SMED30003100

Overview
NameSMED30003100
Smed IDSMED30003100
Length (bp)1655
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30003100 (SMED30003100) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30003100 (SMED30003100) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30003100 (SMED30003100) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30003100 (SMED30003100) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003100

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30003100h1SMcG0018994 dd_Smed_v4_14856_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30003100 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001260:77439..79093 +8203
Homology
BLAST of SMED30003100 vs. Planmine SMEST
Match: SMESG000027093.1 (SMESG000027093.1)

HSP 1 Score: 904.434 bits (2336), Expect = 0.000e+0
Identity = 505/508 (99.41%), Postives = 505/508 (99.41%), Query Frame = 1
Query:   49 MNAKRGKSSDSYSFHKYFIIKYSIVTAFMFTVGVGIVWNYTIYTLSLTPYTIIRIEYWKTILFISTILFLFNVGLILTNYRVNYMNRNFFLKGPTENPKIVYLICFPXXXXXXXXXXCTAAFLFHFNDCGSFIDIIFAGSIILFFTSMIFLIINVLSSSDTGELPLVNIINAFTLMVSLASVWNLTLYNIELVLTKSFKTTVKRVFNEATFFNQCSNKNIPNSPWPVDLDVNMLPLLRISSIILGICLMPYLFRPLKSHISFINKSIPNASHYFDVEFVSRKNYKNYYLSIVMIVLNFAIFIAKKFSPSNIIDTIALFLFFCXXXXXXXXXXXXXXDMQYIPTTGNGSASVTHYIFLWIGVIGEFVSVIERLILCIYNLYYGPNNSLILSVINLCNVGLLLINGFVQSVLLSIVIKDKSEYEVNKSGTNIYILPLVLCFYNGLYFIYNLFLVDPCYYHCNVFNIAFLTSGLYQICXXXXXXXXXXXXXXXXXNYLSMSNSHHRVVINS 1572
            MNAKRGKSSDSYSFHKYFIIKYSIVTAFMFTVGVGIVWNYTIYTLSLTPYTIIRIEYWKTILFISTILFL NVGLILTNYRVNYMNRNFFLKGPTENPKIVYLICFPLIILILSSLS TAAFLFHFNDCGSFIDIIFAGSIILFFTSMIFLIINVLSSSDTGELPLVNIINAFTLMVSLASVWNLTLYNIELVLT SFKTTVKRVFNEATFFNQCSNKNIPNSPWPVDLDVNMLPLLRISSIILGICLMPYLFRPLKSHISFINKSIPNASHYFDVEFVSRKNYKNYYLSIVMIVLNFAIFIAKKFSPSNIIDTIALFLFFCVMLIVNLVSVVLLVDMQYIPTTGNGSASVTHYIFLWIGVIGEFVSVIERLILCIYNLYYGPNNSLILSVINLCNVGLLLINGFVQSVLLSIVIKDKSEYEVNKSGTNIYILPLVLCFYNGLYFIYNLFLVDPCYYHCNVFNIAFLTSGLYQICLPLTLLYRLFSSLLFTLNYLSMSNSHHRVVINS
Sbjct:    1 MNAKRGKSSDSYSFHKYFIIKYSIVTAFMFTVGVGIVWNYTIYTLSLTPYTIIRIEYWKTILFISTILFLLNVGLILTNYRVNYMNRNFFLKGPTENPKIVYLICFPLIILILSSLSYTAAFLFHFNDCGSFIDIIFAGSIILFFTSMIFLIINVLSSSDTGELPLVNIINAFTLMVSLASVWNLTLYNIELVLTNSFKTTVKRVFNEATFFNQCSNKNIPNSPWPVDLDVNMLPLLRISSIILGICLMPYLFRPLKSHISFINKSIPNASHYFDVEFVSRKNYKNYYLSIVMIVLNFAIFIAKKFSPSNIIDTIALFLFFCVMLIVNLVSVVLLVDMQYIPTTGNGSASVTHYIFLWIGVIGEFVSVIERLILCIYNLYYGPNNSLILSVINLCNVGLLLINGFVQSVLLSIVIKDKSEYEVNKSGTNIYILPLVLCFYNGLYFIYNLFLVDPCYYHCNVFNIAFLTSGLYQICLPLTLLYRLFSSLLFTLNYLSMSNSHHRVVINS 508          
BLAST of SMED30003100 vs. Planmine SMEST
Match: SMESG000027091.1 (SMESG000027091.1)

