISLSDCNGNVIGGHVIGDLIIHTTAEVMMGQISGVQMCREPDENTGYSELTFST 2324
            Q  + P++ A GS L  HA+RFGPGQ+L   L  +V+++++ A FI+TC GS+ +A LR+A++  ++T  E+ +    +EIVSLVG+  + D HLHISL+D  G  +GGHV+GDL + TTAEV++G    +Q  REPD  TG+ EL   T
Sbjct:   13 QRLLDPQNRAAGSALRVHAVRFGPGQELFGSLQAFVEERRLRAPFIITCVGSVTRATLRLANATATDTN-EVLQLSGRYEIVSLVGT-LNSDAHLHISLADAQGATVGGHVLGDLEVFTTAEVVVGDAVDLQFSREPDPRTGFPELVVLT 160          
BLAST of Dna-binding protein with pd1 dna-binding motif protein vs. Ensembl Cavefish
Match: ENSAMXT00000031685.1 (bifunctional protein GlmU-like [Source:NCBI gene;Acc:107197779])

HSP 1 Score: 134.42 bits (337), Expect = 2.796e-36
Identity = 66/135 (48.89%), Postives = 95/135 (70.37%), Query Frame = 3
Query: 1914 SLTCHALRFGPGQDLKACLLEYVKKKKISAAFIMTCCGSLNQAKLRMADSGISNTPLEIKKFKKHFEIVSLVGSVFDHDCHLHISLSDCNGNVIGGHVIGDLIIHTTAEVMMGQISGVQMCREPDENTGYSELTF 2318
            SL   ALR GPGQ+L + LL +V+++K+ A FI+TC GSL +A LR+A++  +NT  E+   ++ FEIVSLVG+  + + HLHI L+D +G  IGGHV+GDL + TTAEV++G+ +G+   RE D  TG+ EL  
Sbjct:    7 SLRVLALRLGPGQELLSSLLAFVEEQKLKAPFIITCVGSLTKATLRLANATANNTN-EVIHLQERFEIVSLVGT-LNREAHLHICLADKDGKTIGGHVLGDLEVFTTAEVVIGEATGLHFTREMDSRTGFPELVI 139          
BLAST of Dna-binding protein with pd1 dna-binding motif protein vs. Ensembl Nematostella
Match: EDO48643 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJA4])

HSP 1 Score: 55.0694 bits (131), Expect = 9.004e-8
Identity = 20/52 (38.46%), Postives = 35/52 (67.31%), Query Frame = 3
Query: 1911 GSLTCHALRFGPGQDLKACLLEYVKKKKISAAFIMTCCGSLNQAKLRMADSG 2066
            G LTCHA+R  PG++L + L  +V +  + +AF++TC GS+    +R+A++ 
Sbjct:   22 GLLTCHAIRLKPGEELVSGLKRFVSENDLGSAFVLTCVGSVRSGTIRLANAA 73          

HSP 2 Score: 50.447 bits (119), Expect = 1.942e-6
Identity = 21/33 (63.64%), Postives = 27/33 (81.82%), Query Frame = 3
Query: 2154 HLHISLSDCNGNVIGGHVIGDLIIHTTAEVMMG 2252
            HLH+SL D  G VIGGHV+G++II TTAEV++ 
Sbjct:  278 HLHVSLGDKEGQVIGGHVMGNMIIFTTAEVVIA 310          
BLAST of Dna-binding protein with pd1 dna-binding motif protein vs. Ensembl Medaka
Match: ENSORLT00000021555.2 (bifunctional protein GlmU [Source:NCBI gene;Acc:101163376])

HSP 1 Score: 133.65 bits (335), Expect = 6.438e-36
Identity = 66/140 (47.14%), Postives = 96/140 (68.57%), Query Frame = 3
