F-box and WD repeat domain containing 7

Overview
NameF-box and WD repeat domain containing 7
Smed IDSMED30003098
Length (bp)1490
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of F-box and WD repeat domain containing 7 (SMED30003098) t-SNE clustered cells

Violin plots show distribution of expression levels for F-box and WD repeat domain containing 7 (SMED30003098) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of F-box and WD repeat domain containing 7 (SMED30003098) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for F-box and WD repeat domain containing 7 (SMED30003098) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Human
Match: FBXW7 (F-box and WD repeat domain containing 7 [Source:HGNC Symbol;Acc:HGNC:16712])

HSP 1 Score: 320.857 bits (821), Expect = 9.934e-103
Identity = 177/445 (39.78%), Postives = 260/445 (58.43%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQITFLKTKEF--HDLLKYG---STLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSV 1409
            +++I  LP EL  ++  F+  KDLL  +Q  + W  L+ D+L+W  KC++    +        ++K G   S  K  YI   ++ TNW+    K    +  H   +IT L      I S SDD T+ V   VTG+ +R L GH GGVWS    +  +   I S S D T+++W+   G C+H   GH + VRC+   +        +++SGSRD+T+R+WD+ T +C H+L     GH  A+RCVQ     VVSG+YD  V+VWD  T  C   L GHT+RVY++      ++S SLDT+IRVWD+ TG CIH L GH+SLTSGM +   ++++VSGNADST+++W + TG+C+  L G   H S +T +Q   + F+++S   GTVKLW+L  G F+R+++ L+    G ++WR   SNT LVCAVG+ N  + +KL + DF V
Sbjct:  160 RDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS----SQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEK-------RVVSGSRDATLRVWDIETGQCLHVL----MGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKN-FVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDV 586          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Human
Match: FBXW7 (F-box and WD repeat domain containing 7 [Source:HGNC Symbol;Acc:HGNC:16712])

HSP 1 Score: 320.472 bits (820), Expect = 4.003e-102
Identity = 177/445 (39.78%), Postives = 260/445 (58.43%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQITFLKTKEF--HDLLKYG---STLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSV 1409
            +++I  LP EL  ++  F+  KDLL  +Q  + W  L+ D+L+W  KC++    +        ++K G   S  K  YI   ++ TNW+    K    +  H   +IT L      I S SDD T+ V   VTG+ +R L GH GGVWS    +  +   I S S D T+++W+   G C+H   GH + VRC+   +        +++SGSRD+T+R+WD+ T +C H+L     GH  A+RCVQ     VVSG+YD  V+VWD  T  C   L GHT+RVY++      ++S SLDT+IRVWD+ TG CIH L GH+SLTSGM +   ++++VSGNADST+++W + TG+C+  L G   H S +T +Q   + F+++S   GTVKLW+L  G F+R+++ L+    G ++WR   SNT LVCAVG+ N  + +KL + DF V
Sbjct:  198 RDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS----SQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEK-------RVVSGSRDATLRVWDIETGQCLHVL----MGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKN-FVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDV 624          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Human
Match: FBXW7 (F-box and WD repeat domain containing 7 [Source:HGNC Symbol;Acc:HGNC:16712])

HSP 1 Score: 322.013 bits (824), Expect = 7.351e-102
Identity = 177/445 (39.78%), Postives = 260/445 (58.43%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQITFLKTKEF--HDLLKYG---STLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSV 1409
            +++I  LP EL  ++  F+  KDLL  +Q  + W  L+ D+L+W  KC++    +        ++K G   S  K  YI   ++ TNW+    K    +  H   +IT L      I S SDD T+ V   VTG+ +R L GH GGVWS    +  +   I S S D T+++W+   G C+H   GH + VRC+   +        +++SGSRD+T+R+WD+ T +C H+L     GH  A+RCVQ     VVSG+YD  V+VWD  T  C   L GHT+RVY++      ++S SLDT+IRVWD+ TG CIH L GH+SLTSGM +   ++++VSGNADST+++W + TG+C+  L G   H S +T +Q   + F+++S   GTVKLW+L  G F+R+++ L+    G ++WR   SNT LVCAVG+ N  + +KL + DF V
Sbjct:  278 RDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS----SQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEK-------RVVSGSRDATLRVWDIETGQCLHVL----MGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKN-FVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDV 704          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Human
Match: FBXW7 (F-box and WD repeat domain containing 7 [Source:HGNC Symbol;Acc:HGNC:16712])

HSP 1 Score: 322.013 bits (824), Expect = 7.351e-102
Identity = 177/445 (39.78%), Postives = 260/445 (58.43%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQITFLKTKEF--HDLLKYG---STLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSV 1409
            +++I  LP EL  ++  F+  KDLL  +Q  + W  L+ D+L+W  KC++    +        ++K G   S  K  YI   ++ TNW+    K    +  H   +IT L      I S SDD T+ V   VTG+ +R L GH GGVWS    +  +   I S S D T+++W+   G C+H   GH + VRC+   +        +++SGSRD+T+R+WD+ T +C H+L     GH  A+RCVQ     VVSG+YD  V+VWD  T  C   L GHT+RVY++      ++S SLDT+IRVWD+ TG CIH L GH+SLTSGM +   ++++VSGNADST+++W + TG+C+  L G   H S +T +Q   + F+++S   GTVKLW+L  G F+R+++ L+    G ++WR   SNT LVCAVG+ N  + +KL + DF V
Sbjct:  278 RDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS----SQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEK-------RVVSGSRDATLRVWDIETGQCLHVL----MGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKN-FVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDV 704          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Human
Match: FBXW7 (F-box and WD repeat domain containing 7 [Source:HGNC Symbol;Acc:HGNC:16712])

HSP 1 Score: 322.013 bits (824), Expect = 7.351e-102
Identity = 177/445 (39.78%), Postives = 260/445 (58.43%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQITFLKTKEF--HDLLKYG---STLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSV 1409
            +++I  LP EL  ++  F+  KDLL  +Q  + W  L+ D+L+W  KC++    +        ++K G   S  K  YI   ++ TNW+    K    +  H   +IT L      I S SDD T+ V   VTG+ +R L GH GGVWS    +  +   I S S D T+++W+   G C+H   GH + VRC+   +        +++SGSRD+T+R+WD+ T +C H+L     GH  A+RCVQ     VVSG+YD  V+VWD  T  C   L GHT+RVY++      ++S SLDT+IRVWD+ TG CIH L GH+SLTSGM +   ++++VSGNADST+++W + TG+C+  L G   H S +T +Q   + F+++S   GTVKLW+L  G F+R+++ L+    G ++WR   SNT LVCAVG+ N  + +KL + DF V
Sbjct:  278 RDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS----SQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEK-------RVVSGSRDATLRVWDIETGQCLHVL----MGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKN-FVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDV 704          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Celegans
Match: sel-10 (F-box/WD repeat-containing protein sel-10 [Source:UniProtKB/Swiss-Prot;Acc:Q93794])

HSP 1 Score: 248.054 bits (632), Expect = 3.753e-75
Identity = 166/487 (34.09%), Postives = 249/487 (51.13%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTS-----------KCRQIT---------------------------FLKTKEFHDLLKYGSTLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQ-KPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGA--TVMLSASLDTTIRVWDI---HTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSVKSP 1418
            ++++  LP EL   I   +   DLL  +QVSK+W  +S  D +W S              ++T                           FLK ++F D+ +  +  K +Y+   K+  NW  N    S  +  H   +IT + + D  + + SDD T+ V  +  GE +  L GH GGVW+     I Q   YI S S D TV++W  V+G  +H  +GH + VRC+             L++GSRD+T+R+WDV + +  HL  A+  GH  A+RCVQ     VVSG YD TV++W+  TG C   L GH +RVY++   +  +++ S SLDT+IRVWD        C+ +L GH SLTSGM +  +  ++VS NADS +RVW +  G C+  L G   H S +T +Q      + +S   GTVKLW+++ G  +RD++ L     G  +WR   ++T L CAVG+ N  + +K+ + DF    P
Sbjct:  121 RDFLSCLPVELGMKILHNLTGYDLLKVAQVSKNWKLISEIDKIWKSLGVEEFKHHPDPTDRVTGAWQGTAIAAGVTIPDHIQPCDLNVHRFLKLQKFGDIFERAAD-KSRYLRADKIEKNWNANPIMGSAVLRGHEDHVITCMQIHDDVLVTGSDDNTLKVWCIDKGEVMYTLVGHTGGVWTS---QISQCGRYIVSGSTDRTVKVWSTVDGSLLHTLQGHTSTVRCMAMAGS-------ILVTGSRDTTLRVWDVESGR--HL--ATLHGHHAAVRCVQFDGTTVVSGGYDFTVKIWNAHTGRCIRTLTGHNNRVYSLLFESERSIVCSGSLDTSIRVWDFTRPEGQECVALLQGHTSLTSGMQLRGN--ILVSCNADSHVRVWDIHEGTCVHMLSG---HRSAITSLQWFGRNMVATSSDDGTVKLWDIERGALIRDLVTLDSGGNGGCIWRLCSTSTMLACAVGSRNNTEETKVILLDFDAVYP 587          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Celegans
Match: sel-10 (F-box/WD repeat-containing protein sel-10 [Source:UniProtKB/Swiss-Prot;Acc:Q93794])

HSP 1 Score: 247.669 bits (631), Expect = 3.945e-75
Identity = 166/487 (34.09%), Postives = 249/487 (51.13%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTS-----------KCRQIT---------------------------FLKTKEFHDLLKYGSTLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQ-KPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGA--TVMLSASLDTTIRVWDI---HTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSVKSP 1418
            ++++  LP EL   I   +   DLL  +QVSK+W  +S  D +W S              ++T                           FLK ++F D+ +  +  K +Y+   K+  NW  N    S  +  H   +IT + + D  + + SDD T+ V  +  GE +  L GH GGVW+     I Q   YI S S D TV++W  V+G  +H  +GH + VRC+             L++GSRD+T+R+WDV + +  HL  A+  GH  A+RCVQ     VVSG YD TV++W+  TG C   L GH +RVY++   +  +++ S SLDT+IRVWD        C+ +L GH SLTSGM +  +  ++VS NADS +RVW +  G C+  L G   H S +T +Q      + +S   GTVKLW+++ G  +RD++ L     G  +WR   ++T L CAVG+ N  + +K+ + DF    P
Sbjct:  119 RDFLSCLPVELGMKILHNLTGYDLLKVAQVSKNWKLISEIDKIWKSLGVEEFKHHPDPTDRVTGAWQGTAIAAGVTIPDHIQPCDLNVHRFLKLQKFGDIFERAAD-KSRYLRADKIEKNWNANPIMGSAVLRGHEDHVITCMQIHDDVLVTGSDDNTLKVWCIDKGEVMYTLVGHTGGVWTS---QISQCGRYIVSGSTDRTVKVWSTVDGSLLHTLQGHTSTVRCMAMAGS-------ILVTGSRDTTLRVWDVESGR--HL--ATLHGHHAAVRCVQFDGTTVVSGGYDFTVKIWNAHTGRCIRTLTGHNNRVYSLLFESERSIVCSGSLDTSIRVWDFTRPEGQECVALLQGHTSLTSGMQLRGN--ILVSCNADSHVRVWDIHEGTCVHMLSG---HRSAITSLQWFGRNMVATSSDDGTVKLWDIERGALIRDLVTLDSGGNGGCIWRLCSTSTMLACAVGSRNNTEETKVILLDFDAVYP 585          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Celegans
Match: sel-10 (F-box/WD repeat-containing protein sel-10 [Source:UniProtKB/Swiss-Prot;Acc:Q93794])

HSP 1 Score: 247.669 bits (631), Expect = 3.945e-75
Identity = 166/487 (34.09%), Postives = 249/487 (51.13%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTS-----------KCRQIT---------------------------FLKTKEFHDLLKYGSTLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQ-KPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGA--TVMLSASLDTTIRVWDI---HTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSVKSP 1418
            ++++  LP EL   I   +   DLL  +QVSK+W  +S  D +W S              ++T                           FLK ++F D+ +  +  K +Y+   K+  NW  N    S  +  H   +IT + + D  + + SDD T+ V  +  GE +  L GH GGVW+     I Q   YI S S D TV++W  V+G  +H  +GH + VRC+             L++GSRD+T+R+WDV + +  HL  A+  GH  A+RCVQ     VVSG YD TV++W+  TG C   L GH +RVY++   +  +++ S SLDT+IRVWD        C+ +L GH SLTSGM +  +  ++VS NADS +RVW +  G C+  L G   H S +T +Q      + +S   GTVKLW+++ G  +RD++ L     G  +WR   ++T L CAVG+ N  + +K+ + DF    P
Sbjct:  119 RDFLSCLPVELGMKILHNLTGYDLLKVAQVSKNWKLISEIDKIWKSLGVEEFKHHPDPTDRVTGAWQGTAIAAGVTIPDHIQPCDLNVHRFLKLQKFGDIFERAAD-KSRYLRADKIEKNWNANPIMGSAVLRGHEDHVITCMQIHDDVLVTGSDDNTLKVWCIDKGEVMYTLVGHTGGVWTS---QISQCGRYIVSGSTDRTVKVWSTVDGSLLHTLQGHTSTVRCMAMAGS-------ILVTGSRDTTLRVWDVESGR--HL--ATLHGHHAAVRCVQFDGTTVVSGGYDFTVKIWNAHTGRCIRTLTGHNNRVYSLLFESERSIVCSGSLDTSIRVWDFTRPEGQECVALLQGHTSLTSGMQLRGN--ILVSCNADSHVRVWDIHEGTCVHMLSG---HRSAITSLQWFGRNMVATSSDDGTVKLWDIERGALIRDLVTLDSGGNGGCIWRLCSTSTMLACAVGSRNNTEETKVILLDFDAVYP 585          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Celegans
Match: lin-23 (F-box/WD repeat-containing protein lin-23 [Source:UniProtKB/Swiss-Prot;Acc:Q09990])

HSP 1 Score: 123.25 bits (308), Expect = 9.346e-30
Identity = 124/442 (28.05%), Postives = 189/442 (42.76%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWH---------------SLSNDDLVWT-SKCRQ-ITFLK------TKEFHDLLKYGSTLKQQ--------YIYYLKLF-----------TNWQ-CNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVW--------RVSTGECILELLGQQAHTSPLTGIQIVLDKF-IVSSELSGTVKLWNLDDG 1259
            +++I +LP  L   I   +N   L SC +VS SW                ++ +D L W  S+ RQ   FL        +   +   Y   +K+         +++Y KL+            NW+  N++   I     +   +  L   D  I S   D TI + D       R L GH G V  L     Y    I S S+D TVR+WD   G C+     H     C   + +  +N    +++ S+D +I +WD+ + + D  +     GH  A+  V     ++VS S D T++VW + T      L GH   +  +     +++S S D TIR+WDIH+G+C+ VL GH+ L     +  DE  +VSG  D  I+VW        R  + E  L  L Q  HT  +  +Q   D F IVSS    T+ +W+  D 
Sbjct:   26 RDFISNLPAHLVELILFNVNSDSLKSCEEVSTSWRCALARGQHWKKLIEKNVRSDSLWWGLSEKRQWDKFLNISRDMSVRRICEKFNYDVNIKRDKLDQLILMHVFYSKLYPKIIRDIHNIDNNWKRGNYKMTRINCQSENSKGVYCLQYDDDKIVSGLRDNTIKIWDRKDYSCSRILSGHTGSVLCLQ----YDNRVIISGSSDATVRVWDVETGECIKTLIHH-----CEAVLHLRFANG--IMVTCSKDRSIAVWDMVSPR-DITIRRVLVGHRAAVNVVDFDDRYIVSASGDRTIKVWSMDTLEFVRTLAGHRRGIACLQYRGRLVVSGSSDNTIRLWDIHSGVCLRVLEGHEELVR--CIRFDEKRIVSGAYDGKIKVWDLQAALDPRALSSEICLCSLVQ--HTGRVFRLQ--FDDFQIVSSSHDDTILIWDFLDA 449          

HSP 2 Score: 82.8037 bits (203), Expect = 1.273e-16
Identity = 57/207 (27.54%), Postives = 94/207 (45.41%), Query Frame = 3
Query:  780 TGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICI-------------------------------------------HVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLR 1271
            + ++  + C+Q     +VSG  D T+++WD +   C+ +L+GHT  V  +     V++S S D T+RVWD+ TG CI                                            VLVGH++  +  V++ D+  +VS + D TI+VW + T E +  L G   H   +  +Q    + +VS     T++LW++  GV LR
Sbjct:  164 SENSKGVYCLQYDDDKIVSGLRDNTIKIWDRKDYSCSRILSGHTGSVLCLQYDNRVIISGSSDATVRVWDVETGECIKTLIHHCEAVLHLRFANGIMVTCSKDRSIAVWDMVSPRDITIRRVLVGHRAAVN--VVDFDDRYIVSASGDRTIKVWSMDTLEFVRTLAG---HRRGIACLQ-YRGRLVVSGSSDNTIRLWDIHSGVCLR 364          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Celegans
Match: lin-23 (F-box/WD repeat-containing protein lin-23 [Source:UniProtKB/Swiss-Prot;Acc:Q09990])

HSP 1 Score: 123.25 bits (308), Expect = 9.523e-30
Identity = 124/442 (28.05%), Postives = 189/442 (42.76%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWH---------------SLSNDDLVWT-SKCRQ-ITFLK------TKEFHDLLKYGSTLKQQ--------YIYYLKLF-----------TNWQ-CNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVW--------RVSTGECILELLGQQAHTSPLTGIQIVLDKF-IVSSELSGTVKLWNLDDG 1259
            +++I +LP  L   I   +N   L SC +VS SW                ++ +D L W  S+ RQ   FL        +   +   Y   +K+         +++Y KL+            NW+  N++   I     +   +  L   D  I S   D TI + D       R L GH G V  L     Y    I S S+D TVR+WD   G C+     H     C   + +  +N    +++ S+D +I +WD+ + + D  +     GH  A+  V     ++VS S D T++VW + T      L GH   +  +     +++S S D TIR+WDIH+G+C+ VL GH+ L     +  DE  +VSG  D  I+VW        R  + E  L  L Q  HT  +  +Q   D F IVSS    T+ +W+  D 
Sbjct:   26 RDFISNLPAHLVELILFNVNSDSLKSCEEVSTSWRCALARGQHWKKLIEKNVRSDSLWWGLSEKRQWDKFLNISRDMSVRRICEKFNYDVNIKRDKLDQLILMHVFYSKLYPKIIRDIHNIDNNWKRGNYKMTRINCQSENSKGVYCLQYDDDKIVSGLRDNTIKIWDRKDYSCSRILSGHTGSVLCLQ----YDNRVIISGSSDATVRVWDVETGECIKTLIHH-----CEAVLHLRFANG--IMVTCSKDRSIAVWDMVSPR-DITIRRVLVGHRAAVNVVDFDDRYIVSASGDRTIKVWSMDTLEFVRTLAGHRRGIACLQYRGRLVVSGSSDNTIRLWDIHSGVCLRVLEGHEELVR--CIRFDEKRIVSGAYDGKIKVWDLQAALDPRALSSEICLCSLVQ--HTGRVFRLQ--FDDFQIVSSSHDDTILIWDFLDA 449          