HSP 1 Score: 418.313 bits (1074), Expect = 2.124e-141
Identity = 232/474 (48.95%), Postives = 330/474 (69.62%), Query Frame = 1
Query:   49 MNAKRGKSSDSYSFHKYFIIKYSIVTAFMFTVGVGIVWNYTIYTLSLTPYTIIRIEYWKTILFISTILFLFNVGLILTNYRVNYMNRNFFLKGPTENPKIVYLICFPXXXXXXXXXXCTAAFLFHFNDCGSFIDIIFAGSIILFFTSMIFLIINVLSSSDTGELPLVNIINAFTLMVSLASVWNLTLYNIELVLTKSFKTTVKRVFNEATFFNQCSNKNIPNSPWPVDLDVNMLPLLRISSIILGICLMPYLFRPLKSHISFINKSIPNASHYFDVEFVSRKNYKNYYLSIVMIVLNFAIFIAKKFSPSNIIDTIALFLFFCXXXXXXXXXXXXXXDMQYIPTTGNGSASVTHYIFLWIGVIGEFVSVIERLILCIYNLYYGPNNSLILSVINLCNVGLLLINGFVQSVLLSIVIKDKSEYEVNKSGTNIYILPLVLCFYNGLYFIYNLFLVDPCYYHCNVFNIAFLTSGLYQI 1470
            M  +  K  DS S ++  I K +I++ F+F++ V I+ NY+IYTL +TPYT+  I YW++IL I+TILF+ NV L   N R+NY+NRNFF KGPTENPKIVYLIC PLI++I SSLS T  FLF + DCGS IDI+F+GSI++FF SM+F+IIN+LSSS+TGELPLVNI+NAFTL++SLAS+WNLT+YN   +L+  FK TV+ VFN++ F N+C  +N+ ++ W ++L+  +L  L IS ++LGICL PY  +P++SH SFINKSI  +    + E  SR NY  YY  +++  L F  ++ +K  PS     I L L  C+++ +NLV++V++ D++Y+ T     +  T+YI L IG+IGEF ++I++LIL I  ++Y  N S++ S++     GL L+NGF+QS+LL ++IK  SEYE     +NIYIL L+LC YNG YFIY +  ++  Y +   FNI     GL +I
Sbjct:    1 MLLRFSKYFDSISPYRLEIYKDAIISMFLFSISVAIIQNYSIYTLRVTPYTVKEIAYWQSILAITTILFIINVMLAFLNSRINYINRNFFQKGPTENPKIVYLICLPLIVIIFSSLSYTTLFLFLYVDCGSVIDIVFSGSIVIFFISMMFVIINILSSSNTGELPLVNIVNAFTLLISLASIWNLTVYNSIYMLSADFKRTVRIVFNDSAFKNECRIRNVTDNKWAINLNSILLSSLNISILMLGICLTPYFLKPIQSHFSFINKSIIKSISCIEEENPSRINYNRYYSVLILFALCFTFYVGQKLYPSTNFYEIELILRLCILVSINLVTIVVMRDLKYVSTVTKKESRETYYIILSIGIIGEFATIIQQLILKINTIFYSTNQSIVTSILLFGFFGLSLVNGFLQSMLLLVIIKVNSEYETIMKRSNIYILSLILCLYNGFYFIYEISSLNQYYENAIGFNIHLFEVGLLKI 474          
BLAST of SMED30003100 vs. Planmine SMEST
Match: SMESG000027096.1 (SMESG000027096.1)