Query: 1899 SSAQGS-LTCHALRFGPGQDLKACLLEYVKKKKISAAFIMTCCGSLNQAKLRMADSGISNTPLEIKKFKKHFEIVSLVGSVFDHDCHLHISLSDCNGNVIGGHVIGDLIIHTTAEVMMGQISGVQMCREPDENTGYSELT 2315
            S+  GS L  +A+RF PGQ++   L  +V+++++ A FIMTC GS+ +A LR+A++  +NT  E+     H+EIVSLVG+  + D HLHISLSD  G  IGGHV+GDL + TTAEV++G+ + +   RE D+ TG+ EL 
Sbjct:    3 SAGAGSNLQVYAVRFCPGQEILGSLQAFVEERRLQAPFIMTCVGSVTKATLRLANASATNTN-EVIHLTGHYEIVSLVGT-LNRDAHLHISLSDAEGKTIGGHVLGDLEVFTTAEVVIGEAADLLFIREMDDQTGFPELV 140          
BLAST of Dna-binding protein with pd1 dna-binding motif protein vs. Planmine SMEST
Match: SMESG000024994.1 (SMESG000024994.1)

HSP 1 Score: 1243.02 bits (3215), Expect = 0.000e+0
Identity = 758/760 (99.74%), Postives = 760/760 (100.00%), Query Frame = 3
Query:   51 KGLVSTTQLDNEHQKSKKLTTMSSRTSIQHSSPEFNDNHISKSIKSEKCFYNIQLNSQSDNDKIELSNEKRESLSTSSYKFLSXXXXXXXXXXXXXXXHMWLVIPHGSFEVMCLVCHKVMTQRKLDTIKRHTVRRHTEVLDMDQAERILLFEKLLLEHNSTKFXXXXXXXXXXXXXXXXXXXXXXXXTKSLENGKLSNLETEVGDLEKLXXXXXXXXXXXXXXXXXXXQQNNPDSSYYQKRLXXXXXXXXXXXXXXXXXDSLKSFSNIKSPIDEKSMMNKAILKSKLKIPTACDGNKPYSVWSNSPLNNRLVNSASKSFQDSLYNVNGSSCLSMPMISKCPLCLEDCSQNGVDTINNFNRLMSHMQQKHSDKLHNXXXXXXXXXXXXXXXXXXXXXXXMPPTTNSMNYMSVSNAISSANMISFLYYQDLMRQTISTNRSSNSQFNTMPPDPMFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAFNLNPLNESSIPTPISLKDNNHNFNKISPLKRTKFSAESFISDSCTQSAFYSPKCCKLDSKDSDYLKLMKTNPSHQNPESVHKFHPHETDANSKEIKTENITDSTTADSKATRVILTSSPNNQNCVTPKSSAQGSLTCHALRFGPGQDLKACLLEYVKKKKISAAFIMTCCGSLNQAKLRMADSGISNTPLEIKKFKKHFEIVSLVGSVFDHDCHLHISLSDCNGNVIGGHVIGDLIIHTTAEVMMGQISGVQMCREPDENTGYSELTFSTAD 2330
            +GLVSTTQLDNEHQKSKKLTTMSSRTSIQHSSPEFNDNHISKSIKSEKCFYNIQLNSQSDNDKIELSNEKRESLSTSSYKFLSWREKDRRRRFRDEWKHMWLVIPHGSFEVMCLVCHKVMTQRKLDTIKRHTVRRHTEVLDMDQAERILLFEKLLLEHNSTKFPTPNSNCNAINNNNINTAGNCMNGTKSLENGKLSNLETEVGDLEKLLSTDCISATSSSSLSPLDLQQNNPDSSYYQKRLKYNRKNIKINFKNNQKIDSLKSFSNIKSPIDEKSMMNKAILKSKLKIPTACDGNKPYSVWSNSPLNNRLVNSASKSFQDSLYNVNGSSCLSMPMISKCPLCLEDCSQNGVDTINNFNRLMSHMQQKHSDKL+NSNLSFDLSQSSGSSASSLVQSLLMPPTTNSMNYMSVSNAISSANMISFLYYQDLMRQTISTNRSSNSQFNTMPPDPMFLQSPSALASSSIYPILSPPSPQYSLRPSSSSISAFNLNPLNESSIPTPISLKDNNHNFNKISPLKRTKFSAESFISDSCTQSAFYSPKCCKLDSKDSDYLKLMKTNPSHQNPESVHKFHPHETDANSKEIKTENITDSTTADSKATRVILTSSPNNQNCVTPKSSAQGSLTCHALRFGPGQDLKACLLEYVKKKKISAAFIMTCCGSLNQAKLRMADSGISNTPLEIKKFKKHFEIVSLVGSVFDHDCHLHISLSDCNGNVIGGHVIGDLIIHTTAEVMMGQISGVQMCREPDENTGYSELTFSTAD