HSP 2 Score: 83.1889 bits (204), Expect = 1.139e-16
Identity = 57/207 (27.54%), Postives = 94/207 (45.41%), Query Frame = 3
Query:  780 TGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICI-------------------------------------------HVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLR 1271
            + ++  + C+Q     +VSG  D T+++WD +   C+ +L+GHT  V  +     V++S S D T+RVWD+ TG CI                                            VLVGH++  +  V++ D+  +VS + D TI+VW + T E +  L G   H   +  +Q    + +VS     T++LW++  GV LR
Sbjct:  164 SENSKGVYCLQYDDDKIVSGLRDNTIKIWDRKDYSCSRILSGHTGSVLCLQYDNRVIISGSSDATVRVWDVETGECIKTLIHHCEAVLHLRFANGIMVTCSKDRSIAVWDMVSPRDITIRRVLVGHRAAVN--VVDFDDRYIVSASGDRTIKVWSMDTLEFVRTLAG---HRRGIACLQ-YRGRLVVSGSSDNTIRLWDIHSGVCLR 364          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Fly
Match: ago (gene:FBgn0041171 transcript:FBtr0073246)

HSP 1 Score: 310.842 bits (795), Expect = 8.010e-94
Identity = 172/452 (38.05%), Postives = 257/452 (56.86%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQITFL------KTKEFHD--LLKYGSTLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSVKSPC 1421
            +++I  LP EL   +  ++  KDLL  +Q  +SW  L +D+L+W  KCR+   L      + K   D  +    S  K  Y+    +  NW+    ++   +  H   +IT L      I S SDD T+ V   V G+ +R L GH GGVWS    +      I S S D T+++WD   G CVH  +GH + VRC+    +  S    K++SGSRD+T+R+WD+    C H+L     GH  A+RCVQ     +VSG+YD  V++W      C   L GHT+RVY++      ++S SLDT+IRVWD+ TG C H L+GH+SLTSGM +   ++++VSGNADST++VW ++TG+C+  L G   H S +T +Q    +F+V+S   GTVKLW++  G F+R+++ L     G ++WR   ++T L+CAVG+ N  + +KL + DF V+  C
Sbjct:  889 RDFISLLPRELALFVLSYLEPKDLLRAAQTCRSWRFLCDDNLLWKEKCRKAQILAEPRSDRPKRGRDGNMPPIASPWKAAYMRQHIIEMNWRSRPVRKPKVLKGHDDHVITCLQFSGNRIVSGSDDNTLKVWSAVNGKCLRTLVGHTGGVWS----SQMSGNIIISGSTDRTLKVWDMDSGACVHTLQGHTSTVRCM---HLHGS----KVVSGSRDATLRVWDIEQGSCLHVL----VGHLAAVRCVQYDGKLIVSGAYDYMVKIWHPERQECLHTLQGHTNRVYSLQFDGLHVVSGSLDTSIRVWDVETGNCKHTLMGHQSLTSGMELR--QNILVSGNADSTVKVWDITTGQCLQTLSGPNKHHSAVTCLQFN-SRFVVTSSDDGTVKLWDVKTGDFIRNLVALDSGGSGGVVWRIRANDTKLICAVGSRNGTEETKLMVLDFDVEGAC 1322          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Fly
Match: ago (gene:FBgn0041171 transcript:FBtr0073245)

HSP 1 Score: 310.842 bits (795), Expect = 8.010e-94
Identity = 172/452 (38.05%), Postives = 257/452 (56.86%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQITFL------KTKEFHD--LLKYGSTLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSVKSPC 1421
            +++I  LP EL   +  ++  KDLL  +Q  +SW  L +D+L+W  KCR+   L      + K   D  +    S  K  Y+    +  NW+    ++   +  H   +IT L      I S SDD T+ V   V G+ +R L GH GGVWS    +      I S S D T+++WD   G CVH  +GH + VRC+    +  S    K++SGSRD+T+R+WD+    C H+L     GH  A+RCVQ     +VSG+YD  V++W      C   L GHT+RVY++      ++S SLDT+IRVWD+ TG C H L+GH+SLTSGM +   ++++VSGNADST++VW ++TG+C+  L G   H S +T +Q    +F+V+S   GTVKLW++  G F+R+++ L     G ++WR   ++T L+CAVG+ N  + +KL + DF V+  C
Sbjct:  889 RDFISLLPRELALFVLSYLEPKDLLRAAQTCRSWRFLCDDNLLWKEKCRKAQILAEPRSDRPKRGRDGNMPPIASPWKAAYMRQHIIEMNWRSRPVRKPKVLKGHDDHVITCLQFSGNRIVSGSDDNTLKVWSAVNGKCLRTLVGHTGGVWS----SQMSGNIIISGSTDRTLKVWDMDSGACVHTLQGHTSTVRCM---HLHGS----KVVSGSRDATLRVWDIEQGSCLHVL----VGHLAAVRCVQYDGKLIVSGAYDYMVKIWHPERQECLHTLQGHTNRVYSLQFDGLHVVSGSLDTSIRVWDVETGNCKHTLMGHQSLTSGMELR--QNILVSGNADSTVKVWDITTGQCLQTLSGPNKHHSAVTCLQFN-SRFVVTSSDDGTVKLWDVKTGDFIRNLVALDSGGSGGVVWRIRANDTKLICAVGSRNGTEETKLMVLDFDVEGAC 1322          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Fly
Match: ago (gene:FBgn0041171 transcript:FBtr0073247)

HSP 1 Score: 310.842 bits (795), Expect = 8.010e-94
Identity = 172/452 (38.05%), Postives = 257/452 (56.86%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQITFL------KTKEFHD--LLKYGSTLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSVKSPC 1421
            +++I  LP EL   +  ++  KDLL  +Q  +SW  L +D+L+W  KCR+   L      + K   D  +    S  K  Y+    +  NW+    ++   +  H   +IT L      I S SDD T+ V   V G+ +R L GH GGVWS    +      I S S D T+++WD   G CVH  +GH + VRC+    +  S    K++SGSRD+T+R+WD+    C H+L     GH  A+RCVQ     +VSG+YD  V++W      C   L GHT+RVY++      ++S SLDT+IRVWD+ TG C H L+GH+SLTSGM +   ++++VSGNADST++VW ++TG+C+  L G   H S +T +Q    +F+V+S   GTVKLW++  G F+R+++ L     G ++WR   ++T L+CAVG+ N  + +KL + DF V+  C
Sbjct:  889 RDFISLLPRELALFVLSYLEPKDLLRAAQTCRSWRFLCDDNLLWKEKCRKAQILAEPRSDRPKRGRDGNMPPIASPWKAAYMRQHIIEMNWRSRPVRKPKVLKGHDDHVITCLQFSGNRIVSGSDDNTLKVWSAVNGKCLRTLVGHTGGVWS----SQMSGNIIISGSTDRTLKVWDMDSGACVHTLQGHTSTVRCM---HLHGS----KVVSGSRDATLRVWDIEQGSCLHVL----VGHLAAVRCVQYDGKLIVSGAYDYMVKIWHPERQECLHTLQGHTNRVYSLQFDGLHVVSGSLDTSIRVWDVETGNCKHTLMGHQSLTSGMELR--QNILVSGNADSTVKVWDITTGQCLQTLSGPNKHHSAVTCLQFN-SRFVVTSSDDGTVKLWDVKTGDFIRNLVALDSGGSGGVVWRIRANDTKLICAVGSRNGTEETKLMVLDFDVEGAC 1322          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Fly
Match: Lis-1 (gene:FBgn0015754 transcript:FBtr0087241)

HSP 1 Score: 116.316 bits (290), Expect = 4.313e-28
Identity = 91/302 (30.13%), Postives = 135/302 (44.70%), Query Frame = 3
Query:  423 IASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEG-RCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQ---ASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTI----------------------HLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQI-VLDKFIVSSELSGTVKLWN 1247
            + S S+D TI + D  TGE  R L+GH   V  +   A  Q   +AS SAD +++LWDF +   C+    GH++ V  +  V   +      ++S SRD TI++W+V T  C      + TGH   +R V+     S++    S D T+RVW   +  C   L  H   V  I                      H     + S S D TIR+WD+  G+C+  L GH +   G+  +     +VS + D TIRVW +    C+  L    AH    T I       +++S  +  TVK+W 
Sbjct:  123 MVSASEDATIRIWDFETGEYERSLKGHTDSVQDVAFDA--QGKLLASCSADLSIKLWDFQQSYECIKTMHGHDHNVSSVAFVPAGDY-----VLSASRDRTIKMWEVATGYC----VKTYTGHREWVRMVRVHIEGSIFATC-SNDQTIRVWLTNSKDCKVELRDHEHTVECIAWAPEAAASAINEAAGADNKKGHHQGPFLASGSRDKTIRIWDVSVGLCLLTLSGHDNWVRGLAFHPGGKYLVSASDDKTIRVWDLRNKRCMKTLY---AHQHFCTSIDFHKAHPYVISGSVDQTVKVWE 409          

HSP 2 Score: 66.6254 bits (161), Expect = 1.692e-11
Identity = 42/112 (37.50%), Postives = 59/112 (52.68%), Query Frame = 3
Query:  540 YQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIR 875
            +Q P++AS S D T+R+WD   G C+    GH+N VR L         K   L+S S D TIR+WD+  ++C   L A    H         +  +V+SGS D TV+VW+ R
Sbjct:  307 HQGPFLASGSRDKTIRIWDVSVGLCLLTLSGHDNWVRGLA---FHPGGK--YLVSASDDKTIRVWDLRNKRCMKTLYAHQ--HFCTSIDFHKAHPYVISGSVDQTVKVWECR 411          

HSP 3 Score: 56.225 bits (134), Expect = 3.887e-8
Identity = 36/126 (28.57%), Postives = 60/126 (47.62%), Query Frame = 3
Query:  891 FVLNGHTDRVYTI--HLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTG-ECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDG 1259
            F L GH   +  +  H    +M+SAS D TIR+WD  TG     L GH      +  ++   L+ S +AD +I++W      ECI  + G   + S +  +      +++S+    T+K+W +  G
Sbjct:  102 FSLTGHRASITRVIFHPIFALMVSASEDATIRIWDFETGEYERSLKGHTDSVQDVAFDAQGKLLASCSADLSIKLWDFQQSYECIKTMHGHDHNVSSVAFVPA--GDYVLSASRDRTIKMWEVATG 225          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Fly
Match: Lis-1 (gene:FBgn0015754 transcript:FBtr0304747)

HSP 1 Score: 116.316 bits (290), Expect = 4.313e-28
Identity = 91/302 (30.13%), Postives = 135/302 (44.70%), Query Frame = 3
Query:  423 IASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEG-RCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQ---ASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTI----------------------HLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQI-VLDKFIVSSELSGTVKLWN 1247
            + S S+D TI + D  TGE  R L+GH   V  +   A  Q   +AS SAD +++LWDF +   C+    GH++ V  +  V   +      ++S SRD TI++W+V T  C      + TGH   +R V+     S++    S D T+RVW   +  C   L  H   V  I                      H     + S S D TIR+WD+  G+C+  L GH +   G+  +     +VS + D TIRVW +    C+  L    AH    T I       +++S  +  TVK+W 
Sbjct:  123 MVSASEDATIRIWDFETGEYERSLKGHTDSVQDVAFDA--QGKLLASCSADLSIKLWDFQQSYECIKTMHGHDHNVSSVAFVPAGDY-----VLSASRDRTIKMWEVATGYC----VKTYTGHREWVRMVRVHIEGSIFATC-SNDQTIRVWLTNSKDCKVELRDHEHTVECIAWAPEAAASAINEAAGADNKKGHHQGPFLASGSRDKTIRIWDVSVGLCLLTLSGHDNWVRGLAFHPGGKYLVSASDDKTIRVWDLRNKRCMKTLY---AHQHFCTSIDFHKAHPYVISGSVDQTVKVWE 409          

HSP 2 Score: 66.6254 bits (161), Expect = 1.692e-11
Identity = 42/112 (37.50%), Postives = 59/112 (52.68%), Query Frame = 3
Query:  540 YQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIR 875
            +Q P++AS S D T+R+WD   G C+    GH+N VR L         K   L+S S D TIR+WD+  ++C   L A    H         +  +V+SGS D TV+VW+ R
Sbjct:  307 HQGPFLASGSRDKTIRIWDVSVGLCLLTLSGHDNWVRGLA---FHPGGK--YLVSASDDKTIRVWDLRNKRCMKTLYAHQ--HFCTSIDFHKAHPYVISGSVDQTVKVWECR 411          

HSP 3 Score: 56.225 bits (134), Expect = 3.887e-8
Identity = 36/126 (28.57%), Postives = 60/126 (47.62%), Query Frame = 3
Query:  891 FVLNGHTDRVYTI--HLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTG-ECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDG 1259
            F L GH   +  +  H    +M+SAS D TIR+WD  TG     L GH      +  ++   L+ S +AD +I++W      ECI  + G   + S +  +      +++S+    T+K+W +  G
Sbjct:  102 FSLTGHRASITRVIFHPIFALMVSASEDATIRIWDFETGEYERSLKGHTDSVQDVAFDAQGKLLASCSADLSIKLWDFQQSYECIKTMHGHDHNVSSVAFVPA--GDYVLSASRDRTIKMWEVATG 225          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Zebrafish
Match: fbxw7 (F-box and WD repeat domain containing 7 [Source:ZFIN;Acc:ZDB-GENE-090313-79])

HSP 1 Score: 321.242 bits (822), Expect = 1.351e-103
Identity = 178/445 (40.00%), Postives = 260/445 (58.43%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQITFLKTKEF--HDLLKYG---STLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSV 1409
            +++I  LP EL  H+  F+  KDLL  +Q  + W  L+ D+L+W  KC++    +        ++K G   S  K  YI   ++ TNW+    K    +  H   +IT L      I S SDD T+ V   VTG+ +R L GH GGVWS    +  +   I S S D T+++W+   G C+H   GH + VRC+   +        +++SGSRD+T+R+WD+ T +C H+L     GH  A+RCVQ     VVSG+YD  V+VWD  T  C   L GHT+RVY++      ++S SLDT+IRVWD+ TG CIH L GH+SLTSGM +   ++++VSGNADST+++W + TG+C+  L G   H S +T +Q   + F+++S   GTVKLW+L  G F+R+++ L+    G ++WR   SNT LVCAVG+ N  + +KL + DF V
Sbjct:  115 RDFISLLPRELALHVLSFLEPKDLLQAAQTCRYWRILAEDNLLWKEKCKEEGIDEPLHIKRRKVIKPGFTHSPWKSAYIRQHRIDTNWRRGDLKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS----SQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEK-------RVVSGSRDATLRVWDIETGQCLHVL----MGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTVKIWDIKTGQCLQTLQGPHKHQSAVTCLQFNKN-FVITSSDDGTVKLWDLRTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDV 541          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Zebrafish
Match: fbxw7 (F-box and WD repeat domain containing 7 [Source:ZFIN;Acc:ZDB-GENE-090313-79])

HSP 1 Score: 323.168 bits (827), Expect = 6.912e-102
Identity = 178/445 (40.00%), Postives = 260/445 (58.43%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQITFLKTKEF--HDLLKYG---STLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSV 1409
            +++I  LP EL  H+  F+  KDLL  +Q  + W  L+ D+L+W  KC++    +        ++K G   S  K  YI   ++ TNW+    K    +  H   +IT L      I S SDD T+ V   VTG+ +R L GH GGVWS    +  +   I S S D T+++W+   G C+H   GH + VRC+   +        +++SGSRD+T+R+WD+ T +C H+L     GH  A+RCVQ     VVSG+YD  V+VWD  T  C   L GHT+RVY++      ++S SLDT+IRVWD+ TG CIH L GH+SLTSGM +   ++++VSGNADST+++W + TG+C+  L G   H S +T +Q   + F+++S   GTVKLW+L  G F+R+++ L+    G ++WR   SNT LVCAVG+ N  + +KL + DF V
Sbjct:  331 RDFISLLPRELALHVLSFLEPKDLLQAAQTCRYWRILAEDNLLWKEKCKEEGIDEPLHIKRRKVIKPGFTHSPWKSAYIRQHRIDTNWRRGDLKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS----SQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEK-------RVVSGSRDATLRVWDIETGQCLHVL----MGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTVKIWDIKTGQCLQTLQGPHKHQSAVTCLQFNKN-FVITSSDDGTVKLWDLRTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDV 757          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Zebrafish
Match: AL954386.1 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:564991])

HSP 1 Score: 306.99 bits (785), Expect = 1.443e-97
Identity = 173/431 (40.14%), Postives = 250/431 (58.00%), Query Frame = 3
Query:  132 IFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQITFLKTKEF--HDLLKYG---STLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSV 1409
             F F   KDLL  +Q  + W  L+ D+L+W  KC++    +        ++K G   S  K  YI   ++ TNW+    K    +  H   +IT L      I S SDD T+ V   VTG+ +R L GH GGVWS    +  +   I S S D T+++W+   G C+H   GH + VRC+   +        +++SGSRD+T+R+WD+ T +C H+L     GH  A+RCVQ     VVSG+YD  V+VWD  T  C   L GHT+RVY++      ++S SLDT+IRVWD+ TG CIH L GH+SLTSGM +   ++++VSGNADST+++W + TG+C+  L G   H S +T +Q   + F+++S   GTVKLW+L  G F+R+++ L+    G ++WR   SNT LVCAVG+ N  + +KL + DF V
Sbjct:  169 FFFFFTPKDLLQAAQTCRYWRILAEDNLLWKEKCKEEGIDEPLHIKRRKVIKPGFTHSPWKSAYIRQHRIDTNWRRGDLKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS----SQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEK-------RVVSGSRDATLRVWDIETGQCLHVL----MGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTVKIWDIKTGQCLQTLQGPHKHQSAVTCLQFNKN-FVITSSDDGTVKLWDLRTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDV 581          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Zebrafish
Match: CR381538.1 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:564991])