HSP 1 Score: 406.757 bits (1044), Expect = 7.606e-137
Identity = 233/474 (49.16%), Postives = 330/474 (69.62%), Query Frame = 1
Query:   49 MNAKRGKSSDSYSFHKYFIIKYSIVTAFMFTVGVGIVWNYTIYTLSLTPYTIIRIEYWKTILFISTILFLFNVGLILTNYRVNYMNRNFFLKGPTENPKIVYLICFPXXXXXXXXXXCTAAFLFHFNDCGSFIDIIFAGSIILFFTSMIFLIINVLSSSDTGELPLVNIINAFTLMVSLASVWNLTLYNIELVLTKSFKTTVKRVFNEATFFNQCSNKNIPNSPWPVDLDVNMLPLLRISSIILGICLMPYLFRPLKSHISFINKSIPNASHYFDVEFVSRKNYKNYYLSIVMIVLNFAIFIAKKFSPSNIIDTIALFLFFCXXXXXXXXXXXXXXDMQYIPTTGNGSASVTHYIFLWIGVIGEFVSVIERLILCIYNLYYGPNNSLILSVINLCNVGLLLINGFVQSVLLSIVIKDKSEYEVNKSGTNIYILPLVLCFYNGLYFIYNLFLVDPCYYHCNVFNIAFLTSGLYQI 1470
            M  +  K  DS S ++  I K +I++ F+F++ V I+ NY+IYTL +TPYT+  I YW++IL I+TILF+ NV L   N R+NY+NRNFF KGPTENPKIVYLIC PLII+I SSLS T  FLF + DCGS IDI+F+GSI++FF SM+F+IIN+LSSS+TGELPLVNI+NAFTL++SLAS+WNLT+YN   +L+  FK TV  VFN++ F N+C  +N+ ++ W ++L+  +L  L IS ++LGICL PY  +P++SH SFINKSI  +    + E  SR NY  YY  +++  L F  ++ +K  PS     I L L  C+++ +NLV++V++ D++Y+ T     +  T+YI L IG+IGEF ++I++LIL I  ++Y  N S++ S++     GL L+NGF+QS+LL ++IK  SEYE   + +NIYIL L+LC YNG YFIY +  ++  Y +   FNI     GL +I
Sbjct:    1 MLLRFSKYFDSISPYRLEIYKDAIISMFLFSISVAIIQNYSIYTLRVTPYTVKEIAYWQSILAITTILFIINVMLAFLNSRINYINRNFFQKGPTENPKIVYLICLPLIIIIFSSLSYTTLFLFLYVDCGSVIDIVFSGSIVIFFISMMFVIINILSSSNTGELPLVNIVNAFTLLISLASIWNLTVYNSIYMLSADFKITVSSVFNDSAFKNECRIRNVADNKWAINLNSILLSSLNISILMLGICLTPYFLKPIQSHFSFINKSILKSISCIEEENPSRINYNRYYSVLILFALCFTFYVGQKLYPSTNFYEIELILRLCILVSINLVTIVVMRDLKYVSTVTKKESRETYYIILSIGIIGEFATIIQQLILKINTIFYSTNQSIVTSILLFGFFGLSLVNGFLQSMLLLVIIKVNSEYETIMTRSNIYILSLILCLYNGFYFIYEISSLNQYYENAIGFNIHLFEVGLLKI 474          
BLAST of SMED30003100 vs. Planmine SMEST
Match: SMESG000027312.1 (SMESG000027312.1)

HSP 1 Score: 79.337 bits (194), Expect = 1.593e-15
Identity = 69/239 (28.87%), Postives = 120/239 (50.21%), Query Frame = 1
Query:  163 NYTIYTLSLTPYTIIRIEYWKTILFISTILFLFNVGLILTNYRVNYMNRNFFLKGPTENPKIVYLICFPXXXXXXXXXXCTAAFLFHFN----DCGSFIDIIFAGSIILFFTSMIFLIINVLSSSDTGELPLVNIINAFTLMVSLASVWNLTLYNIELVLTKSFKTTV--KRVFNEATFFNQCSNKNIPNSPWPVDLDVNMLPLLRISSIILGICLMPYLFRPLKSHISFINKSIPNAS 861
            NY IY L +     +    W T ++I +++FLFN  LIL +  +NY  RNF  K   ENP I+YL+C    + +L    C   F+F  N        + + +FAG++++ FT++I L+IN   S  T E   +N INAFT + S+ S+ NL  YN+    T++F++T     +++  T+  +C  +               LP+ +   I    C +P+LF  +  ++  + + + + +
Sbjct:    3 NYLIYALRVAGEKRLEGTIWNTFMYIGSVIFLFNFILILYSSHINYKYRNFIDKRIPENPLILYLLC----LPLLVLSLCGLIFIFIHNVMTLSVSKYTNALFAGNLVMLFTAIITLLINTSGSKSTYESWSLNYINAFTTLFSITSLTNLLCYNLVHKATRTFRSTFLNNTIYHNGTY--KCFYQ--------------FLPIFQTIIINTSFCFLPFLFVSINHYVKVLRQYLTDRN 221          
BLAST of SMED30003100 vs. Planmine SMEST
Match: SMESG000025344.1 (SMESG000025344.1)