Sbjct:   85 EGLVSTTQLDNEHQKSKKLTTMSSRTSIQHSSPEFNDNHISKSIKSEKCFYNIQLNSQSDNDKIELSNEKRESLSTSSYKFLSWREKDRRRRFRDEWKHMWLVIPHGSFEVMCLVCHKVMTQRKLDTIKRHTVRRHTEVLDMDQAERILLFEKLLLEHNSTKFPTPNSNCNAINNNNINTAGNCMNGTKSLENGKLSNLETEVGDLEKLLSTDCISATSSSSLSPLDLQQNNPDSSYYQKRLKYNRKNIKINFKNNQKIDSLKSFSNIKSPIDEKSMMNKAILKSKLKIPTACDGNKPYSVWSNSPLNNRLVNSASKSFQDSLYNVNGSSCLSMPMISKCPLCLEDCSQNGVDTINNFNRLMSHMQQKHSDKLYNSNLSFDLSQSSGSSASSLVQSLLMPPTTNSMNYMSVSNAISSANMISFLYYQDLMRQTISTNRSSNSQFNTMPPDPMFLQSPSALASSSIYPILSPPSPQYSLRPSSSSISAFNLNPLNESSIPTPISLKDNNHNFNKISPLKRTKFSAESFISDSCTQSAFYSPKCCKLDSKDSDYLKLMKTNPSHQNPESVHKFHPHETDANSKEIKTENITDSTTADSKATRVILTSSPNNQNCVTPKSSAQGSLTCHALRFGPGQDLKACLLEYVKKKKISAAFIMTCCGSLNQAKLRMADSGISNTPLEIKKFKKHFEIVSLVGSVFDHDCHLHISLSDCNGNVIGGHVIGDLIIHTTAEVMMGQISGVQMCREPDENTGYSELTFSTAD 844          
BLAST of Dna-binding protein with pd1 dna-binding motif protein vs. Planmine SMEST
Match: SMESG000024994.1 (SMESG000024994.1)

HSP 1 Score: 1239.56 bits (3206), Expect = 0.000e+0
Identity = 757/758 (99.87%), Postives = 758/758 (100.00%), Query Frame = 3
Query:   57 LVSTTQLDNEHQKSKKLTTMSSRTSIQHSSPEFNDNHISKSIKSEKCFYNIQLNSQSDNDKIELSNEKRESLSTSSYKFLSXXXXXXXXXXXXXXXHMWLVIPHGSFEVMCLVCHKVMTQRKLDTIKRHTVRRHTEVLDMDQAERILLFEKLLLEHNSTKFXXXXXXXXXXXXXXXXXXXXXXXXTKSLENGKLSNLETEVGDLEKLXXXXXXXXXXXXXXXXXXXQQNNPDSSYYQKRLXXXXXXXXXXXXXXXXXDSLKSFSNIKSPIDEKSMMNKAILKSKLKIPTACDGNKPYSVWSNSPLNNRLVNSASKSFQDSLYNVNGSSCLSMPMISKCPLCLEDCSQNGVDTINNFNRLMSHMQQKHSDKLHNXXXXXXXXXXXXXXXXXXXXXXXMPPTTNSMNYMSVSNAISSANMISFLYYQDLMRQTISTNRSSNSQFNTMPPDPMFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAFNLNPLNESSIPTPISLKDNNHNFNKISPLKRTKFSAESFISDSCTQSAFYSPKCCKLDSKDSDYLKLMKTNPSHQNPESVHKFHPHETDANSKEIKTENITDSTTADSKATRVILTSSPNNQNCVTPKSSAQGSLTCHALRFGPGQDLKACLLEYVKKKKISAAFIMTCCGSLNQAKLRMADSGISNTPLEIKKFKKHFEIVSLVGSVFDHDCHLHISLSDCNGNVIGGHVIGDLIIHTTAEVMMGQISGVQMCREPDENTGYSELTFSTAD 2330
            LVSTTQLDNEHQKSKKLTTMSSRTSIQHSSPEFNDNHISKSIKSEKCFYNIQLNSQSDNDKIELSNEKRESLSTSSYKFLSWREKDRRRRFRDEWKHMWLVIPHGSFEVMCLVCHKVMTQRKLDTIKRHTVRRHTEVLDMDQAERILLFEKLLLEHNSTKFPTPNSNCNAINNNNINTAGNCMNGTKSLENGKLSNLETEVGDLEKLLSTDCISATSSSSLSPLDLQQNNPDSSYYQKRLKYNRKNIKINFKNNQKIDSLKSFSNIKSPIDEKSMMNKAILKSKLKIPTACDGNKPYSVWSNSPLNNRLVNSASKSFQDSLYNVNGSSCLSMPMISKCPLCLEDCSQNGVDTINNFNRLMSHMQQKHSDKL+NSNLSFDLSQSSGSSASSLVQSLLMPPTTNSMNYMSVSNAISSANMISFLYYQDLMRQTISTNRSSNSQFNTMPPDPMFLQSPSALASSSIYPILSPPSPQYSLRPSSSSISAFNLNPLNESSIPTPISLKDNNHNFNKISPLKRTKFSAESFISDSCTQSAFYSPKCCKLDSKDSDYLKLMKTNPSHQNPESVHKFHPHETDANSKEIKTENITDSTTADSKATRVILTSSPNNQNCVTPKSSAQGSLTCHALRFGPGQDLKACLLEYVKKKKISAAFIMTCCGSLNQAKLRMADSGISNTPLEIKKFKKHFEIVSLVGSVFDHDCHLHISLSDCNGNVIGGHVIGDLIIHTTAEVMMGQISGVQMCREPDENTGYSELTFSTAD
Sbjct:  116 LVSTTQLDNEHQKSKKLTTMSSRTSIQHSSPEFNDNHISKSIKSEKCFYNIQLNSQSDNDKIELSNEKRESLSTSSYKFLSWREKDRRRRFRDEWKHMWLVIPHGSFEVMCLVCHKVMTQRKLDTIKRHTVRRHTEVLDMDQAERILLFEKLLLEHNSTKFPTPNSNCNAINNNNINTAGNCMNGTKSLENGKLSNLETEVGDLEKLLSTDCISATSSSSLSPLDLQQNNPDSSYYQKRLKYNRKNIKINFKNNQKIDSLKSFSNIKSPIDEKSMMNKAILKSKLKIPTACDGNKPYSVWSNSPLNNRLVNSASKSFQDSLYNVNGSSCLSMPMISKCPLCLEDCSQNGVDTINNFNRLMSHMQQKHSDKLYNSNLSFDLSQSSGSSASSLVQSLLMPPTTNSMNYMSVSNAISSANMISFLYYQDLMRQTISTNRSSNSQFNTMPPDPMFLQSPSALASSSIYPILSPPSPQYSLRPSSSSISAFNLNPLNESSIPTPISLKDNNHNFNKISPLKRTKFSAESFISDSCTQSAFYSPKCCKLDSKDSDYLKLMKTNPSHQNPESVHKFHPHETDANSKEIKTENITDSTTADSKATRVILTSSPNNQNCVTPKSSAQGSLTCHALRFGPGQDLKACLLEYVKKKKISAAFIMTCCGSLNQAKLRMADSGISNTPLEIKKFKKHFEIVSLVGSVFDHDCHLHISLSDCNGNVIGGHVIGDLIIHTTAEVMMGQISGVQMCREPDENTGYSELTFSTAD 873          
The following BLAST results are available for this feature:
BLAST of Dna-binding protein with pd1 dna-binding motif protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dna-binding protein with pd1 dna-binding motif protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dna-binding protein with pd1 dna-binding motif protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dna-binding protein with pd1 dna-binding motif protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dna-binding protein with pd1 dna-binding motif protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000001582.19.032e-3446.27bifunctional protein GlmU-like [Source:NCBI gene;A... [more]
back to top
BLAST of Dna-binding protein with pd1 dna-binding motif protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dna-binding protein with pd1 dna-binding motif protein vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q2JVA4|GLMU_SYNJA4.408e-2135.14Bifunctional protein GlmU OS=Synechococcus sp. (st... [more]
sp|Q2JII9|GLMU_SYNJB6.703e-2035.71Bifunctional protein GlmU OS=Synechococcus sp. (st... [more]