HSP 1 Score: 305.449 bits (781), Expect = 2.433e-97
Identity = 176/446 (39.46%), Postives = 257/446 (57.62%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINI-KDLLSCSQVSKSWHSLSNDDLVWTSKCRQITFLKTKEF--HDLLKYG---STLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSV 1409
            +++I      L   IF F+   KDLL  +Q  + W  L+ D+L+W  KC++    +        ++K G   S  K  YI   ++ TNW+    K    +  H   +IT L      I S SDD T+ V   VTG+ +R L GH GGVWS    +  +   I S S D T+++W+   G C+H   GH + VRC+   +        +++SGSRD+T+R+WD+ T +C H+L     GH  A+RCVQ     VVSG+YD  V+VWD  T  C   L GHT+RVY++      ++S SLDT+IRVWD+ TG CIH L GH+SLTSGM +   ++++VSGNADST+++W + TG+C+  L G   H S +T +Q   + F+++S   GTVKLW+L  G F+R+++ L+    G ++WR   SNT LVCAVG+ N  + +KL + DF V
Sbjct:  126 RDFISLALKSLALRIFFFLLFPKDLLQAAQTCRYWRILAEDNLLWKEKCKEEGIDEPLHIKRRKVIKPGFTHSPWKSAYIRQHRIDTNWRRGDLKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS----SQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEK-------RVVSGSRDATLRVWDIETGQCLHVL----MGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTVKIWDIKTGQCLQTLQGPHKHQSAVTCLQFNKN-FVITSSDDGTVKLWDLRTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDV 553          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Zebrafish
Match: AL954386.1 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:564991])

HSP 1 Score: 306.22 bits (783), Expect = 2.749e-97
Identity = 173/431 (40.14%), Postives = 250/431 (58.00%), Query Frame = 3
Query:  132 IFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQITFLKTKEF--HDLLKYG---STLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSV 1409
             F F   KDLL  +Q  + W  L+ D+L+W  KC++    +        ++K G   S  K  YI   ++ TNW+    K    +  H   +IT L      I S SDD T+ V   VTG+ +R L GH GGVWS    +  +   I S S D T+++W+   G C+H   GH + VRC+   +        +++SGSRD+T+R+WD+ T +C H+L     GH  A+RCVQ     VVSG+YD  V+VWD  T  C   L GHT+RVY++      ++S SLDT+IRVWD+ TG CIH L GH+SLTSGM +   ++++VSGNADST+++W + TG+C+  L G   H S +T +Q   + F+++S   GTVKLW+L  G F+R+++ L+    G ++WR   SNT LVCAVG+ N  + +KL + DF V
Sbjct:  174 FFFFFTPKDLLQAAQTCRYWRILAEDNLLWKEKCKEEGIDEPLHIKRRKVIKPGFTHSPWKSAYIRQHRIDTNWRRGDLKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS----SQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEK-------RVVSGSRDATLRVWDIETGQCLHVL----MGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTVKIWDIKTGQCLQTLQGPHKHQSAVTCLQFNKN-FVITSSDDGTVKLWDLRTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDV 586          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Xenopus
Match: ENSXETT00000008111.1 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:100145670])

HSP 1 Score: 321.627 bits (823), Expect = 6.312e-104
Identity = 177/445 (39.78%), Postives = 260/445 (58.43%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQ-----ITFLKTKEFHDLLKYGSTLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSV 1409
            +++I  LP EL  ++  F++ KDLL  +Q  + W  L+ D+L+W  KC++        LK ++        S  K  YI   ++ TNW+    K    +  H   +IT L      I S SDD T+ V   VTG+ +R L GH GGVWS    +  +   I S S D T+++W+   G C+H   GH + VRC+   +        +++SGSRD+T+R+WD+ T +C H+L     GH  A+RCVQ     VVSG+YD  V+VWD  T  C   L GHT+RVY++      ++S SLDT+IRVWD+ TG CIH L GH+SLTSGM +   ++++VSGNADST+++W + TG+C+  L G   H S +T +Q   + F+++S   GTVKLW+L  G F+R+++ L+    G ++WR   SNT LVCAVG+ N  + +KL + DF V
Sbjct:   85 RDFISLLPKELALYVLSFLDPKDLLQAAQTCRYWRILAEDNLLWREKCKEDGIDEPLHLKKRKISKPGFTHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS----SQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEK-------RVVSGSRDATLRVWDIETGQCLHVL----MGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKN-FVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDV 511          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Xenopus
Match: ENSXETT00000008122.1 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:100145670])

HSP 1 Score: 322.398 bits (825), Expect = 9.890e-104
Identity = 177/445 (39.78%), Postives = 260/445 (58.43%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQ-----ITFLKTKEFHDLLKYGSTLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSV 1409
            +++I  LP EL  ++  F++ KDLL  +Q  + W  L+ D+L+W  KC++        LK ++        S  K  YI   ++ TNW+    K    +  H   +IT L      I S SDD T+ V   VTG+ +R L GH GGVWS    +  +   I S S D T+++W+   G C+H   GH + VRC+   +        +++SGSRD+T+R+WD+ T +C H+L     GH  A+RCVQ     VVSG+YD  V+VWD  T  C   L GHT+RVY++      ++S SLDT+IRVWD+ TG CIH L GH+SLTSGM +   ++++VSGNADST+++W + TG+C+  L G   H S +T +Q   + F+++S   GTVKLW+L  G F+R+++ L+    G ++WR   SNT LVCAVG+ N  + +KL + DF V
Sbjct:  123 RDFISLLPKELALYVLSFLDPKDLLQAAQTCRYWRILAEDNLLWREKCKEDGIDEPLHLKKRKISKPGFTHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS----SQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEK-------RVVSGSRDATLRVWDIETGQCLHVL----MGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKN-FVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDV 549          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Xenopus
Match: ENSXETT00000008142.1 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:100145670])

HSP 1 Score: 322.398 bits (825), Expect = 5.475e-103
Identity = 177/445 (39.78%), Postives = 260/445 (58.43%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQ-----ITFLKTKEFHDLLKYGSTLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSV 1409
            +++I  LP EL  ++  F++ KDLL  +Q  + W  L+ D+L+W  KC++        LK ++        S  K  YI   ++ TNW+    K    +  H   +IT L      I S SDD T+ V   VTG+ +R L GH GGVWS    +  +   I S S D T+++W+   G C+H   GH + VRC+   +        +++SGSRD+T+R+WD+ T +C H+L     GH  A+RCVQ     VVSG+YD  V+VWD  T  C   L GHT+RVY++      ++S SLDT+IRVWD+ TG CIH L GH+SLTSGM +   ++++VSGNADST+++W + TG+C+  L G   H S +T +Q   + F+++S   GTVKLW+L  G F+R+++ L+    G ++WR   SNT LVCAVG+ N  + +KL + DF V
Sbjct:  185 RDFISLLPKELALYVLSFLDPKDLLQAAQTCRYWRILAEDNLLWREKCKEDGIDEPLHLKKRKISKPGFTHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS----SQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEK-------RVVSGSRDATLRVWDIETGQCLHVL----MGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKN-FVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDV 611          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Xenopus
Match: ENSXETT00000008237.1 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:100145670])

HSP 1 Score: 323.939 bits (829), Expect = 1.214e-102
Identity = 177/445 (39.78%), Postives = 260/445 (58.43%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQ-----ITFLKTKEFHDLLKYGSTLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSV 1409
            +++I  LP EL  ++  F++ KDLL  +Q  + W  L+ D+L+W  KC++        LK ++        S  K  YI   ++ TNW+    K    +  H   +IT L      I S SDD T+ V   VTG+ +R L GH GGVWS    +  +   I S S D T+++W+   G C+H   GH + VRC+   +        +++SGSRD+T+R+WD+ T +C H+L     GH  A+RCVQ     VVSG+YD  V+VWD  T  C   L GHT+RVY++      ++S SLDT+IRVWD+ TG CIH L GH+SLTSGM +   ++++VSGNADST+++W + TG+C+  L G   H S +T +Q   + F+++S   GTVKLW+L  G F+R+++ L+    G ++WR   SNT LVCAVG+ N  + +KL + DF V
Sbjct:  274 RDFISLLPKELALYVLSFLDPKDLLQAAQTCRYWRILAEDNLLWREKCKEDGIDEPLHLKKRKISKPGFTHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS----SQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEK-------RVVSGSRDATLRVWDIETGQCLHVL----MGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKN-FVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDV 700          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Xenopus
Match: ENSXETT00000008205.1 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:100145670])

HSP 1 Score: 323.553 bits (828), Expect = 9.924e-102
Identity = 177/445 (39.78%), Postives = 260/445 (58.43%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQ-----ITFLKTKEFHDLLKYGSTLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSV 1409
            +++I  LP EL  ++  F++ KDLL  +Q  + W  L+ D+L+W  KC++        LK ++        S  K  YI   ++ TNW+    K    +  H   +IT L      I S SDD T+ V   VTG+ +R L GH GGVWS    +  +   I S S D T+++W+   G C+H   GH + VRC+   +        +++SGSRD+T+R+WD+ T +C H+L     GH  A+RCVQ     VVSG+YD  V+VWD  T  C   L GHT+RVY++      ++S SLDT+IRVWD+ TG CIH L GH+SLTSGM +   ++++VSGNADST+++W + TG+C+  L G   H S +T +Q   + F+++S   GTVKLW+L  G F+R+++ L+    G ++WR   SNT LVCAVG+ N  + +KL + DF V
Sbjct:  344 RDFISLLPKELALYVLSFLDPKDLLQAAQTCRYWRILAEDNLLWREKCKEDGIDEPLHLKKRKISKPGFTHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS----SQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEK-------RVVSGSRDATLRVWDIETGQCLHVL----MGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKN-FVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDV 770          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Mouse
Match: Fbxw7 (F-box and WD-40 domain protein 7 [Source:MGI Symbol;Acc:MGI:1354695])

HSP 1 Score: 321.242 bits (822), Expect = 5.625e-103
Identity = 177/445 (39.78%), Postives = 260/445 (58.43%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQITFLKTKEF--HDLLKYG---STLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSV 1409
            +++I  LP EL  ++  F+  KDLL  +Q  + W  L+ D+L+W  KC++    +        ++K G   S  K  YI   ++ TNW+    K    +  H   +IT L      I S SDD T+ V   VTG+ +R L GH GGVWS    +  +   I S S D T+++W+   G C+H   GH + VRC+   +        +++SGSRD+T+R+WD+ T +C H+L     GH  A+RCVQ     VVSG+YD  V+VWD  T  C   L GHT+RVY++      ++S SLDT+IRVWD+ TG CIH L GH+SLTSGM +   ++++VSGNADST+++W + TG+C+  L G   H S +T +Q   + F+++S   GTVKLW+L  G F+R+++ L+    G ++WR   SNT LVCAVG+ N  + +KL + DF V
Sbjct:  160 RDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKIIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS----SQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEK-------RVVSGSRDATLRVWDIETGQCLHVL----MGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTVKIWDIKTGQCLQTLQGPSKHQSAVTCLQFNKN-FVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDV 586          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Mouse
Match: Fbxw7 (F-box and WD-40 domain protein 7 [Source:MGI Symbol;Acc:MGI:1354695])

HSP 1 Score: 320.087 bits (819), Expect = 4.632e-102
Identity = 177/445 (39.78%), Postives = 260/445 (58.43%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQITFLKTKEF--HDLLKYG---STLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSV 1409
            +++I  LP EL  ++  F+  KDLL  +Q  + W  L+ D+L+W  KC++    +        ++K G   S  K  YI   ++ TNW+    K    +  H   +IT L      I S SDD T+ V   VTG+ +R L GH GGVWS    +  +   I S S D T+++W+   G C+H   GH + VRC+   +        +++SGSRD+T+R+WD+ T +C H+L     GH  A+RCVQ     VVSG+YD  V+VWD  T  C   L GHT+RVY++      ++S SLDT+IRVWD+ TG CIH L GH+SLTSGM +   ++++VSGNADST+++W + TG+C+  L G   H S +T +Q   + F+++S   GTVKLW+L  G F+R+++ L+    G ++WR   SNT LVCAVG+ N  + +KL + DF V
Sbjct:  200 RDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKIIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS----SQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEK-------RVVSGSRDATLRVWDIETGQCLHVL----MGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTVKIWDIKTGQCLQTLQGPSKHQSAVTCLQFNKN-FVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDV 626          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Mouse
Match: Fbxw7 (F-box and WD-40 domain protein 7 [Source:MGI Symbol;Acc:MGI:1354695])

HSP 1 Score: 322.013 bits (824), Expect = 6.096e-102
Identity = 177/445 (39.78%), Postives = 260/445 (58.43%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQITFLKTKEF--HDLLKYG---STLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSV 1409
            +++I  LP EL  ++  F+  KDLL  +Q  + W  L+ D+L+W  KC++    +        ++K G   S  K  YI   ++ TNW+    K    +  H   +IT L      I S SDD T+ V   VTG+ +R L GH GGVWS    +  +   I S S D T+++W+   G C+H   GH + VRC+   +        +++SGSRD+T+R+WD+ T +C H+L     GH  A+RCVQ     VVSG+YD  V+VWD  T  C   L GHT+RVY++      ++S SLDT+IRVWD+ TG CIH L GH+SLTSGM +   ++++VSGNADST+++W + TG+C+  L G   H S +T +Q   + F+++S   GTVKLW+L  G F+R+++ L+    G ++WR   SNT LVCAVG+ N  + +KL + DF V
Sbjct:  281 RDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKIIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS----SQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEK-------RVVSGSRDATLRVWDIETGQCLHVL----MGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTVKIWDIKTGQCLQTLQGPSKHQSAVTCLQFNKN-FVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDV 707          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Mouse
Match: Fbxw7 (F-box and WD-40 domain protein 7 [Source:MGI Symbol;Acc:MGI:1354695])

HSP 1 Score: 322.013 bits (824), Expect = 6.096e-102
Identity = 177/445 (39.78%), Postives = 260/445 (58.43%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQITFLKTKEF--HDLLKYG---STLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSV 1409
            +++I  LP EL  ++  F+  KDLL  +Q  + W  L+ D+L+W  KC++    +        ++K G   S  K  YI   ++ TNW+    K    +  H   +IT L      I S SDD T+ V   VTG+ +R L GH GGVWS    +  +   I S S D T+++W+   G C+H   GH + VRC+   +        +++SGSRD+T+R+WD+ T +C H+L     GH  A+RCVQ     VVSG+YD  V+VWD  T  C   L GHT+RVY++      ++S SLDT+IRVWD+ TG CIH L GH+SLTSGM +   ++++VSGNADST+++W + TG+C+  L G   H S +T +Q   + F+++S   GTVKLW+L  G F+R+++ L+    G ++WR   SNT LVCAVG+ N  + +KL + DF V
Sbjct:  281 RDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKIIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS----SQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEK-------RVVSGSRDATLRVWDIETGQCLHVL----MGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTVKIWDIKTGQCLQTLQGPSKHQSAVTCLQFNKN-FVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDV 707          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Mouse
Match: Btrc (beta-transducin repeat containing protein [Source:MGI Symbol;Acc:MGI:1338871])

HSP 1 Score: 126.331 bits (316), Expect = 7.934e-31
Identity = 117/431 (27.15%), Postives = 186/431 (43.16%), Query Frame = 3
Query:   72 MKDKPGKNYIDHLPTELFFHI----FKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQIT------------------FLKTKEFHDLLKYGSTLKQQYIYYLK----LFTNWQC-NHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFV--LNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVW--------RVSTGECILELLGQQAHTSPLTGIQIVLDKF-IVSSELSGTVKLWNL 1250
            +K    +++I  LP     HI      +++ K L +   V K W+ +++D ++W     ++                     K K   +     S  +  Y   ++    + +NW+C  H  + I     +   +  L   DQ I S   D TI + D  T E  R L GH G V  L     Y +  I + S+D TVR+WD   G  ++    H     C   + +  +N    +++ S+D +I +WD+ +   D  L     GH  A+  V     ++VS S D T++VW+  T  C FV  LNGH   +  +     +++S S D TIR+WDI  G C+ VL GH+ L     +  D   +VSG  D  I+VW        R   G   L  L +  H+  +  +Q   D+F IVSS    T+ +W+ 
Sbjct:   73 LKPMLQRDFITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGWGQYLFKNKPPDENAPPNSFYRALYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKSTLECKRILTGHTGSVLCLQ----YDERVIITGSSDSTVRVWDVNAGEMLNTLIHH-----CEAVLHLRFNNG--MMVTCSKDRSIAVWDMAS-PTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWN--TSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVR--CIRFDNKRIVSGAYDGKIKVWDLMAALDPRAPAGTLCLRTLVE--HSGRVFRLQ--FDEFQIVSSSHDDTILIWDF 483          

HSP 2 Score: 76.2554 bits (186), Expect = 2.882e-14
Identity = 46/161 (28.57%), Postives = 83/161 (51.55%), Query Frame = 3
Query:  789 TGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLR 1271
            +  + C+Q     +VSG  D T+++WD  T  C  +L GHT  V  +     V+++ S D+T+RVWD++ G  ++ L+ H      +  N+   ++V+ + D +I VW +++   I        H + +  +    DK+IVS+    T+K+WN     F+R
Sbjct:  204 SKGVYCLQYDDQKIVSGLRDNTIKIWDKSTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNAGEMLNTLIHHCEAVLHLRFNN--GMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFD-DKYIVSASGDRTIKVWNTSTCEFVR 361          
BLAST of F-box and WD repeat domain containing 7 vs. UniProt/SwissProt
Match: sp|F1MNN4|FBXW7_BOVIN (F-box/WD repeat-containing protein 7 OS=Bos taurus OX=9913 GN=FBXW7 PE=1 SV=2)