HSP 1 Score: 73.9442 bits (180), Expect = 8.892e-14
Identity = 66/243 (27.16%), Postives = 119/243 (48.97%), Query Frame = 1
Query:  133 MFTVGVGIVWNYTIYTLSLTPYTIIRIEYWKTILFISTILFLFNVGLILTNYRVNYMNRNFFLKGPTENPKIVYLICFPXXXXXXXXXXCTAAFLFHFNDCGSFIDIIFAGSIILFFTSMIFLIINVLSSSDTGELPLVNIINAFTLMVSLASVWNLTLYNIELVLTKSFKTTVKRVFNEATFFNQCSNKNIPNSPWPVDLDVNMLPLLRISSIILGICLMPYLFRPLKSHISFINKSIPNAS 861
            +F  G+  V NY  Y   ++P    + EY   I +  + + + ++ LI  N ++N+  RN  +K   E P I YLIC P++ + L  L     F + F   G+  +I++   +I  +   I L+I++   SDTGE   +N  N+ T+++++ SV      NI ++LT  F  T+    N  TF +  SN N   + +       ++ L + + I L +  +P+L  PLK +++ + +  P   
Sbjct:   24 LFLFGMVYVTNYGFYVYQISPRGDRKDEYLDKINYSISFVKIVSIILICYNTQINHRFRNLRIKHKLEQPLIFYLICLPMLFISLMGLFV-IIFHYTFEKSGTSTNILYFALVIFEYFLFIILVIDINGFSDTGEEWFMNYFNSMTIIITMTSVMIQICLNIIMILTDDFTNTM----NRTTFVSLFSNHNF--TIFDKTCYRTLVFLKKRAVITLSLVFIPFLVIPLKRNLTHLFRFKPKED 259          
The following BLAST results are available for this feature:
BLAST of SMED30003100 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003100 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003100 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003100 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003100 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003100 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003100 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003100 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003100 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003100 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003100 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003100 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003100 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003100 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027093.10.000e+099.41SMESG000027093.1[more]
SMESG000027091.12.124e-14148.95SMESG000027091.1[more]
SMESG000027096.17.606e-13749.16SMESG000027096.1[more]
SMESG000027312.11.593e-1528.87SMESG000027312.1[more]
SMESG000025344.18.892e-1427.16SMESG000025344.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003100 ID=SMED30003100|Name=SMED30003100|organism=Schmidtea mediterranea sexual|type=transcript|length=1655bp
TTTCATTATGCCTGATTATAGTCAATAAACGAAATCTGATAACAGAAAAT
GAATGCAAAACGAGGGAAATCAAGCGATTCATACTCATTTCACAAATACT
TTATTATCAAATATTCTATTGTTACGGCTTTCATGTTCACCGTCGGTGTT
GGAATCGTGTGGAATTACACAATTTACACCCTCTCATTGACCCCTTACAC
AATCATCCGGATCGAGTATTGGAAAACCATCCTTTTTATATCAACAATTC
TATTTCTTTTCAATGTTGGATTGATATTAACGAATTACAGAGTTAATTAC
ATGAACCGGAATTTCTTTTTAAAAGGTCCCACTGAAAACCCGAAAATCGT
ATATTTGATTTGCTTTCCTCTTATCATACTCATTCTATCTTCATTATCAT
GCACGGCGGCATTCTTGTTCCACTTCAATGATTGCGGTAGTTTTATTGAT
ATCATCTTTGCGGGATCCATTATTCTCTTTTTCACTTCGATGATTTTTCT
AATAATAAACGTTCTCAGCTCGAGTGATACCGGAGAATTGCCTTTGGTAA
ACATTATCAATGCCTTTACTCTCATGGTATCCTTAGCGTCAGTCTGGAAC
TTGACCCTTTACAATATTGAATTGGTATTAACAAAGTCGTTCAAAACCAC
CGTGAAAAGGGTATTCAACGAGGCAACCTTTTTCAACCAATGTTCCAATA
AAAATATACCCAACTCCCCTTGGCCTGTGGATTTAGATGTGAACATGTTG
CCTTTATTAAGGATATCAAGCATAATTCTTGGTATTTGTTTGATGCCTTA
CCTCTTCAGGCCTTTGAAATCCCACATTTCCTTCATCAATAAAAGTATAC
CAAACGCTTCTCATTATTTTGATGTTGAGTTTGTCAGTCGGAAAAATTAT
AAAAATTATTATTTATCAATTGTTATGATAGTTTTAAACTTTGCAATTTT
TATTGCAAAAAAATTTTCTCCATCCAACATCATTGACACGATCGCTTTAT
TTCTGTTTTTCTGCGTTATGCTGATAGTGAACCTCGTTTCGGTTGTCTTG
TTGGTAGATATGCAATACATTCCCACGACAGGAAACGGAAGCGCAAGCGT
GACGCATTATATATTCCTTTGGATAGGAGTAATTGGTGAATTTGTTTCGG
TGATAGAACGCCTGATATTGTGCATATACAATTTATACTATGGGCCAAAC
AACTCTCTGATCTTGTCAGTCATTAACTTGTGCAATGTCGGTTTGTTATT
AATAAATGGATTCGTGCAGTCAGTTCTCCTCTCTATCGTGATCAAGGACA
AATCGGAATATGAGGTCAATAAATCAGGGACAAATATTTATATTTTACCT
CTAGTTCTTTGTTTTTATAATGGATTATATTTTATCTATAATTTGTTTCT
CGTGGATCCTTGCTACTATCACTGCAATGTTTTCAATATAGCCTTTCTCA
CGTCTGGTTTATACCAAATTTGTTTACCTTTGACCCTGCTCTATCGTTTA
TTCTCATCCTTACTGTTTACTTTGAATTATTTATCCATGTCCAACAGCCA
TCACCGAGTCGTAATCAACTCCTAATTTTTATCAAACTGAATTATATACA
GCAATGATTTTGATTTTGAAACACTTTTTTGGTACATGATCTTCTTGTGT
ATTCA
back to top