back to top
BLAST of Dna-binding protein with pd1 dna-binding motif protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|235020507.367e-3751.85tr|A0A210R398|A0A210R398_MIZYE Bifunctional protei... [more]
gnl|BL_ORD_ID|1753442073.555e-3646.67tr|A0A3B3WX42|A0A3B3WX42_9TELE PPC domain-containi... [more]
gnl|BL_ORD_ID|1753900284.321e-3647.55tr|A0A3Q2DBF6|A0A3Q2DBF6_CYPVA PPC domain-containi... [more]
gnl|BL_ORD_ID|225803871.477e-3549.65tr|A0A2C9JYS2|A0A2C9JYS2_BIOGL PPC domain-containi... [more]
gnl|BL_ORD_ID|1736218451.623e-3546.00tr|A0A3B3VCG3|A0A3B3VCG3_9TELE PPC domain-containi... [more]
back to top
BLAST of Dna-binding protein with pd1 dna-binding motif protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000031685.12.796e-3648.89bifunctional protein GlmU-like [Source:NCBI gene;A... [more]
back to top
BLAST of Dna-binding protein with pd1 dna-binding motif protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dna-binding protein with pd1 dna-binding motif protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dna-binding protein with pd1 dna-binding motif protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO486439.004e-838.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dna-binding protein with pd1 dna-binding motif protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000021555.26.438e-3647.14bifunctional protein GlmU [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Dna-binding protein with pd1 dna-binding motif protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000024994.10.000e+099.74SMESG000024994.1[more]
SMESG000024994.10.000e+099.87SMESG000024994.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003101 ID=SMED30003101|Name=Dna-binding protein with pd1 dna-binding motif protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2361bp
ATACTCTTAAGCGCGTTCAAATTGAATTAATATTAATTTAAATTTAAATA
AAAGGACTAGTAAGTACAACTCAATTAGATAATGAACATCAAAAGTCCAA
AAAATTAACAACAATGTCCAGTAGAACTTCAATTCAACATTCTTCGCCAG
AATTCAATGACAATCATATTTCAAAATCGATTAAAAGTGAAAAATGTTTT
TACAATATTCAATTAAATTCTCAAAGTGATAATGATAAAATTGAATTATC
AAACGAAAAACGAGAATCCCTCTCAACATCTTCATACAAATTCCTTTCGT
GGAGAGAAAAAGATAGACGGCGACGATTTAGAGATGAATGGAAACACATG
TGGCTCGTAATACCCCATGGAAGTTTTGAGGTGATGTGCTTGGTATGCCA
CAAAGTGATGACCCAAAGAAAGCTTGACACAATTAAACGCCATACTGTTC