HSP 1 Score: 320.472 bits (820), Expect = 2.006e-101
Identity = 177/445 (39.78%), Postives = 260/445 (58.43%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQITFLKTKEF--HDLLKYG---STLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSV 1409
            +++I  LP EL  ++  F+  KDLL  +Q  + W  L+ D+L+W  KC++    +        ++K G   S  K  YI   ++ TNW+    K    +  H   +IT L      I S SDD T+ V   VTG+ +R L GH GGVWS    +  +   I S S D T+++W+   G C+H   GH + VRC+   +        +++SGSRD+T+R+WD+ T +C H+L     GH  A+RCVQ     VVSG+YD  V+VWD  T  C   L GHT+RVY++      ++S SLDT+IRVWD+ TG CIH L GH+SLTSGM +   ++++VSGNADST+++W + TG+C+  L G   H S +T +Q   + F+++S   GTVKLW+L  G F+R+++ L+    G ++WR   SNT LVCAVG+ N  + +KL + DF V
Sbjct:  198 RDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS----SQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEK-------RVVSGSRDATLRVWDIETGQCLHVL----MGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKN-FVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDV 624          
BLAST of F-box and WD repeat domain containing 7 vs. UniProt/SwissProt
Match: sp|Q969H0|FBXW7_HUMAN (F-box/WD repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=FBXW7 PE=1 SV=1)

HSP 1 Score: 322.013 bits (824), Expect = 3.530e-101
Identity = 177/445 (39.78%), Postives = 260/445 (58.43%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQITFLKTKEF--HDLLKYG---STLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSV 1409
            +++I  LP EL  ++  F+  KDLL  +Q  + W  L+ D+L+W  KC++    +        ++K G   S  K  YI   ++ TNW+    K    +  H   +IT L      I S SDD T+ V   VTG+ +R L GH GGVWS    +  +   I S S D T+++W+   G C+H   GH + VRC+   +        +++SGSRD+T+R+WD+ T +C H+L     GH  A+RCVQ     VVSG+YD  V+VWD  T  C   L GHT+RVY++      ++S SLDT+IRVWD+ TG CIH L GH+SLTSGM +   ++++VSGNADST+++W + TG+C+  L G   H S +T +Q   + F+++S   GTVKLW+L  G F+R+++ L+    G ++WR   SNT LVCAVG+ N  + +KL + DF V
Sbjct:  278 RDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS----SQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEK-------RVVSGSRDATLRVWDIETGQCLHVL----MGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKN-FVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDV 704          
BLAST of F-box and WD repeat domain containing 7 vs. UniProt/SwissProt
Match: sp|Q8VBV4|FBXW7_MOUSE (F-box/WD repeat-containing protein 7 OS=Mus musculus OX=10090 GN=Fbxw7 PE=1 SV=2)

HSP 1 Score: 322.013 bits (824), Expect = 4.264e-101
Identity = 177/445 (39.78%), Postives = 260/445 (58.43%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQITFLKTKEF--HDLLKYG---STLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSV 1409
            +++I  LP EL  ++  F+  KDLL  +Q  + W  L+ D+L+W  KC++    +        ++K G   S  K  YI   ++ TNW+    K    +  H   +IT L      I S SDD T+ V   VTG+ +R L GH GGVWS    +  +   I S S D T+++W+   G C+H   GH + VRC+   +        +++SGSRD+T+R+WD+ T +C H+L     GH  A+RCVQ     VVSG+YD  V+VWD  T  C   L GHT+RVY++      ++S SLDT+IRVWD+ TG CIH L GH+SLTSGM +   ++++VSGNADST+++W + TG+C+  L G   H S +T +Q   + F+++S   GTVKLW+L  G F+R+++ L+    G ++WR   SNT LVCAVG+ N  + +KL + DF V
Sbjct:  281 RDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKIIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS----SQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEK-------RVVSGSRDATLRVWDIETGQCLHVL----MGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTVKIWDIKTGQCLQTLQGPSKHQSAVTCLQFNKN-FVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDV 707          
BLAST of F-box and WD repeat domain containing 7 vs. UniProt/SwissProt
Match: sp|D3Z902|FBXW7_RAT (F-box/WD repeat-containing protein 7 OS=Rattus norvegicus OX=10116 GN=Fbxw7 PE=1 SV=2)

HSP 1 Score: 321.242 bits (822), Expect = 7.795e-101
Identity = 176/445 (39.55%), Postives = 260/445 (58.43%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQITFLKTKEF--HDLLKYG---STLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSV 1409
            +++I  LP EL  ++  F+  KDLL  +Q  + W  L+ D+L+W  KC++    +        ++K G   S  K  YI   ++ TNW+    +    +  H   +IT L      I S SDD T+ V   VTG+ +R L GH GGVWS    +  +   I S S D T+++W+   G C+H   GH + VRC+   +        +++SGSRD+T+R+WD+ T +C H+L     GH  A+RCVQ     VVSG+YD  V+VWD  T  C   L GHT+RVY++      ++S SLDT+IRVWD+ TG CIH L GH+SLTSGM +   ++++VSGNADST+++W + TG+C+  L G   H S +T +Q   + F+++S   GTVKLW+L  G F+R+++ L+    G ++WR   SNT LVCAVG+ N  + +KL + DF V
Sbjct:  284 RDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKIIKPGFIHSPWKSAYIRQHRIDTNWRRGELRSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS----SQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEK-------RVVSGSRDATLRVWDIETGQCLHVL----MGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTVKIWDIKTGQCLQTLQGPSKHQSAVTCLQFNKN-FVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDV 710          
BLAST of F-box and WD repeat domain containing 7 vs. UniProt/SwissProt
Match: sp|Q9VZF4|FBXW7_DROME (F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster OX=7227 GN=ago PE=1 SV=1)

HSP 1 Score: 310.842 bits (795), Expect = 8.029e-93
Identity = 172/452 (38.05%), Postives = 257/452 (56.86%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQITFL------KTKEFHD--LLKYGSTLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSVKSPC 1421
            +++I  LP EL   +  ++  KDLL  +Q  +SW  L +D+L+W  KCR+   L      + K   D  +    S  K  Y+    +  NW+    ++   +  H   +IT L      I S SDD T+ V   V G+ +R L GH GGVWS    +      I S S D T+++WD   G CVH  +GH + VRC+    +  S    K++SGSRD+T+R+WD+    C H+L     GH  A+RCVQ     +VSG+YD  V++W      C   L GHT+RVY++      ++S SLDT+IRVWD+ TG C H L+GH+SLTSGM +   ++++VSGNADST++VW ++TG+C+  L G   H S +T +Q    +F+V+S   GTVKLW++  G F+R+++ L     G ++WR   ++T L+CAVG+ N  + +KL + DF V+  C
Sbjct:  889 RDFISLLPRELALFVLSYLEPKDLLRAAQTCRSWRFLCDDNLLWKEKCRKAQILAEPRSDRPKRGRDGNMPPIASPWKAAYMRQHIIEMNWRSRPVRKPKVLKGHDDHVITCLQFSGNRIVSGSDDNTLKVWSAVNGKCLRTLVGHTGGVWS----SQMSGNIIISGSTDRTLKVWDMDSGACVHTLQGHTSTVRCM---HLHGS----KVVSGSRDATLRVWDIEQGSCLHVL----VGHLAAVRCVQYDGKLIVSGAYDYMVKIWHPERQECLHTLQGHTNRVYSLQFDGLHVVSGSLDTSIRVWDVETGNCKHTLMGHQSLTSGMELR--QNILVSGNADSTVKVWDITTGQCLQTLSGPNKHHSAVTCLQFN-SRFVVTSSDDGTVKLWDVKTGDFIRNLVALDSGGSGGVVWRIRANDTKLICAVGSRNGTEETKLMVLDFDVEGAC 1322          
BLAST of F-box and WD repeat domain containing 7 vs. TrEMBL
Match: A0A3Q3FW27 (Uncharacterized protein OS=Labrus bergylta OX=56723 PE=4 SV=1)

HSP 1 Score: 331.257 bits (848), Expect = 6.025e-104
Identity = 184/446 (41.26%), Postives = 264/446 (59.19%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQ--ITFLKTKEFHDLLKYG---STLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVW-SLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSV 1409
            +++I  LP EL  ++  F+  +DLL  +Q  + W  L+ D+L+W  KCR+  ++   +      ++ G   S  K  YI   ++ +NW+   E+E + +  H   +IT L      I S SDD T+ V   +TG+ +R L GH GGVW S +A+A      + S S D T+R+WD   G CVH   GH + VRC+      + N+   ++SGSRD+T+R+WDV T +C+H+L    TGH  A+RCVQ     VVSG YD  V+VWD  T  C   L GHT+RVY++      ++S SLDT+IRVWD  TG CIH L GH+SLTSGM +   ++++VSGNADST+RVW V TG+CI  L G   H S +T +Q      ++SS   GTVKLW+L  G +LRD++ L+    G ++WR   S+T LVCA G+ N  + +KL + DF +
Sbjct:  122 RDFISLLPKELALYVLTFLAPRDLLQAAQTCRYWRILAEDNLLWREKCREEGVSDCASSRRRKCVRPGVAVSPWKSAYIRQHRIESNWRKGDEREPMVLKGHDDHVITCLQFSGDLIVSGSDDNTLKVWSAITGKCLRTLTGHSGGVWCSQMAVAT-----VISGSTDRTLRVWDAESGECVHTLYGHTSTVRCMHL----HGNR---VVSGSRDTTLRVWDVSTGRCEHVL----TGHVAAVRCVQYDGRRVVSGGYDYMVKVWDPETEACLHTLQGHTNRVYSLQFDGAFVVSGSLDTSIRVWDAETGGCIHTLTGHQSLTSGMELR--DNILVSGNADSTVRVWDVRTGQCIHTLQGPNKHQSAVTCLQFCRG-LVLSSSDDGTVKLWDLKTGAWLRDVVALQSRGSGGVVWRIRASDTRLVCAAGSRNGTEETKLLVLDFDL 548          
BLAST of F-box and WD repeat domain containing 7 vs. TrEMBL
Match: A0A1A8JFH2 (F-box and WD repeat domain containing 7, E3 ubiquitin protein ligase OS=Nothobranchius kuhntae OX=321403 GN=FBXW7 PE=4 SV=1)

HSP 1 Score: 327.405 bits (838), Expect = 6.502e-104
Identity = 180/444 (40.54%), Postives = 263/444 (59.23%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQITFLKTKEFHDLLKYGSTL---KQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVW-SLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSV 1409
            +++I  LP EL  ++  F+  +DLL  +Q  + W  L+ D+L+W  KCR+    +     D  + G+ +   K  YI   ++ TNW+   ++E   +  H   +IT L      I S SDD T+ V   +TG+ +R L GH GGVW S +A+A      + S S D T+R+WD   G+CVH   GH + VRC+      + N+   ++SGSRD+T+R+WDV T +C+H+L    TGH  A+RCVQ     VVSG YD  V+VWD  T +C   L GHT+RVY++      ++S SLDT+IRVWD  TG C+H L GH+SLTSGM +   + ++VSGNADST+RVW + +G+C+  L G   H S +T +Q      ++SS   GTVKLW+L  G +LRD++ L+    G ++WR   S+T LVCA G+ N  + +KL + DF +
Sbjct:   10 RDFISLLPKELALYVLTFLAPRDLLQAAQTCRYWRILAEDNLLWREKCREEGISERVRRRDCEQPGADISPWKSAYIRQHRIETNWRRGDDREPSVLKGHDDHVITCLQFSGDLIVSGSDDNTLKVWSAITGKCLRTLMGHTGGVWCSQMAVAT-----VISGSTDRTLRVWDAESGKCVHTLYGHTSTVRCMHL----HGNR---VVSGSRDTTLRVWDVSTGRCEHVL----TGHVAAVRCVQYDGRRVVSGGYDYMVKVWDPETEVCLHTLQGHTNRVYSLQFDGVFVVSGSLDTSIRVWDAETGGCVHTLTGHQSLTSGMELR--DHILVSGNADSTVRVWDIRSGQCLHTLQGPNKHQSAVTCLQFCR-GLVLSSSDDGTVKLWDLRTGAWLRDVVVLQSRGSGGVVWRIRASDTRLVCAAGSRNGTEETKLLVLDFDL 434          
BLAST of F-box and WD repeat domain containing 7 vs. TrEMBL
Match: A0A1A8I2V0 (F-box and WD repeat domain containing 7, E3 ubiquitin protein ligase (Fragment) OS=Nothobranchius kuhntae OX=321403 GN=FBXW7 PE=4 SV=1)

HSP 1 Score: 327.405 bits (838), Expect = 6.916e-104
Identity = 180/444 (40.54%), Postives = 263/444 (59.23%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQITFLKTKEFHDLLKYGSTL---KQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVW-SLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSV 1409
            +++I  LP EL  ++  F+  +DLL  +Q  + W  L+ D+L+W  KCR+    +     D  + G+ +   K  YI   ++ TNW+   ++E   +  H   +IT L      I S SDD T+ V   +TG+ +R L GH GGVW S +A+A      + S S D T+R+WD   G+CVH   GH + VRC+      + N+   ++SGSRD+T+R+WDV T +C+H+L    TGH  A+RCVQ     VVSG YD  V+VWD  T +C   L GHT+RVY++      ++S SLDT+IRVWD  TG C+H L GH+SLTSGM +   + ++VSGNADST+RVW + +G+C+  L G   H S +T +Q      ++SS   GTVKLW+L  G +LRD++ L+    G ++WR   S+T LVCA G+ N  + +KL + DF +
Sbjct:   12 RDFISLLPKELALYVLTFLAPRDLLQAAQTCRYWRILAEDNLLWREKCREEGISERVRRRDCEQPGADISPWKSAYIRQHRIETNWRRGDDREPSVLKGHDDHVITCLQFSGDLIVSGSDDNTLKVWSAITGKCLRTLMGHTGGVWCSQMAVAT-----VISGSTDRTLRVWDAESGKCVHTLYGHTSTVRCMHL----HGNR---VVSGSRDTTLRVWDVSTGRCEHVL----TGHVAAVRCVQYDGRRVVSGGYDYMVKVWDPETEVCLHTLQGHTNRVYSLQFDGVFVVSGSLDTSIRVWDAETGGCVHTLTGHQSLTSGMELR--DHILVSGNADSTVRVWDIRSGQCLHTLQGPNKHQSAVTCLQFCR-GLVLSSSDDGTVKLWDLRTGAWLRDVVVLQSRGSGGVVWRIRASDTRLVCAAGSRNGTEETKLLVLDFDL 436          
BLAST of F-box and WD repeat domain containing 7 vs. TrEMBL
Match: A0A1A8FKX9 (F-box and WD repeat domain containing 7, E3 ubiquitin protein ligase OS=Nothobranchius korthausae OX=1143690 GN=FBXW7 PE=4 SV=1)

HSP 1 Score: 330.487 bits (846), Expect = 1.053e-103
Identity = 181/444 (40.77%), Postives = 263/444 (59.23%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQITFLKTKEFHDLLKYG---STLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVW-SLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSV 1409
            +++I  LP EL  ++  F+  +DLL  +Q  + W  L+ D+L+W  KCR+    +     D  + G   S  K  YI   ++ TNW+   ++E   +  H   +IT L   +  I S SDD T+ V   +TG+ +R L GH GGVW S +A+A      + S S D T+R+WD   G+CVH   GH + VRC+      + N+   ++SGSRD+T+R+WDV T +C+H+L    TGH  A+RCVQ     VVSG YD  V+VWD  T +C   L GHT+RVY++      ++S SLDT+IRVWD  TG C+H L GH+SLTSGM +   + ++VSGNADST+RVW + +G+C+  L G   H S +T +Q      ++SS   GTVKLW+L  G +LRD++ L+    G ++WR   S+T LVCA G+ N  + +KL + DF +
Sbjct:  122 RDFISLLPKELALYVLTFLAPRDLLQAAQTCRYWRILAEDNLLWREKCREEGISERVRRRDCEQPGADFSPWKSAYIRQHRIETNWRRGDDREPSVLKGHDDHVITCLQFSEDLIVSGSDDNTLKVWSAITGKCLRTLMGHTGGVWCSQMAVAT-----VISGSTDRTLRVWDAESGKCVHTLYGHTSTVRCMHL----HGNR---VVSGSRDTTLRVWDVSTGRCEHVL----TGHVAAVRCVQYDGRRVVSGGYDYMVKVWDPETEVCLHTLQGHTNRVYSLQFDGVFVVSGSLDTSIRVWDAETGGCVHTLTGHQSLTSGMELR--DHMLVSGNADSTVRVWDIRSGQCLHTLQGPNKHQSAVTCLQFCR-GLVLSSSDDGTVKLWDLRTGAWLRDVVALQSRGSGGVVWRIRASDTRLVCAAGSRNGTEETKLLVLDFDL 546          
BLAST of F-box and WD repeat domain containing 7 vs. TrEMBL
Match: A0A3P8PN02 (Uncharacterized protein OS=Astatotilapia calliptera OX=8154 PE=4 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 4.952e-103
Identity = 179/442 (40.50%), Postives = 259/442 (58.60%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQ--ITFLKTKEFHDLLKYGSTLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSV 1409
            +++I  LP EL  ++  F+  +DLL  +Q  ++W +L+ D+L+W  KCR+  I+   +          S  K  YI   ++ TNW+    +E + +  H   +IT L      I S SDD T+ V   +TG+ +R L GH GGVW     A      + S S D T+R+WD   G CVH   GH + VRC+      N N+   ++SGSRD+T+R+WDV T +C+H+L    TGH  A+RCVQ     VVSG YD  V+VWD  T +C   L GHT+RVY++      ++S SLDT+I+VWD  TG C+H L GH+SLTSGM +   ++++VSGNADST+RVW + TG+C+  L G   H S +T +Q      ++SS   GTVKLW+L  G +LRD++ L+    G ++WR   S+T LVCA G+ N  + +KL + DF +
Sbjct:  122 RDFISLLPKELALYVLTFLAPRDLLQAAQTCRNWRTLAEDNLLWREKCREEGISECTSSRHRRSSAAVSEWKSTYIRQHRIETNWRKGDTREPMVLKGHDDHVITCLQFSGDLIVSGSDDNTLKVWSAITGKCLRTLTGHTGGVWCSQMAATT----VISGSTDRTLRVWDAESGECVHTLYGHTSTVRCMHL----NGNR---VVSGSRDTTLRVWDVSTGRCEHVL----TGHLAAVRCVQYDGRRVVSGGYDYMVKVWDPETEVCLHTLQGHTNRVYSLQFDGVFVVSGSLDTSIKVWDPETGGCVHTLTGHQSLTSGMELR--DNILVSGNADSTVRVWDIRTGQCLHTLQGPNKHQSAVTCLQFCRG-LVLSSSDDGTVKLWDLRTGAWLRDVVALQSRGSGGVVWRIRASDTRLVCAAGSRNGTEETKLLVLDFDL 545          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Cavefish
Match: fbxw7 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:103046885])