protein sequence of SMED30003100-orf-1

>SMED30003100-orf-1 ID=SMED30003100-orf-1|Name=SMED30003100-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=509bp
MNAKRGKSSDSYSFHKYFIIKYSIVTAFMFTVGVGIVWNYTIYTLSLTPY
TIIRIEYWKTILFISTILFLFNVGLILTNYRVNYMNRNFFLKGPTENPKI
VYLICFPLIILILSSLSCTAAFLFHFNDCGSFIDIIFAGSIILFFTSMIF
LIINVLSSSDTGELPLVNIINAFTLMVSLASVWNLTLYNIELVLTKSFKT
TVKRVFNEATFFNQCSNKNIPNSPWPVDLDVNMLPLLRISSIILGICLMP
YLFRPLKSHISFINKSIPNASHYFDVEFVSRKNYKNYYLSIVMIVLNFAI
FIAKKFSPSNIIDTIALFLFFCVMLIVNLVSVVLLVDMQYIPTTGNGSAS
VTHYIFLWIGVIGEFVSVIERLILCIYNLYYGPNNSLILSVINLCNVGLL
LINGFVQSVLLSIVIKDKSEYEVNKSGTNIYILPLVLCFYNGLYFIYNLF
LVDPCYYHCNVFNIAFLTSGLYQICLPLTLLYRLFSSLLFTLNYLSMSNS
HHRVVINS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 286..303
NoneNo IPR availableTMHMMTMhelixcoord: 234..256
NoneNo IPR availableTMHMMTMhelixcoord: 57..79
NoneNo IPR availableTMHMMTMhelixcoord: 387..409
NoneNo IPR availableTMHMMTMhelixcoord: 164..186
NoneNo IPR availableTMHMMTMhelixcoord: 355..377
NoneNo IPR availableTMHMMTMhelixcoord: 313..335
NoneNo IPR availableTMHMMTMhelixcoord: 462..484
NoneNo IPR availableTMHMMTMhelixcoord: 100..122
NoneNo IPR availableTMHMMTMhelixcoord: 430..452
NoneNo IPR availableTMHMMTMhelixcoord: 20..42
NoneNo IPR availableTMHMMTMhelixcoord: 135..157