GTCGACACACTGAAGTTCTTGACATGGACCAAGCCGAAAGAATACTTTTA
TTTGAAAAGCTACTTCTTGAACATAATTCCACAAAGTTCCCAACACCAAA
TTCTAATTGCAATGCCATCAACAATAACAACATCAACACTGCTGGCAATT
GTATGAATGGCACAAAATCATTGGAAAATGGAAAACTCTCCAACCTGGAA
ACTGAAGTCGGCGATTTGGAAAAACTCTTGTCGACCGATTGCATTTCGGC
CACTTCATCGTCGTCTTTATCGCCTTTGGATTTGCAACAAAACAATCCCG
ATTCAAGTTATTATCAGAAACGATTGAAATATAACCGGAAAAATATTAAA
ATCAATTTCAAAAATAATCAGAAAATCGATTCGTTGAAATCGTTTTCAAA
CATCAAATCACCGATCGACGAAAAATCAATGATGAATAAAGCGATTTTGA
AATCCAAATTGAAAATACCAACGGCCTGTGACGGCAATAAACCGTACAGT
GTTTGGTCAAATTCACCTTTGAATAATCGGCTTGTCAATTCAGCCAGCAA
ATCGTTTCAAGATTCACTTTACAATGTTAATGGATCATCTTGCCTCTCAA
TGCCTATGATCAGTAAATGTCCTTTGTGCCTTGAAGACTGCTCGCAGAAC
GGAGTGGACACGATCAACAATTTCAACCGCTTAATGAGTCACATGCAACA
GAAACATTCTGATAAATTGCACAACTCGAATCTGTCTTTCGATCTCTCCC
AATCAAGTGGTTCATCGGCCAGCAGCCTCGTCCAATCACTATTAATGCCA
CCGACAACAAACTCCATGAATTATATGTCAGTATCGAATGCTATATCGAG
TGCAAATATGATTTCCTTTCTTTATTATCAAGATTTAATGCGTCAAACTA
TTTCTACAAATCGTTCGTCAAATTCACAATTCAATACGATGCCACCAGAT
CCCATGTTTTTGCAGTCACCCTCTGCCTTAGCCTCGTCTTCTATTTATCC
TATTCTTTCTCCTCCTTCTCCACAATATTCTTTGCGTCCGTCTAGTTCCA
GTATTTCTGCCTTCAATTTAAATCCACTTAATGAAAGTTCTATTCCAACT
CCGATTTCATTGAAAGACAACAATCACAATTTCAACAAAATTTCTCCATT
GAAACGAACGAAATTCTCTGCGGAATCTTTCATATCCGATTCGTGCACTC
AATCAGCGTTTTATTCACCGAAATGTTGTAAACTCGATTCTAAAGACTCT
GATTATCTGAAATTGATGAAAACCAATCCATCTCACCAAAATCCTGAAAG
CGTTCATAAATTCCATCCACACGAAACTGATGCCAATAGTAAAGAAATAA
AAACCGAAAACATAACTGATTCAACTACTGCCGACAGTAAAGCCACCAGA
GTGATTTTAACTTCGAGTCCAAACAATCAGAACTGCGTTACTCCGAAATC
ATCGGCTCAAGGAAGTCTGACTTGCCATGCTTTACGGTTTGGTCCGGGTC
AAGATTTAAAGGCCTGCTTATTGGAATATGTAAAGAAAAAGAAAATCAGC
GCCGCCTTCATCATGACCTGTTGTGGTAGTTTGAATCAAGCAAAATTGCG
GATGGCCGATTCCGGAATTTCCAATACTCCATTGGAAATTAAAAAGTTTA
AAAAACACTTTGAAATCGTTTCACTCGTCGGATCGGTATTCGATCACGAT
TGCCATCTTCATATTTCTCTATCCGATTGCAATGGAAACGTTATTGGGGG
TCATGTAATAGGGGACTTGATAATCCACACAACTGCTGAGGTGATGATGG
GACAGATTTCTGGAGTTCAAATGTGCAGAGAGCCTGACGAAAATACTGGA
TATTCCGAGTTAACCTTCTCGACAGCAGATATTATTTGAAATATATATAT
ATATATATATA
back to top

protein sequence of SMED30003101-orf-1

>SMED30003101-orf-1 ID=SMED30003101-orf-1|Name=SMED30003101-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=742bp
MSSRTSIQHSSPEFNDNHISKSIKSEKCFYNIQLNSQSDNDKIELSNEKR
ESLSTSSYKFLSWREKDRRRRFRDEWKHMWLVIPHGSFEVMCLVCHKVMT