HSP 1 Score: 320.087 bits (819), Expect = 3.953e-103
Identity = 179/445 (40.22%), Postives = 261/445 (58.65%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQ--ITFLKTKEFHDLLKYG---STLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSV 1409
            +++I  LP EL  ++  F+  KDLL  +Q  + W  L+ D+L+W  KCR+  I      +   ++K G   S  K  YI   ++ TNW+    K    +  H   +IT L      I S SDD T+ V   VTG+ +R L GH GGVWS    +  +   I S S D T+++W+   G C+H   GH + VRC+   +        +++SGSRD+T+R+WD+ T +C H+L     GH  A+RCVQ     VVSG+YD  V+VWD  T  C   L GHT+RVY++      ++S SLDT+IRVWD+ TG CIH L GH+SLTSGM +   ++++VSGNADST+++W + TG+C+  L G   H S +T +Q   + F+++S   GTVKLW+L  G F+R+++ L+    G ++WR   SNT LVCAVG+ N  + +KL + DF V
Sbjct:  119 RDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCREEGIDEPLHGKRRKVVKPGFSHSPWKSAYIRQHRIDTNWRRGDLKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS----SQMRDNIIISGSTDRTLKVWNAETGDCIHTLYGHTSTVRCMHLHEK-------RVVSGSRDATLRVWDIETGQCLHVL----MGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTVKIWDIKTGQCLQTLQGPHKHQSAVTCLQFNKN-FVITSSDDGTVKLWDLRTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDV 545          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Cavefish
Match: fbxw7 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:103046885])

HSP 1 Score: 320.857 bits (821), Expect = 9.186e-101
Identity = 179/445 (40.22%), Postives = 261/445 (58.65%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQ--ITFLKTKEFHDLLKYG---STLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSV 1409
            +++I  LP EL  ++  F+  KDLL  +Q  + W  L+ D+L+W  KCR+  I      +   ++K G   S  K  YI   ++ TNW+    K    +  H   +IT L      I S SDD T+ V   VTG+ +R L GH GGVWS    +  +   I S S D T+++W+   G C+H   GH + VRC+   +        +++SGSRD+T+R+WD+ T +C H+L     GH  A+RCVQ     VVSG+YD  V+VWD  T  C   L GHT+RVY++      ++S SLDT+IRVWD+ TG CIH L GH+SLTSGM +   ++++VSGNADST+++W + TG+C+  L G   H S +T +Q   + F+++S   GTVKLW+L  G F+R+++ L+    G ++WR   SNT LVCAVG+ N  + +KL + DF V
Sbjct:  361 RDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCREEGIDEPLHGKRRKVVKPGFSHSPWKSAYIRQHRIDTNWRRGDLKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS----SQMRDNIIISGSTDRTLKVWNAETGDCIHTLYGHTSTVRCMHLHEK-------RVVSGSRDATLRVWDIETGQCLHVL----MGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTVKIWDIKTGQCLQTLQGPHKHQSAVTCLQFNKN-FVITSSDDGTVKLWDLRTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDV 787          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Cavefish
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:103033424])

HSP 1 Score: 116.701 bits (291), Expect = 1.297e-28
Identity = 89/291 (30.58%), Postives = 137/291 (47.08%), Query Frame = 3
Query:  417 QWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLI-SGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCV--QASSVWVVSGSYDCTVRVWDIRTGICAFVL---NGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMN---SDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSS---ELSGTVKLWNLD 1253
            +W+AS S D  I +     G+  + + GH+ G+ S VA +      + S+S D T+++WD   G+C+   +GH N V C       N N    LI SGS D ++RIWDV T KC   L A    H+  +  V        +VS SYD   R+WD  +G C   L   +               +L+A+LD T+++WD   G C+    GHK+    +  N   +    +VSG+ D+ + +W + T E + +L   Q HT  +        + I++S   E   T+KLW  D
Sbjct:   58 EWLASSSADKLIKIWGAYDGKFEKTISGHKLGI-SDVAWS-SDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCC------NFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPA----HSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKL---QGHTDVVISTACHPTENIIASAALENDKTIKLWKSD 333          

HSP 2 Score: 107.842 bits (268), Expect = 1.427e-25
Identity = 61/197 (30.96%), Postives = 106/197 (53.81%), Query Frame = 3
Query:  696 LISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCV--QASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLG--ATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLD-KFIVSSELSGTVKLWNLDDGVFLR 1271
            L S S D  I+IW  +    D   E + +GH   I  V   + S  +VS S D T+++WD+ +G C   L GH++ V+  +    + +++S S D ++R+WD+ TG C+  L  H    S +  N D SL+VS + D   R+W  ++G+C+  L+       P++ ++   + K+I+++ L  T+KLW+   G  L+
Sbjct:   60 LASSSADKLIKIWGAY----DGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDD--NPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLK 250          

HSP 3 Score: 94.7449 bits (234), Expect = 5.846e-21
Identity = 59/209 (28.23%), Postives = 105/209 (50.24%), Query Frame = 3
Query:  750 KCDHLLEASPTGHTGAIRCVQ--ASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGA--TVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLD-KFIVSSELSGTVKLWNLDDGVFLRDILQ--------LKHSFPGAMMWRAVVSNT 1337
            K ++ L+ +  GHT A+  V+   S  W+ S S D  +++W    G     ++GH   +  +   +   +++SAS D T+++WD+ +G C+  L GH +       N   +L+VSG+ D ++R+W V TG+C+  L    AH+ P++ +    D   IVSS   G  ++W+   G  L+ ++         +K S  G  +  A + NT
Sbjct:   32 KPNYTLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL---PAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNT 237          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Cavefish
Match: pafah1b1a (lissencephaly-1 homolog A-like [Source:NCBI gene;Acc:103030333])

HSP 1 Score: 116.701 bits (291), Expect = 4.350e-28
Identity = 90/300 (30.00%), Postives = 136/300 (45.33%), Query Frame = 3
Query:  423 IASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASS--VWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIH----------LGAT------------VMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQI-VLDKFIVSSELSGTVKLWN 1247
            + S S+D TI V D  TG+  R L+GH   V  +      +   +AS SAD T++LWDF    C+    GH++ V  +  +   +      +IS SRD T+++W+V T  C        TGH   +R V+ +     + S S D TVRVW + T  C   L  H   V  I           + AT             +LS S D TI++WD+  G+C+  LVGH +   GM+ +     ++S   D T+R+W      C   L    AH   +T +       ++V+  +  TVK+W 
Sbjct:  123 MVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDQTGK--LLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDH-----IISASRDKTMKMWEVATGYCTKTF----TGHREWVRMVRPNQDGSLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESAHQTIMDATGSETKKSGKPGPFLLSGSRDKTIKMWDVSIGMCLMTLVGHDNWVRGMMFHPGGKFIISCADDKTLRIWDYKNKRCKKTL---SAHEHFVTSLDFHKAAPYVVTGSVDQTVKVWE 408          

HSP 2 Score: 94.7449 bits (234), Expect = 1.223e-20
Identity = 60/214 (28.04%), Postives = 107/214 (50.00%), Query Frame = 3
Query:  696 LISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCV--QASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHL--GATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHT------SPLTGIQIVLD-------------KFIVSSELSGTVKLWNLDDGVFL 1268
            ++S S D+TI++WD  T   +  L+    GHT +++ +    +   + S S D T+++WD +   C   ++GH   V ++ +      ++SAS D T+++W++ TG C     GH+     +  N D SL+ S + D T+RVW V+T EC  EL  +  H       +P +  Q ++D              F++S     T+K+W++  G+ L
Sbjct:  123 MVSASEDATIKVWDYETGDFERTLK----GHTDSVQDISFDQTGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIISASRDKTMKMWEVATGYCTKTFTGHREWVRMVRPNQDGSLIASCSNDQTVRVWVVATKECKAELR-EHEHVVECISWAPESAHQTIMDATGSETKKSGKPGPFLLSGSRDKTIKMWDVSIGMCL 331          

HSP 3 Score: 60.077 bits (144), Expect = 2.111e-9
Identity = 40/126 (31.75%), Postives = 63/126 (50.00%), Query Frame = 3
Query:  891 FVLNGHTDRVYTI--HLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLD-KFIVSSELSGTVKLWNLDDG 1259
            + L+GH   V  +  H   +VM+SAS D TI+VWD  TG     L GH      +  +    L+ S +AD TI++W     ECI  + G   H   ++ + I+ +   I+S+    T+K+W +  G
Sbjct:  102 YSLSGHRSPVTKVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDQTGKLLASCSADMTIKLWDFQGFECIRTMHG---HDHNVSSVAIMPNGDHIISASRDKTMKMWEVATG 224          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Cavefish
Match: fbxw11b (F-box/WD repeat-containing protein 11-like [Source:NCBI gene;Acc:103029337])

HSP 1 Score: 118.242 bits (295), Expect = 4.611e-28
Identity = 115/431 (26.68%), Postives = 185/431 (42.92%), Query Frame = 3
Query:   72 MKDKPGKNYIDHLPTELFFHI----FKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQITFLKT-----KEFHD----LLKYGSTLKQQYIYYLKLF-----------TNWQC-NHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFV--LNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPL--------TG--IQIVLDKF-IVSSELSGTVKLWNL 1250
            +K    +++I  LP +   HI      F++ + L S   V K W  + ++ ++W     ++           E H     L K  +T      YY  L+            NW+C  H  + I+    +   +  L   D  I S   D +I + D  + E ++ L GH G V  L     Y +  I + S+D TVR+WD   G  ++    H   V   + ++  N      +++ S+D +I +WD+ +   D  L     GH  A+  V     ++VS S D T++VW   T  C FV  LNGH   +  +     +++S S D TIR+WDI  G C+ VL GH+ L     +  D   +VSG  D  I+VW +         L  +A  S L        +G   ++  D+F I+SS    T+ +W+ 
Sbjct:  102 LKPMLQRDFITALPAQGLDHIAENILSFLDARSLCSAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERHQWEKYLFKNRTTEVPPNSYYRSLYPKIIQDIETIEANWRCGRHNLQRIQCRSENSKGVYCLQYDDDKIISGLRDNSIKIWDKQSLECLKILTGHTGSVLCLQ----YDERVIVTGSSDSTVRVWDVNSGEVLNTLIHHNEAV---LHLRFCNG----LMVTCSKDRSIAVWDMAS-PTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWS--TSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVR--CIRFDNKRIVSGAYDGKIKVWDLQAA------LDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDF 510          

HSP 2 Score: 69.707 bits (169), Expect = 3.056e-12
Identity = 42/162 (25.93%), Postives = 85/162 (52.47%), Query Frame = 3
Query:  786 HTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLR 1271
            ++  + C+Q     ++SG  D ++++WD ++  C  +L GHT  V  +     V+++ S D+T+RVWD+++G  ++ L+ H      + +     L+V+ + D +I VW +++   I        H + +  +    DK+IVS+    T+K+W+     F+R
Sbjct:  230 NSKGVYCLQYDDDKIISGLRDNSIKIWDKQSLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNSGEVLNTLIHHNEAV--LHLRFCNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFD-DKYIVSASGDRTIKVWSTSTCEFVR 388          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008862.1 (pep scaffold:Pmarinus_7.0:GL476579:86637:114999:1 gene:ENSPMAG00000008000.1 transcript:ENSPMAT00000008862.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 324.709 bits (831), Expect = 1.636e-105
Identity = 180/447 (40.27%), Postives = 262/447 (58.61%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQ-----ITFLKTKEFHDLLKYGSTLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSVKS 1415
            +++I  LP EL  ++  F+  +DLL  +Q  + W  L+ D+L+W  KCR+       ++K K+        S  K  Y+   ++  NW+C   +    +  H   +IT L      I S SDD T+ V   VTG+ +R L GH GGVWS    +  +   I S S D T+++W+   G+CVH   GH + VRC+      + N+   ++SGSRD+T+R+WD+ T +C H+L     GH  A+RCVQ     VVSG+YD TV+VWD  +  C   L GHT+RVY++      ++S SLDT+IRVWD  TG C+H LVGH+SLTSGM +   ++++VSGNADST+++W + TG+C+  L G   H S +T +Q    K +V+S   GTVKLW+L  G FLR+++ L     G ++WR   SNT LVCAVG+ N  + +KL + DF V S
Sbjct:  131 RDFISLLPKELALYVLSFLEPRDLLRAAQTCRYWRILAEDNLLWREKCREEGLDEPLYVKRKKSATPNFTYSPWKSAYMRQHRIDMNWRCGEIRAPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS----SQMRGNIIVSGSTDRTLKVWNADTGQCVHTLYGHTSTVRCMHL----HGNR---VVSGSRDATLRVWDIETGQCLHVL----AGHVAAVRCVQYDGRRVVSGAYDYTVKVWDPESETCLHTLQGHTNRVYSLQFDGVHIVSGSLDTSIRVWDAETGTCLHTLVGHQSLTSGMELR--DNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFS-RKLVVTSSDDGTVKLWDLRTGDFLRNLVSLDSGGSGGVVWRVRCSNTKLVCAVGSRNGTEETKLLVLDFDVDS 559          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Sea Lamprey
Match: pafah1b1b (platelet-activating factor acetylhydrolase 1b, regulatory subunit 1b [Source:NCBI gene;Acc:394247])

HSP 1 Score: 117.472 bits (293), Expect = 1.849e-29
Identity = 92/299 (30.77%), Postives = 137/299 (45.82%), Query Frame = 3
Query:  423 IASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASS--VWVVSGSYDCTVRVWDIRTGICAFVLNGH----------TDRVYTIHLGAT------------VMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWN 1247
            I S S+D TI V D  TG+  R L+GH   V   ++  +  K  +AS SAD TV+LWDF    C+    GH++ V  +  +   +      L+S SRD T+++W+V T  C        TGH   +R V+ +     + S S D TVRVW   T  C   L  H           D    + L AT             +LS S D TI++WDI TGIC+  LVGH +   G++ +     ++S   D T+RVW      C   L   +   + L   +     ++++  +  +VK+W 
Sbjct:   62 IVSASEDATIKVWDYETGDFERTLKGHTDSVQD-ISFDLSGK-MLASCSADMTVKLWDFQSFECLRTMHGHDHNVSSVAFMPNGD-----HLVSASRDKTMKMWEVQTGYCVKTF----TGHREWVRMVRPNQDGSLIASCSNDQTVRVWVTATKECKAELREHEHVVECVSWAPDAASPVILEATGAEAKKGGKPGPYLLSGSRDKTIKMWDISTGICVITLVGHDNWVRGVLFHPGGKFILSCADDKTLRVWDYKNKRCQKSLAAHEHFVTSLDFHKTA--PYVITGSVDQSVKVWE 347          

HSP 2 Score: 93.5893 bits (231), Expect = 2.867e-21
Identity = 58/212 (27.36%), Postives = 105/212 (49.53%), Query Frame = 3
Query:  696 LISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCV--QASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHL--GATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHT------SPLTGIQIVLD-------------KFIVSSELSGTVKLWNLDDGV 1262
            ++S S D+TI++WD  T   +  L+    GHT +++ +    S   + S S D TV++WD ++  C   ++GH   V ++        ++SAS D T+++W++ TG C+    GH+     +  N D SL+ S + D T+RVW  +T EC  EL  +  H       +P     ++L+              +++S     T+K+W++  G+
Sbjct:   62 IVSASEDATIKVWDYETGDFERTLK----GHTDSVQDISFDLSGKMLASCSADMTVKLWDFQSFECLRTMHGHDHNVSSVAFMPNGDHLVSASRDKTMKMWEVQTGYCVKTFTGHREWVRMVRPNQDGSLIASCSNDQTVRVWVTATKECKAELR-EHEHVVECVSWAPDAASPVILEATGAEAKKGGKPGPYLLSGSRDKTIKMWDISTGI 268          

HSP 3 Score: 55.4546 bits (132), Expect = 1.134e-8
Identity = 35/129 (27.13%), Postives = 63/129 (48.84%), Query Frame = 3
Query:  891 FVLNGHTDRVYTI--HLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLR 1271
            + L+GH   V  +  H   +V++SAS D TI+VWD  TG     L GH      +  +    ++ S +AD T+++W   + EC+  + G   + S +  +       +VS+    T+K+W +  G  ++
Sbjct:   41 YALSGHRSPVTRVIFHPVFSVIVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDLSGKMLASCSADMTVKLWDFQSFECLRTMHGHDHNVSSVAFMPN--GDHLVSASRDKTMKMWEVQTGYCVK 167          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Sea Lamprey
Match: BTRC (beta-transducin repeat containing E3 ubiquitin protein ligase [Source:HGNC Symbol;Acc:HGNC:1144])

HSP 1 Score: 108.612 bits (270), Expect = 1.430e-25
Identity = 113/433 (26.10%), Postives = 186/433 (42.96%), Query Frame = 3
Query:   72 MKDKPGKNYIDHLPTELFFH----IFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQITF-------LKTKE------FHDLLKYGSTLKQQYIYYLKLF-----------TNWQC-NHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFV--LNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVW--------RVSTGECILELLGQQAHTSPLTGIQIVLDKF-IVSSELSGTVKLWNL 1250
            +K    +++I  LP     H    I  +++ + L +   V K W+ + +D ++W     ++         L  +       F +    G    Q   +Y  L+           +NW+C  H  + I+    S   +  L   D+ I S   D TI V   +  +       H G +   + L +Y + Y+ + S+D TVR+WD   G  V+    H     C   + +  +N    +++ S+D +I +WD+ +   D  L     GH  A+  V     ++VS S D T++VW+  T  C FV  LNGH   +  +     +++S S D TIR+WDI  G C+ VL GH+ L     +  D   +VSG  D  I+VW        R   G   L  L +  H+  +  +Q   D+F IVSS    T+ +W+ 
Sbjct:  139 LKPMLQRDFITALPARGLDHLAENILSYLDARSLCAAELVCKEWYRVISDGMLWKKLIERMVRTDSLWRGLSERRGWCLYLFRNWPNGGPP--QANSFYRALYPKIIGDIETIESNWRCGRHNLQRIQCRSESSKGVYCLQYDDEKIVSGLRDNTIKVKATIKVKAT----THHGHLIFFMFL-LYVQLYVFTGSSDSTVRVWDVNTGEMVNTLIHH-----CEAVLHLRFTNG--LMVTCSKDRSIAVWDLAS-PTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWN--TSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVR--CIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVE--HSGRVFRLQ--FDEFQIVSSSHDDTILIWDF 548          

HSP 2 Score: 50.8322 bits (120), Expect = 5.718e-7
Identity = 41/163 (25.15%), Postives = 78/163 (47.85%), Query Frame = 3
Query:  789 TGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDI 1277
            +  + C+Q     +VSG  D T++V      + A   +GH      +      + + S D+T+RVWD++TG  ++ L+ H    + + +     L+V+ + D +I VW +++   I        H + +  +    DK+IVS+    T+K+WN     F+R +
Sbjct:  270 SKGVYCLQYDDEKIVSGLRDNTIKV-KATIKVKATTHHGHLIFFMFLLYVQLYVFTGSSDSTVRVWDVNTGEMVNTLIHH--CEAVLHLRFTNGLMVTCSKDRSIAVWDLASPTDISLRRVLVGHRAAVNVVDFD-DKYIVSASGDRTIKVWNTSTCEFVRTL 428          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Sea Lamprey
Match: plrg1 (pleiotropic regulator 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2787])

HSP 1 Score: 108.227 bits (269), Expect = 1.697e-25
Identity = 83/295 (28.14%), Postives = 139/295 (47.12%), Query Frame = 3
Query:  414 DQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQK-PYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCL---VTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCV--QASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTI--HLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLG--QQAHTSPLTGIQIVL----DKFIVSSELSGTVKLWNLDD 1256
            +QW  + S D TI + +L TG+    L GH   + ++  +A+  + PY+ S   D  ++ WD    + +  + GH +    L    T+ +        L++  RD+T R+WD+ T+   H L    TGHT  +  V  QA    +++GS+DCTVR+WD+  G     L  H   V ++  H       SAS D  I+ W    G+    L GH ++ + + +NSD  ++VSG  + T+ +W   TG     +    Q       +GI        +  ++++E   T+KL+  DD
Sbjct:  225 NQWFVTGSADRTIKIWELATGKLKLSLTGH---ISTVRGVAVSSRSPYLFSCGEDKQIKCWDLEYNKVIRHYHGHLSAAYALDLHPTIDV--------LVTCGRDATARVWDIRTKANVHTL----TGHTNTVADVKCQAVEPQIITGSHDCTVRLWDLAAGKSRVTLTNHKKSVRSVVLHPRQYTFASASPD-NIKQWKFPDGVFFQNLSGHNAIINCLALNSD-GVLVSGADNGTMHLWDWRTGYNFQRIHAAVQPGSLDSESGIFACAFDHSESRLITAEADKTIKLYKEDD 502          

HSP 2 Score: 92.4337 bits (228), Expect = 2.692e-20
Identity = 56/198 (28.28%), Postives = 98/198 (49.49%), Query Frame = 3
Query:  696 LISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASS--VWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGAT--VMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDI 1277
             ++GS D TI+IW++ T K    L+ S TGH   +R V  SS   ++ S   D  ++ WD+         +GH    Y + L  T  V+++   D T RVWDI T   +H L GH +  + +   + E  +++G+ D T+R+W ++ G+  + L     H   +  + +   ++  +S     +K W   DGVF +++
Sbjct:  228 FVTGSADRTIKIWELATGK----LKLSLTGHISTVRGVAVSSRSPYLFSCGEDKQIKCWDLEYNKVIRHYHGHLSAAYALDLHPTIDVLVTCGRDATARVWDIRTKANVHTLTGHTNTVADVKCQAVEPQIITGSHDCTVRLWDLAAGKSRVTLTN---HKKSVRSVVLHPRQYTFASASPDNIKQWKFPDGVFFQNL 418          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Sea Lamprey
Match: WDR86 (WD repeat domain 86 [Source:HGNC Symbol;Acc:HGNC:28020])

HSP 1 Score: 92.8189 bits (229), Expect = 5.328e-21
Identity = 74/249 (29.72%), Postives = 108/249 (43.37%), Query Frame = 3
Query:  429 SCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLV--------------TVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRC--VQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTG 1127
            +CS D T    D+ +G  ++  RGH G    +V   +    ++ SSS D T R WD   G  + VF GH + V  L                +     N  + L+SGS D T+R+W + +  C   L     GH G + C  V AS+  + SG  D TVR WD+ +G        HTD V  + L    + S S D T R W    G C  V   HK   S   +   + ++ +G+ D+  R +   +G
Sbjct:   76 TCSADRTARCWDVQSGHCLQVYRGHAG----VVNRVVPHAGWLFSSSYDKTARCWDTRTGDALRVFAGHRSCVLPLALYCPPKGERRSSSAALAALEENTTLLLMSGSVDGTVRLWRLSSGACARTLR----GHQGPVLCLAVDASNGALYSGGADGTVRKWDLSSGQQLRSYTEHTDLVICLQLANRHLYSGSSDGTARRWLSEVGGCARVYRPHKHTVS--TLRYHDGILFTGSGDTLARAFDARSG 314          

HSP 2 Score: 91.6633 bits (226), Expect = 1.220e-20
Identity = 71/237 (29.96%), Postives = 99/237 (41.77%), Query Frame = 3
Query:  387 SIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKP--------------------YIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSL 1037
             ++  ++    W+ S S D T    D  TG+ +R   GH   V   + LA+Y  P                     + S S D TVRLW    G C    RGH+  V CL    +D SN    L SG  D T+R WD+ + +       S T HT  + C+Q ++  + SGS D T R W    G CA V   H   V T+     ++ + S DT  R +D  +G       GH  +
Sbjct:  102 GVVNRVVPHAGWLFSSSYDKTARCWDTRTGDALRVFAGHRSCV---LPLALYCPPKGERRSSSAALAALEENTTLLLMSGSVDGTVRLWRLSSGACARTLRGHQGPVLCLA---VDASNG--ALYSGGADGTVRKWDLSSGQ----QLRSYTEHTDLVICLQLANRHLYSGSSDGTARRWLSEVGGCARVYRPHKHTVSTLRYHDGILFTGSGDTLARAFDARSGALKRTFKGHTGI 326          

HSP 3 Score: 85.8853 bits (211), Expect = 1.093e-18
Identity = 63/218 (28.90%), Postives = 98/218 (44.95%), Query Frame = 3
Query:  696 LISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIR--CVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSL----------------TSGMVMNSDES---LVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQI-VLDKFIVSSELSGTVKLWNLDDGVFLRDILQ 1283
            L++G  D +  +WD    +      A+  GH G I    + A      + S D T R WD+++G C  V  GH   V  +   A  + S+S D T R WD  TG  + V  GH+S                 +S  +   +E+   L++SG+ D T+R+WR+S+G C   L G   H  P+  + +   +  + S    GTV+ W+L  G  LR   +
Sbjct:   29 LLTGGEDGSAALWDAEAPQ-GQGRRATLRGHEGYITHCALAADGARAFTCSADRTARCWDVQSGHCLQVYRGHAGVVNRVVPHAGWLFSSSYDKTARCWDTRTGDALRVFAGHRSCVLPLALYCPPKGERRSSSAALAALEENTTLLLMSGSVDGTVRLWRLSSGACARTLRG---HQGPVLCLAVDASNGALYSGGADGTVRKWDLSSGQQLRSYTE 242          

HSP 4 Score: 85.5001 bits (210), Expect = 1.211e-18
Identity = 71/237 (29.96%), Postives = 104/237 (43.88%), Query Frame = 3
Query:  480 RIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFT----------RKC--DHLLEASPTGH----TGAIRCVQA-SSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGAT--VMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGEC 1133
            R   LRGHEG +      A   + +  + SAD T R WD   G C+ V+RGH  +V  +V            L S S D T R WD  T          R C     L   P G     + A+  ++  +++ ++SGS D TVR+W + +G CA  L GH   V  + + A+   + S   D T+R WD+ +G  +     H  L   + +      + SG++D T R W    G C
Sbjct:   51 RRATLRGHEGYITHCALAADGARAF--TCSADRTARCWDVQSGHCLQVYRGHAGVVNRVVP-------HAGWLFSSSYDKTARCWDTRTGDALRVFAGHRSCVLPLALYCPPKGERRSSSAALAALEENTTLLLMSGSVDGTVRLWRLSSGACARTLRGHQGPVLCLAVDASNGALYSGGADGTVRKWDLSSGQQLRSYTEHTDLV--ICLQLANRHLYSGSSDGTARRWLSEVGGC 276          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Yeast
Match: CDC4 (F-box protein required for both the G1/S and G2/M phase transitions; modular substrate specificity factor which associates with core SCF (Cdc53p, Skp1p and Hrt1p/Rbx1p) to form the SCFCdc4 complex; SCFCdc4 acts as a ubiquitin-protein ligase directing ubiquitination of cyclin-dependent kinase (CDK) phosphorylated substrates, such as: Sic1p, Far1p, Cdc6p, Clb6p, and Cln3p [Source:SGD;Acc:S000001885])

HSP 1 Score: 170.244 bits (430), Expect = 2.837e-46
Identity = 154/513 (30.02%), Postives = 237/513 (46.20%), Query Frame = 3
Query:   66 TAMKDKPGKNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSL-SNDDLVWTSKCRQITFLKTKEFHDL-----LKYGSTLKQ--------QYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIK-LISGSRDSTIRIWDVFTRKCD-------------HLLEASP------TGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVY-TIHLGATVM-LSASLDTTIRVWDI----HTGIC----------------IHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQI--VLDKFIVSSELSGTVKLWNLDDGVFLR-DILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSVKSPCDY 1427
            T +KD   ++ I  LP E+   IF ++  +D+++   VS++W+ +      +W        F+  K F+ L      KY    +Q        + I+ LK + N +   ++ ++R   H  S+IT L   D ++ + +DD  I V D +  + +  L GH+GGVW   AL       + S S D TVR+WD  +G C HVF+GH + VRCL  V+  N    IK +++GSRD+T+ +W +                   H  E +P       GH  ++R V      VVSGSYD T+ VWD+    C ++L+GHTDR+Y TI+       +SAS+DTTIR+WD+    + G C                ++ L GH +L  G++  SD+  +VS  AD +IR W  +             H + L+ I    V D  +VS        ++NL  G  +  +IL+         +W        LV AV    +   S L I DFS  S  +Y
Sbjct:  264 TLIKDNLKRDLITSLPFEISLKIFNYLQFEDIINSLGVSQNWNKIIRKSTSLWKKLLISENFVSPKGFNSLNLKLSQKYPKLSQQDRLRLSFLENIFILKNWYNPKFVPQRTTLRG--HMTSVITCLQFEDNYVITGADDKMIRVYDSINKKFLLQLSGHDGGVW---ALKYAHGGILVSGSTDRTVRVWDIKKGCCTHVFKGHNSTVRCLDIVEYKN----IKYIVTGSRDNTLHVWKLPKESSVPDHGEEHDYPLVFHTPEENPYFVGVLRGHMASVRTVSGHGNIVVSGSYDNTLIVWDVAQMKCLYILSGHTDRIYSTIYDHERKRCISASMDTTIRIWDLENIWNNGECSYATNSASPCAKILGAMYTLQGHTALV-GLLRLSDK-FLVSAAADGSIRGWDANDYSRKFSY-----HHTNLSAITTFYVSDNILVSGS-ENQFNIYNLRSGKLVHANILK-----DADQIWSVNFKGKTLVAAVEKDGQ---SFLEILDFSKASKINY 751          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Yeast
Match: MET30 (F-box protein containing five copies of the WD40 motif; controls cell cycle function, sulfur metabolism, and methionine biosynthesis as part of the ubiquitin ligase complex; interacts with and regulates Met4p, localizes within the nucleus; dissociation of Met30p from SCF complex in response to cadmium stress is regulated by Cdc48p [Source:SGD;Acc:S000001308])

HSP 1 Score: 135.191 bits (339), Expect = 1.908e-34
Identity = 117/431 (27.15%), Postives = 185/431 (42.92%), Query Frame = 3
Query:   93 NYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQITFLKTKEFH---DLLKYGSTLKQQ----------------------YIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQ--ASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVY----------------------------TIHLGA---------------------TVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQ 1157
            ++I  LP EL   I  +++ + L + ++V + W  L++DD VW   C Q    K         LL       QQ                      Y    K+ +NW+  H +       H   ++T    + + + + S D TI + DL TG+ IR L GH  GV +L     +    + + S D T+R+W+++ G C+  +RGH + V     + +D+  K I  +SGS D T+++W V +R C  L      GHT  + CV+    S    S S D T+R+WDIRT  C  V  GH  +V                             T+  GA                     T +LS  LD TI++WD+ TG CI    GH  +     + +D   ++SG+ D +I+VW + +G+C+    G++
Sbjct:  182 DFISILPQELSLKILSYLDCQSLCNATRVCRKWQKLADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRARIQQNSTGSSSNADIQTQTTRPWKVIYRERFKVESNWRKGHCRIQ-EFKGHMDGVLTLQFNY-RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLY----FDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSV-----LSVDSYQKVI--VSGSADKTVKVWHVESRTCYTL-----RGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGH--VEGVWDIAADNFRIISGSHDGSIKVWDLQSGKCMHTFNGRR 592          

HSP 2 Score: 70.8626 bits (172), Expect = 1.723e-13
Identity = 51/171 (29.82%), Postives = 81/171 (47.37%), Query Frame = 3
Query:  429 SCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWD---FVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIH 932
            SCSDD TI + D+ T   ++  RGH G V  ++ L I     +A+ +        D     +G        +E       TV  +N   P  L+S   D+TI++WDV T KC      +  GH   +  + A +  ++SGS+D +++VWD+++G C    NG   +  T H
Sbjct:  438 SCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQ-----ETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIR----TQFGHVEGVWDIAADNFRIISGSHDGSIKVWDLQSGKCMHTFNGRRLQRETQH 599          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Yeast
Match: TUP1 (General repressor of transcription; forms complex with Cyc8p, involved in the establishment of repressive chromatin structure through interactions with histones H3 and H4, appears to enhance expression of some genes [Source:SGD;Acc:S000000680])

HSP 1 Score: 91.6633 bits (226), Expect = 4.539e-20
Identity = 67/238 (28.15%), Postives = 110/238 (46.22%), Query Frame = 3
Query:  552 YIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLN-------GHTDRVYTI---HLGATVMLSASLDTTIRVWDI------------HTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQ--------AHTSPL 1175
            ++A+ + D  +R+WD    + V + +GHE  +  L     D      KL+SGS D T+RIWD+ T +C   L       T A+        ++ +GS D  VRVWD  TG     L+       GH D VY++     G +V +S SLD ++++W++            ++G C    +GHK     +    ++  ++SG+ D  +  W   +G  +L L G +        A+ SPL
Sbjct:  457 FLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSL-----DYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSP--GDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSV-VSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSPL 686          

HSP 2 Score: 80.1073 bits (196), Expect = 2.216e-16
Identity = 66/259 (25.48%), Postives = 120/259 (46.33%), Query Frame = 3
Query:  417 QWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFT----RKCDHLLEASPTGHTGAIRCV--QASSVWVVSGSYDCTVRVWDIR------------TGICAFVLNGHTDRVYTIHL--GATVMLSASLDTTIRVWDIHTGICIHVLVGHK------SLTSGMVMNSDESLVVSGNADSTIRVWR 1115
            +++A+ ++D  I + D+   + +  L+GHE  ++SL       K  + S S D TVR+WD   G+C        +I   + TV +   +    + +GS D  +R+WD  T     + D   E+  TGH  ++  V        VVSGS D +V++W+++            +G C     GH D V ++        +LS S D  +  WD  +G  + +L GH+      ++ +G  +  + ++  +G+ D   R+W+
Sbjct:  456 KFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDK--LVSGSGDRTVRIWDLRTGQCSLTL----SIEDGVTTVAVSPGDGKY-IAAGSLDRAVRVWDSETGFLVERLDSENESG-TGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWK 706          

HSP 3 Score: 74.3294 bits (181), Expect = 1.624e-14
Identity = 44/159 (27.67%), Postives = 73/159 (45.91%), Query Frame = 3
Query:  804 CVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHL--GATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQ----AHTSPLTGIQIVLD-KFIVSSELSGTVKLWNLDDG 1259
            C      ++ +G+ D  +R+WDI       +L GH   +Y++        ++S S D T+R+WD+ TG C   L     +T+  V   D   + +G+ D  +RVW   TG  +  L  +      H   +  +    D + +VS  L  +VKLWNL + 
Sbjct:  450 CFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNA 608          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Yeast
Match: PRP46 (Member of the NineTeen Complex (NTC); this complex contains Prp19p and stabilizes U6 snRNA in catalytic forms of the spliceosome containing U2, U5, and U6 snRNAs [Source:SGD;Acc:S000006072])