QRKLDTIKRHTVRRHTEVLDMDQAERILLFEKLLLEHNSTKFPTPNSNCN
AINNNNINTAGNCMNGTKSLENGKLSNLETEVGDLEKLLSTDCISATSSS
SLSPLDLQQNNPDSSYYQKRLKYNRKNIKINFKNNQKIDSLKSFSNIKSP
IDEKSMMNKAILKSKLKIPTACDGNKPYSVWSNSPLNNRLVNSASKSFQD
SLYNVNGSSCLSMPMISKCPLCLEDCSQNGVDTINNFNRLMSHMQQKHSD
KLHNSNLSFDLSQSSGSSASSLVQSLLMPPTTNSMNYMSVSNAISSANMI
SFLYYQDLMRQTISTNRSSNSQFNTMPPDPMFLQSPSALASSSIYPILSP
PSPQYSLRPSSSSISAFNLNPLNESSIPTPISLKDNNHNFNKISPLKRTK
FSAESFISDSCTQSAFYSPKCCKLDSKDSDYLKLMKTNPSHQNPESVHKF
HPHETDANSKEIKTENITDSTTADSKATRVILTSSPNNQNCVTPKSSAQG
SLTCHALRFGPGQDLKACLLEYVKKKKISAAFIMTCCGSLNQAKLRMADS
GISNTPLEIKKFKKHFEIVSLVGSVFDHDCHLHISLSDCNGNVIGGHVIG
DLIIHTTAEVMMGQISGVQMCREPDENTGYSELTFSTADII*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0000287magnesium ion binding
GO:0003824catalytic activity
GO:0003977UDP-N-acetylglucosamine diphosphorylase activity
GO:0016740transferase activity
GO:0016746transferase activity, transferring acyl groups
GO:0016779nucleotidyltransferase activity
GO:0019134glucosamine-1-phosphate N-acetyltransferase activity
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000096ventral epidermis
PLANA:0003503ventral epidermis progenitor cell
Vocabulary: INTERPRO
TermDefinition
IPR040647SPIN-DOC_Znf-C2H2
IPR005175PPC_dom
Vocabulary: biological process
TermDefinition
GO:0000902cell morphogenesis
GO:0006048UDP-N-acetylglucosamine biosynthetic process
GO:0008152metabolic process
GO:0008360regulation of cell shape
GO:0009103lipopolysaccharide biosynthetic process
GO:0009245lipid A biosynthetic process
GO:0009252peptidoglycan biosynthetic process
GO:0071555cell wall organization
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005175PPC domainPFAMPF03479DUF296coord: 604..716
e-value: 7.4E-25
score: 87.4
IPR005175PPC domainPROSITEPS51742PPCcoord: 599..736
score: 36.07
IPR005175PPC domainCDDcd11378DUF296coord: 605..713
e-value: 3.33223E-25
score: 98.8117
IPR040647SPIN-DOC, C2H2-type zinc-fingerPFAMPF18658zf-C2H2_12coord: 71..130
e-value: 6.6E-7
score: 28.8
NoneNo IPR availableGENE3DG3DSA:3.30.1330.80coord: 603..739
e-value: 2.7E-43
score: 149.1
NoneNo IPR availablePANTHERPTHR34988FAMILY NOT NAMEDcoord: 600..736
NoneNo IPR availablePANTHERPTHR34988:SF2coord: 600..736
NoneNo IPR availableSUPERFAMILYSSF117856AF0104/ALDC/Ptd012-likecoord: 601..736