HSP 1 Score: 90.1225 bits (222), Expect = 6.568e-20
Identity = 94/326 (28.83%), Postives = 152/326 (46.63%), Query Frame = 3
Query:  408 VFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQK-PYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLIS-GSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSV--WVVSGSYDCTVRVWDIRTGICAFVLNGHTD--RVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKS-LTSGMVMNSDESLVVSGNA--------DSTIRVWRVSTGECILELLGQQA---HTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVS 1331
            V ++W  + S+D T+ V DL TG+    L GH   V ++  +A+  + PY+ S S D TV+ WD  + + +  + GH + VR   TV I   +  + LI+   RDS I++WD+ TR    +   +  GH G I  VQ + V   VVS S D TVR+WD+  G    VL  H    R   +H     + SA  D  IR W +  G  +      K+ + + + +N D+ L   G+          S  +   ++T E +  L G+++    T   TG++      +++ E   ++K+W  D+          K S PG + W   +S
Sbjct:  150 VDNEWFITGSNDTTMKVWDLATGKLKTTLAGH---VMTVRDVAVSDRHPYLFSVSEDKTVKCWDLEKNQIIRDYYGHLSGVR---TVSI---HPTLDLIATAGRDSVIKLWDMRTR----IPVITLVGHKGPINQVQCTPVDPQVVSSSTDATVRLWDVVAGKTMKVLTHHKRSVRATALHPKEFSVASACTD-DIRSWGLAEGSLLTNFESEKTGIINTLSINQDDVLFAGGDNGVLSFYDYKSGHKYQSLATREMVGSLEGERSVLCSTFDKTGLR------LITGEADKSIKIWKQDETA-------TKESEPG-LAWNPNLS 447          

HSP 2 Score: 88.5817 bits (218), Expect = 2.138e-19
Identity = 67/231 (29.00%), Postives = 110/231 (47.62%), Query Frame = 3
Query:  609 RCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASS--VWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVML--SASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLK 1289
            +   V  GH   VRC+    +DN       I+GS D+T+++WD+ T K    L+ +  GH   +R V  S    ++ S S D TV+ WD+          GH   V T+ +  T+ L  +A  D+ I++WD+ T I +  LVGHK   + +     +  VVS + D+T+R+W V  G+ +  L     H   +    +   +F V+S  +  ++ W L +G  L +    K
Sbjct:  130 KLSRVINGHLGWVRCVAIDPVDNE----WFITGSNDTTMKVWDLATGK----LKTTLAGHVMTVRDVAVSDRHPYLFSVSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVIKLWDMRTRIPVITLVGHKGPINQVQCTPVDPQVVSSSTDATVRLWDVVAGKTMKVLT---HHKRSVRATALHPKEFSVASACTDDIRSWGLAEGSLLTNFESEK 349          

HSP 3 Score: 81.6481 bits (200), Expect = 4.631e-17
Identity = 54/177 (30.51%), Postives = 86/177 (48.59%), Query Frame = 3
Query:  783 GHTGAIRCVQASSV---WVVSGSYDCTVRVWDIRTGICAFVLNGH--TDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQ-IVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHS 1295
            GH G +RCV    V   W ++GS D T++VWD+ TG     L GH  T R   +      + S S D T++ WD+     I    GH S    + ++    L+ +   DS I++W + T   ++ L+G   H  P+  +Q   +D  +VSS    TV+LW++  G  ++ +   K S
Sbjct:  137 GHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDLATGKLKTTLAGHVMTVRDVAVSDRHPYLFSVSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVIKLWDMRTRIPVITLVG---HKGPINQVQCTPVDPQVVSSSTDATVRLWDVVAGKTMKVLTHHKRS 310          

HSP 4 Score: 77.0258 bits (188), Expect = 1.320e-15
Identity = 64/264 (24.24%), Postives = 111/264 (42.05%), Query Frame = 3
Query:  486 RFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKC--DHLLEASPTGHTGAIRCVQASSV--WVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGA--TVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDG 1259
            R + GH G V   VA+      +  + S D T+++WD   G+      GH   VR +       S++   L S S D T++ WD+   +   D+       GH   +R V        + +   D  +++WD+RT I    L GH   +  +        ++S+S D T+R+WD+  G  + VL  HK       ++  E  V S   D  IR W ++ G  +     ++  T  +  + I  D  + +   +G +  ++   G
Sbjct:  133 RVINGHLGWV-RCVAIDPVDNEWFITGSNDTTMKVWDLATGKLKTTLAGHVMTVRDVAV-----SDRHPYLFSVSEDKTVKCWDLEKNQIIRDYY------GHLSGVRTVSIHPTLDLIATAGRDSVIKLWDMRTRIPVITLVGHKGPINQVQCTPVDPQVVSSSTDATVRLWDVVAGKTMKVLTHHKRSVRATALHPKEFSVASACTDD-IRSWGLAEGSLLTNFESEK--TGIINTLSINQDDVLFAGGDNGVLSFYDYKSG 381          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Yeast
Match: SEC27 (Essential beta'-coat protein of the COPI coatomer; involved in ER-to-Golgi and Golgi-to-ER transport; contains WD40 domains that mediate cargo selective interactions; 45% sequence identity to mammalian beta'-COP [Source:SGD;Acc:S000003105])

HSP 1 Score: 90.8929 bits (224), Expect = 9.034e-20
Identity = 63/229 (27.51%), Postives = 102/229 (44.54%), Query Frame = 3
Query:  333 NWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCV-HVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQ----ASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRV--YTIHLGATVMLSASLDTTIRVWDIHT 998
            N++   E  SI+V+  +       I    WI   SDD+ I V +  TGE++     H   + S+       KPY+ S S D TV+LW++     +   F GHE+ V C+      N   P    SG  D T+++W +     +  L    TG    +  V         ++++ S D T+++WD +T  C   L GH   V     H    +++S S D T+++W+  T
Sbjct:   41 NYETQVEVRSIQVT-ETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPT--KPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAF----NPKDPSTFASGCLDRTVKVWSLGQSTPNFTLT---TGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSST 259          

HSP 2 Score: 83.1889 bits (204), Expect = 2.739e-17
Identity = 59/204 (28.92%), Postives = 96/204 (47.06%), Query Frame = 3
Query:  537 IYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCV---QASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRV-----YTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVST 1124
            I +K +I   S D  +R++++  G  V  F  H + +R +      +  KP  ++SGS D T+++W+    + +  LE +  GH   + CV           SG  D TV+VW +      F L    +R      Y        M++AS D TI++WD  T  C+  L GH S  S  V +    +++SG+ D T+++W  ST
Sbjct:   64 IARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAV----HPTKPY-VLSGSDDLTVKLWNW---ENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSST 259          

HSP 3 Score: 55.0694 bits (131), Expect = 1.884e-8
Identity = 62/246 (25.20%), Postives = 101/246 (41.06%), Query Frame = 3
Query:  546 KPYIASSSADCTVRLWDF---VEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIR--CVQASSVWVVSGSYDCTVRVWDIRTG-ICAFVLNGHTDRVYTIHLGA---TVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMN---SDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWN 1247
            +P++ ++     V LW++   VE R + V    E  VR    +   N      +I GS D  IR+++  T +     EA    H   IR   V  +  +V+SGS D TV++W+            GH   V  +       +   S  LD T++VW +        L   +      V      D+  +++ + D TI++W   T  C+  L G  ++ S        L   I+S    GT+K+WN
Sbjct:   25 EPWVLTTLYSGRVELWNYETQVEVRSIQV---TETPVRAGKFIARKNW-----IIVGSDDFRIRVFNYNTGEKVVDFEA----HPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVS-FAVFHPTL-PIIISGSEDGTLKIWN 256          

HSP 4 Score: 54.299 bits (129), Expect = 3.162e-8
Identity = 30/90 (33.33%), Postives = 47/90 (52.22%), Query Frame = 3
Query:  498 GHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLL 767
            G E GV  +    +  KPY+ ++S D T+++WD+    CV    GH       V+  + +   PI +ISGS D T++IW+  T K +  L
Sbjct:  182 GQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGH----MSNVSFAVFHPTLPI-IISGSEDGTLKIWNSSTYKVEKTL 266          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Nematostella
Match: EDO42306 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1V2])

HSP 1 Score: 301.597 bits (771), Expect = 1.140e-95
Identity = 170/463 (36.72%), Postives = 256/463 (55.29%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQITFLKTKEFHDLLK---------------------YGSTLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSVKS 1415
            +++I  LP EL  ++  F+   DLL  +Q  K W  L  D+L+W  KCR+     T++ H   K                     + S  K+ ++   K++ NW+    + S  +  H   +IT L      + S SDD T+ V   ++G+ +R L GH GGVWS    +      I S S D T+++W+   G C+H   GH + VRC+      + ++ + ++SGSRD T+R+WD  T  C H+L     GH  A+RCV+     VVSG+YD  V+VWD  T  C   L GHT+RVY++    T ++S SLDT+IRVW   TG C+H LVGH+SLTSGM + ++   +VSGNADST+++W ++TG+C+  L G   H S +T +Q    KF+++S   GTVK+W+L  G F+RD+++L     G ++WR       LVCAVG+ N  + +KL + DF  + 
Sbjct:  174 RDFISLLPRELALYVLSFLEPSDLLHAAQTCKCWQILCEDNLLWKQKCREAGI--TEDPHGTSKLPRRRSTQTQNNTAPTPTTKHHPSPYKKLFMVKQKIYWNWRRGPLRPSKILKGHDDHVITCLQFSGSRVVSGSDDGTLKVWSALSGKCLRTLTGHTGGVWS----SQLSGHIIVSGSTDRTLKVWNAETGYCMHTLYGHTSTVRCM------DMHEEV-VVSGSRDGTLRVWDTTTGNCLHVL----VGHLAAVRCVKYDGHRVVSGAYDFLVKVWDPETEQCIHTLQGHTNRVYSLQFDGTYIVSGSLDTSIRVWHAETGQCLHTLVGHQSLTSGMELRNN--TLVSGNADSTVKIWDITTGQCLQTLAGPNKHQSAVTCLQFS-SKFVITSSDDGTVKIWDLQTGEFIRDLVKLDSGGSGGVVWRVKCDEKKLVCAVGSRNGTEETKLLVLDFDAQE 616          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Nematostella
Match: EDO44093 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWV7])

HSP 1 Score: 142.895 bits (359), Expect = 8.666e-38
Identity = 90/276 (32.61%), Postives = 147/276 (53.26%), Query Frame = 3
Query:  423 IASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNL 1250
            + + S D TI + D+ +G  IR ++GH+GGV  L     +    I S S D T+ +W  V+   +HV  GH+  V CL   + D +     L+SGS DSTIR+WD+ T +C  +L+    GH GA+ C++  + +V+SGS D T+++W++ +G C   L GH D V ++ +   ++LS S D  I  WD+ +G C   +  H+     +   +D     S   D+ I+ W V T  C+  L   Q H  P+  + +V   +I+     G+V++W+L
Sbjct:  162 VVTGSSDRTIRMWDVRSGRSIRKMKGHKGGVRCLQ----FDNERIISGSWDMTIMVWHIVKFTRLHVLYGHKGCVSCL---RFDENT----LVSGSHDSTIRVWDMRTWECVLVLQ----GHEGAVSCLEFDAPFVLSGSADKTIKLWNVESGDCLNTLRGHADAVTSVKVIGELILSGSADGMILFWDLDSGHCEAAIQAHEGPVHSLSYANDH--FFSAGGDNMIKEWDVGTCTCLRTL---QGHRGPVQDV-MVGHHYILVEHYDGSVRIWDL 416          

HSP 2 Score: 137.502 bits (345), Expect = 7.682e-36
Identity = 88/249 (35.34%), Postives = 135/249 (54.22%), Query Frame = 3
Query:  540 YQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDV--FTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHK-SLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDI 1277
            + +  + + S+D T+R+WD   GR +   +GH+  VRCL   Q DN     ++ISGS D TI +W +  FTR   H+L     GH G + C++     +VSGS+D T+RVWD+RT  C  VL GH   V  +   A  +LS S D TI++W++ +G C++ L GH  ++TS  V+     L++SG+AD  I  W + +G C   +   QAH  P+  +    D F  S+     +K W++     LR +
Sbjct:  157 FDRRRVVTGSSDRTIRMWDVRSGRSIRKMKGHKGGVRCL---QFDNE----RIISGSWDMTIMVWHIVKFTRL--HVL----YGHKGCVSCLRFDENTLVSGSHDSTIRVWDMRTWECVLVLQGHEGAVSCLEFDAPFVLSGSADKTIKLWNVESGDCLNTLRGHADAVTSVKVIG---ELILSGSADGMILFWDLDSGHCEAAI---QAHEGPVHSLSYANDHFF-SAGGDNMIKEWDVGTCTCLRTL 385          

HSP 3 Score: 92.0485 bits (227), Expect = 3.320e-20
Identity = 61/203 (30.05%), Postives = 99/203 (48.77%), Query Frame = 3
Query:  384 KSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDI 992
            K  ++ L   +  + S S D TI V D+ T E +  L+GHEG V  L     +  P++ S SAD T++LW+   G C++  RGH + V    +V++        ++SGS D  I  WD+ +  C    EA+   H G +  +  ++    S   D  ++ WD+ T  C   L GH   V  + +G   +L    D ++R+WD+
Sbjct:  229 KGCVSCLRFDENTLVSGSHDSTIRVWDMRTWECVLVLQGHEGAVSCLE----FDAPFVLSGSADKTIKLWNVESGDCLNTLRGHADAV---TSVKVIGE----LILSGSADGMILFWDLDSGHC----EAAIQAHEGPVHSLSYANDHFFSAGGDNMIKEWDVGTCTCLRTLQGHRGPVQDVMVGHHYILVEHYDGSVRIWDL 416          

HSP 4 Score: 68.1662 bits (165), Expect = 2.207e-12
Identity = 53/173 (30.64%), Postives = 74/173 (42.77%), Query Frame = 3
Query:  867 DIRTGI--CAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICI----------------------------------------HVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDG 1259
            D+R  +   A VL GH D V  +      +++ S D TIR+WD+ +G  I                                        HVL GHK   S   +  DE+ +VSG+ DSTIRVW + T EC+L L G +   S L         F++S     T+KLWN++ G
Sbjct:  133 DVRPALVQAANVLKGHMDVVLCLQFDRRRVVTGSSDRTIRMWDVRSGRSIRKMKGHKGGVRCLQFDNERIISGSWDMTIMVWHIVKFTRLHVLYGHKGCVS--CLRFDENTLVSGSHDSTIRVWDMRTWECVLVLQGHEGAVSCLE----FDAPFVLSGSADKTIKLWNVESG 299          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Nematostella
Match: EDO39072 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB92])

HSP 1 Score: 141.739 bits (356), Expect = 3.559e-37
Identity = 108/394 (27.41%), Postives = 174/394 (44.16%), Query Frame = 3
Query:  108 LPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQITFLKTKEFHDLLKYGSTLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFV--EGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRK--CDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECI--LELLGQQAHTSPLTGIQIVLDKF-IVSSELSGTVKLWNLDDGVFL 1268
            LP  +   I  +++   L  CS V++ WH L+N   +W   C    +  ++          TL    I + K+F                         ++   W+    D              +R   GH  G    ++   +    I S S+D T+++WD    +   V    GH   VRCL      N N   +L+SGS D +I++WD+           + +  GH   +RC+Q     VVSGSYD T++VWDI+TG C   L GH   V  +    + ++S S D TI+VW +  G C+  L GH    + + +  D   V+SG+ D  ++ W ++TG+CI  L+ +  + HT  +  +Q   D + IVS+    T+K+W+L+ G  L
Sbjct:   57 LPHNVTSVIMSYLDPVSLCRCSLVNRLWHDLANMPALWQRLCSNDEWKVSRVGEKQQFQRHTLPSGIIQWKKMFAE---------------------RFLLRKNWLNGRCD--------------VRTFEGHTQG----ISCVQFDDTRIVSGSSDKTIKVWDLSREDTSAVLTLAGHSGTVRCLNL----NGN---RLVSGSVDRSIKVWDLSFESYWSGASCKVTMVGHMHTVRCLQVDDEKVVSGSYDKTLKVWDIKTGNCKLTLRGHNAAVLCVQFDESKIVSGSYDNTIKVWSLVEGSCLMTLAGHHDAVTCLNLTLDRRKVISGSLDHNLKFWDLATGKCIGTLDWIRSEGHTGVIRCLQS--DSWRIVSAGDDKTLKMWSLESGQRL 402          

HSP 2 Score: 110.153 bits (274), Expect = 4.128e-26
Identity = 71/198 (35.86%), Postives = 102/198 (51.52%), Query Frame = 3
Query:  402 LIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLE-ASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDI 992
            L V D+ + S S D T+ V D+ TG     LRGH   V        + +  I S S D T+++W  VEG C+    GH + V CL  + +D      K+ISGS D  ++ WD+ T KC   L+     GHTG IRC+Q+ S  +VS   D T+++W + +G     L  HTD V  +      ++S S D T++VWD 
Sbjct:  248 LQVDDEKVVSGSYDKTLKVWDIKTGNCKLTLRGHNAAV----LCVQFDESKIVSGSYDNTIKVWSLVEGSCLMTLAGHHDAVTCL-NLTLDRR----KVISGSLDHNLKFWDLATGKCIGTLDWIRSEGHTGVIRCLQSDSWRIVSAGDDKTLKMWSLESGQRLLTLRCHTDGVTCLQFNDYRIVSGSYDKTVKVWDF 436          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Nematostella
Match: EDO32198 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVR9])

HSP 1 Score: 133.265 bits (334), Expect = 2.491e-33
Identity = 113/406 (27.83%), Postives = 187/406 (46.06%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQITFLKTKEFHDLLKYGSTLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQA--SSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLD---------TTIRVWDIHTGICIHVLVGHKS------LTSGMVMNSDES-LVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLD 1253
            +++I  LP EL   +  ++   +LL  +QV K W  +++ D +W +KCR + ++        L   +  K  +   + L  NW     K  + +S H+KS+ +     ++ IAS S D T+ V D  TG  ++ L GH  G+W    L       + S S D ++R+W+   G C  +   HE  +  +         K   LISGS D T ++W++  R+C  L   +  GHTG++ CV    ++    +GS D TVR+WD+ +G C  +       VY     A+ + S S D           + +W++  G C H   GHK+      L   MV    ES ++VS   DS I+ W +  G CI  L   ++H   +  I    D  I+S+     +++W+ +
Sbjct:  315 RDFISLLPDELSLKVLSYLRPNELLVAAQVCKFWQGMASRDELWQAKCR-LQYVGVP-----LSVPAIWKDIFKRNINLKRNWAEGRCK-VMEISGHTKSVFSVCECMNK-IASGSLDRTVKVWDATTGNLLQSLHGHTRGIW---CLRFLSSSILISGSYDKSIRVWNLRTGICARILLSHEAPIWAI-------ERKKDILISGSGDKTAKLWNI--RQCKLL--CTLFGHTGSVFCVDLDDAAKRAFTGSADRTVRIWDVASGACVGI-------VYAGLSNASAITSVSYDQDYIAVAAGNLVSLWNLANGTCSHEFKGHKARIESVRLRFMMVNGRKESGVIVSAGKDSMIKYWDIERGTCIQTL---RSHKDAVNCIHFD-DTRIISASYDNRIRIWDFN 687          

HSP 2 Score: 97.8265 bits (242), Expect = 1.432e-21
Identity = 73/224 (32.59%), Postives = 118/224 (52.68%), Query Frame = 3
Query:  594 DFVEGRC-VHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQ-ASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDG 1259
            ++ EGRC V    GH   V      +  N     K+ SGS D T+++WD  T    +LL+ S  GHT  I C++  SS  ++SGSYD ++RVW++RTGICA +L  H   ++ I     +++S S D T ++W+I     +  L GH      + ++       +G+AD T+R+W V++G C+  +    ++ S +T +    D   V++     V LWNL +G
Sbjct:  390 NWAEGRCKVMEISGHTKSV--FSVCECMN-----KIASGSLDRTVKVWDATT---GNLLQ-SLHGHTRGIWCLRFLSSSILISGSYDKSIRVWNLRTGICARILLSHEAPIWAIERKKDILISGSGDKTAKLWNIRQCKLLCTLFGHTGSVFCVDLDDAAKRAFTGSADRTVRIWDVASGACVGIVYAGLSNASAITSVSYDQDYIAVAA--GNLVSLWNLANG 600          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Nematostella
Match: EDO48720 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIJ5])

HSP 1 Score: 122.479 bits (306), Expect = 2.296e-30
Identity = 125/450 (27.78%), Postives = 195/450 (43.33%), Query Frame = 3
Query:   72 MKDKPGKNYIDHLPTELFFHI----FKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQITFLKTKEFHDLLKYGSTLKQ---QYIY------------YLKLF-----------TNWQC-NHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFV--LNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVW--------RVSTGECILELLGQQAHTSPLTGIQIVLDKF-IVSSELSGTVKLWNLDDGVFLRDILQLKHS 1295
            +K    +++I  LP +   HI      F++ K L +   V K WH +  D ++W         ++ K   D L +G + ++   QY++            + KL+           TNW+C NH    I     +   +  L   D  I S   D TI V D  +   ++ L GH G V  L     Y +  I + S+D TVR+W+   G  ++    H     C   + +    +   +++ S+D +I +WD+ +   D  L     GH  A+  V     ++VS S D T++VW   T  C FV  LNGH   +  +     +++S S D TIR+WDI  G C+ VL GH+ L     +  D   +VSG  D  I+VW        R   G   L  L +  HT  +  +Q   D F IVSS    T+ +W+     FL+D  +  +S
Sbjct:   35 LKPMLQRDFITALPAKGLDHIAENILSFLDAKSLCAAEVVCKEWHRVIADGMLWKK------LIERKVRTDPLWHGLSERRGWGQYLFKSKVPDPPNNDFFRKLYPKIIQDLETIETNWRCGNHALHKIPCRSENSKGVYCLQYDDHKIVSGLRDNTIKVWDKKSLACVKVLTGHTGSVLCLQ----YDENVIVTGSSDSTVRVWNVHAGDMLNTLIHH-----CEAVLHL--RFQEGMMVTCSKDRSIAVWDMQS-PTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWS--TSTCEFVRTLNGHRRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVR--CIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPAGTLCLRTLVE--HTGRVFRLQ--FDDFQIVSSSHDDTILIWD-----FLKDATERTYS 453          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Medaka
Match: ENSORLT00000003546.2 (F-box/WD repeat-containing protein 7 [Source:NCBI gene;Acc:101171440])

HSP 1 Score: 323.168 bits (827), Expect = 2.701e-104
Identity = 180/448 (40.18%), Postives = 261/448 (58.26%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQ------ITFLKTKEFHDLLKYGSTLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVW-SLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSVK 1412
            +++I  LP EL  ++  F+  +DLL  +Q  + W  L+ D+L+W  KCR+       ++ + +         S  K  YI   ++ TNW+     E + +  H   +IT L      I S SDD T+ V   VTG+ ++ L GH GGVW S +A+A      + S S D T+R+WD   G CVH   GH + VRC+      + N+   ++SGSRD+T+R+W+V T +C+H+L    TGH  A+RCVQ     VVSG YD  V+VWD  T +C   L GHT+RVY++      ++S SLDT+IRVWD  TG C+H L GH+SLTSGM +   ++++VSGNADST+RVW + TG C+  L G   H S +T +Q      ++SS   GTVKLW+L  G +LRD++ L+    G ++WR   S+T LVCA G+ N  + +KL I DF ++
Sbjct:  122 RDFISLLPKELALYVLTFLPPRDLLRAAQTCRYWRILAEDNLLWREKCREEGISESASYRRRESVRPSAAAVSPWKSAYIRQHRIETNWRKGDTGEPMVLKGHDDHVITCLQFSGDLIVSGSDDNTLKVWSAVTGKCLQTLTGHTGGVWCSQMAVAT-----VISGSTDRTLRVWDAESGECVHTLYGHTSTVRCMHL----HGNR---VVSGSRDTTLRVWNVTTGQCEHVL----TGHVAAVRCVQYDGRRVVSGGYDYMVKVWDPETEVCLHTLQGHTNRVYSLQFDGAFVVSGSLDTSIRVWDAETGGCVHTLTGHQSLTSGMELR--DNILVSGNADSTVRVWDIRTGLCLHTLQGPNKHQSAVTCLQFC-RGLVLSSSDDGTVKLWDLRTGAWLRDVVALQSRGSGGVVWRIKASDTRLVCAAGSRNGTEETKLLIMDFDLE 550          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Medaka
Match: fbxw7 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:101155087])

HSP 1 Score: 322.013 bits (824), Expect = 7.694e-104
Identity = 179/445 (40.22%), Postives = 261/445 (58.65%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQ--ITFLKTKEFHDLLKYG---STLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSV 1409
            +++I  LP EL  ++  F+  KDLL  +Q  + W  L+ D+L+W  KCR+  I      +    +K G   S  K  YI   ++ TNW+    K    +  H   +IT L      I S SDD T+ V   VTG+ +R L GH GGVWS    +  ++  I S S D T+++W+   G C+H   GH + VRC+   +        +++SGSRD+T+R+WD+ T +C H+L     GH  A+RCVQ     VVSG+YD  V+VWD  T  C   L GHT+RVY++      ++S SLDT+IRVWD+ TG CIH L GH+SLTSGM +   ++++VSGNADST+++W + TG+C+  L G   H S +T +Q   + F+++S   GTVKLW+L  G F+R+++ L+    G ++WR   SNT LVCAVG+ N  + +KL + DF V
Sbjct:  124 RDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCREEGIDEPLAPKKRGNVKAGFTHSPWKSAYIRQHRIDTNWRRGDLKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS----SQMRENIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEK-------RVVSGSRDATLRVWDIETGQCLHVL----MGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTVKIWDIKTGQCLQTLQGPHKHQSAVTCLQFNKN-FVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFGV 550          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Medaka
Match: fbxw7 (F-box and WD repeat domain containing 7 [Source:NCBI gene;Acc:101155087])

HSP 1 Score: 324.324 bits (830), Expect = 3.403e-102
Identity = 179/445 (40.22%), Postives = 261/445 (58.65%), Query Frame = 3
Query:   90 KNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQ--ITFLKTKEFHDLLKYG---STLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSV 1409
            +++I  LP EL  ++  F+  KDLL  +Q  + W  L+ D+L+W  KCR+  I      +    +K G   S  K  YI   ++ TNW+    K    +  H   +IT L      I S SDD T+ V   VTG+ +R L GH GGVWS    +  ++  I S S D T+++W+   G C+H   GH + VRC+   +        +++SGSRD+T+R+WD+ T +C H+L     GH  A+RCVQ     VVSG+YD  V+VWD  T  C   L GHT+RVY++      ++S SLDT+IRVWD+ TG CIH L GH+SLTSGM +   ++++VSGNADST+++W + TG+C+  L G   H S +T +Q   + F+++S   GTVKLW+L  G F+R+++ L+    G ++WR   SNT LVCAVG+ N  + +KL + DF V
Sbjct:  349 RDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCREEGIDEPLAPKKRGNVKAGFTHSPWKSAYIRQHRIDTNWRRGDLKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS----SQMRENIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEK-------RVVSGSRDATLRVWDIETGQCLHVL----MGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTVKIWDIKTGQCLQTLQGPHKHQSAVTCLQFNKN-FVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFGV 775          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Medaka
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:101166483])

HSP 1 Score: 116.316 bits (290), Expect = 1.569e-28
Identity = 89/291 (30.58%), Postives = 137/291 (47.08%), Query Frame = 3
Query:  417 QWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLI-SGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCV--QASSVWVVSGSYDCTVRVWDIRTGICAFVL---NGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMN---SDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSS---ELSGTVKLWNLD 1253
            +W+AS S D  I +     G+  + + GH+ G+ S VA +      + S+S D T+++WD   G+C+   +GH N V C       N N    LI SGS D ++RIWDV T KC   L A    H+  +  V        +VS SYD   R+WD  +G C   L   +               +L+A+LD T+++WD   G C+    GHK+    +  N   +    +VSG+ D+ + +W + T E + +L   Q HT  +        + I++S   E   T+KLW  D
Sbjct:   58 EWLASSSADKLIKIWGAYDGKFEKTISGHKLGI-SDVAWS-SDSNLLVSASDDKTLKIWDVNSGKCLKTLKGHSNYVFCC------NFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPA----HSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKL---QGHTDVVISTACHPTENIIASAALENDKTIKLWKSD 333          

HSP 2 Score: 108.227 bits (269), Expect = 1.071e-25
Identity = 61/197 (30.96%), Postives = 106/197 (53.81%), Query Frame = 3
Query:  696 LISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCV--QASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLG--ATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLD-KFIVSSELSGTVKLWNLDDGVFLR 1271
            L S S D  I+IW  +    D   E + +GH   I  V   + S  +VS S D T+++WD+ +G C   L GH++ V+  +    + +++S S D ++R+WD+ TG C+  L  H    S +  N D SL+VS + D   R+W  ++G+C+  L+       P++ ++   + K+I+++ L  T+KLW+   G  L+
Sbjct:   60 LASSSADKLIKIWGAY----DGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVNSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDD--NPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLK 250          

HSP 3 Score: 94.7449 bits (234), Expect = 4.719e-21
Identity = 59/209 (28.23%), Postives = 106/209 (50.72%), Query Frame = 3
Query:  750 KCDHLLEASPTGHTGAIRCVQ--ASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGA--TVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLD-KFIVSSELSGTVKLWNLDDGVFLRDILQ--------LKHSFPGAMMWRAVVSNT 1337
            K ++ L+ +  GHT A+  V+   S  W+ S S D  +++W    G     ++GH   +  +   +   +++SAS D T+++WD+++G C+  L GH +       N   +L+VSG+ D ++R+W V TG+C+  L    AH+ P++ +    D   IVSS   G  ++W+   G  L+ ++         +K S  G  +  A + NT
Sbjct:   32 KPNYSLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVNSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL---PAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNT 237          
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Medaka
Match: PAFAH1B1 (platelet activating factor acetylhydrolase 1b regulatory subunit 1 [Source:NCBI gene;Acc:101169717])

HSP 1 Score: 117.857 bits (294), Expect = 1.727e-28
Identity = 89/299 (29.77%), Postives = 136/299 (45.48%), Query Frame = 3
Query:  423 IASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASS--VWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIH----------LGAT------------VMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWN 1247
            + S S+D TI V D  TG+  R L+GH   V  +      +   +AS SAD T++LWDF    C+    GH++ V  +  +   +      ++S SRD TI++W+V T  C         GH   +R V+ +     + S S D TVRVW + +  C   L  H   V  I           L AT             +LS S D TI++WD+ TG+C+  LVGH +   G++ +     +VS   D T+R+W      C+  L   +   + L   +     F+V+  +  TVK+W 
Sbjct:  123 MVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDQTGK--LLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDH-----IVSASRDKTIKMWEVATGYCVKTF----AGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVASKECKAELREHEHVVECISWAPESASPTILEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGILFHPGGKFIVSCADDKTLRIWDYKNKRCMKTLCAHEHFVTSLDFHKAA--PFVVTGSVDQTVKVWE 408          

HSP 2 Score: 92.8189 bits (229), Expect = 6.067e-20
Identity = 58/214 (27.10%), Postives = 107/214 (50.00%), Query Frame = 3
Query:  696 LISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCV--QASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHL--GATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHT------SPLTGIQIVLD-------------KFIVSSELSGTVKLWNLDDGVFL 1268
            ++S S D+TI++WD  T   +  L+    GHT +++ +    +   + S S D T+++WD +   C   ++GH   V ++ +      ++SAS D TI++W++ TG C+    GH+     +  N D +L+ S + D T+RVW V++ EC  EL  +  H       +P +    +L+              F++S     T+K+W++  G+ L
Sbjct:  123 MVSASEDATIKVWDYETGDFERTLK----GHTDSVQDISFDQTGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVATGYCVKTFAGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVASKECKAELR-EHEHVVECISWAPESASPTILEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCL 331          

HSP 3 Score: 62.3882 bits (150), Expect = 4.336e-10
Identity = 47/152 (30.92%), Postives = 72/152 (47.37%), Query Frame = 3
Query:  891 FVLNGHTDRVYTI--HLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLD-KFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMW-RAVVSN 1334
            + L+GH   V  +  H   +VM+SAS D TI+VWD  TG     L GH      +  +    L+ S +AD TI++W     ECI  + G   H   ++ + I+ +   IVS+    T+K+W +  G  ++       +F G   W R V  N
Sbjct:  102 YALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDQTGKLLASCSADMTIKLWDFQGFECIRTMHG---HDHNVSSVAIMPNGDHIVSASRDKTIKMWEVATGYCVK-------TFAGHREWVRMVRPN 243          
BLAST of F-box and WD repeat domain containing 7 vs. Planmine SMEST
Match: SMESG000065201.1 (SMESG000065201.1)

HSP 1 Score: 847.04 bits (2187), Expect = 0.000e+0
Identity = 425/452 (94.03%), Postives = 427/452 (94.47%), Query Frame = 3
Query:   72 MKDKPGKNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQITFLKTKEFHDLLKYGSTLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSVKSPCDY 1427
            MKDKPGKNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQITFLKTKEF+DLLKYGSTLKQQYIYYLKLFTNWQCNHEKE IRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHE                 ASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLE    GHTGAIRCVQASSV VVSGSYDCTVRVWDI TGICAFVLNGHTDRVYTIHLGATV+LSASLDTTIRVWDIHTGIC HVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSVKSPCDY
Sbjct:    1 MKDKPGKNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQITFLKTKEFYDLLKYGSTLKQQYIYYLKLFTNWQCNHEKEPIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHE-----------------ASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLE----GHTGAIRCVQASSVCVVSGSYDCTVRVWDIITGICAFVLNGHTDRVYTIHLGATVILSASLDTTIRVWDIHTGICTHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSVKSPCDY 431          
BLAST of F-box and WD repeat domain containing 7 vs. Planmine SMEST
Match: SMESG000011456.1 (SMESG000011456.1)

HSP 1 Score: 142.124 bits (357), Expect = 1.086e-36
Identity = 111/432 (25.69%), Postives = 201/432 (46.53%), Query Frame = 3
Query:   93 NYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVWTSKCRQITFLKTKEFHDLLKYGSTLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGR--CVHVFRGHENIVRCLVTV------------QIDNSN----------KPIKLISGSRDSTIRIWDVFTRK--CDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECI--LELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPG 1304
            +++  LP E+   IF + +I+ L   S V+K+W+SLS D+  +      +   KT  +       ST       Y  L    +C   ++++     ++  +  +     W       + I+   L    + R   GH     S+V   ++ +  I S SAD T+++W+        V    GH   VRCL  +            ++ N+N          + + L+SGS D TI+IW +  R      +  A+ TGH  ++RC+QA    +VSGSYD +++VW + TG     L GH D +  +    +V++S SLD TI++W +  G C+  L GH    + + ++   + ++SG+ D+T++ W +   +CI  ++ +  + H   +  +Q    KFI  S+   T+K+W++++G  L       H++ G
Sbjct:   60 DFVLQLPREICQRIFSYFDIETLTKASIVNKAWYSLSRDNWFY------MRLFKTARWVKYAYSQSTSGCNSKCYKCLENEVKCFDSEKTVFCGNDNQLNVLSV----NWYEEYKKQYQINKNWLKGRYKQRIFTGHT----SVVHCVVFSEQRIISGSADSTIKVWNLHTNAQWSVQTLPGHSEAVRCLQLLHCPDSPVNSTRSKLSNANEDLYFGLKCPRDVYLVSGSNDKTIKIWALAARNDWSSIICRATLTGHLNSVRCLQADHDKIVSGSYDGSLKVWCMATGELIRTLRGHQDAILCVQYDDSVIVSGSLDKTIKIW-LFNGECLFTLHGHVDPVACLHLDYKHNRIISGSHDNTLKFWDIRNKKCIRTIDWIESEGHKRVVRCLQADRYKFISGSD-DKTIKVWDIENGTRL-------HTYQG 468          

HSP 2 Score: 108.612 bits (270), Expect = 4.463e-25
Identity = 84/274 (30.66%), Postives = 128/274 (46.72%), Query Frame = 3
Query:  195 SLSNDDLVWTSKCRQITFLKTKEFHDLLKYGSTLKQQYIYYLKLFTNWQCNHEKESIRVSIHSKSIITG-------LIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLE-ASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDI 992
            S +N+DL +  KC +  +L +         GS  K   I+ L    +W           SI  ++ +TG       L      I S S D ++ V  + TGE IR LRGH+  +  +     Y    I S S D T+++W F  G C+    GH + V CL    +D   K  ++ISGS D+T++ WD+  +KC   ++     GH   +RC+QA     +SGS D T++VWDI  G       GH D V  +     +++S S D ++ +WD 
Sbjct:  253 SNANEDLYFGLKCPRDVYLVS---------GSNDKTIKIWALAARNDWS----------SIICRATLTGHLNSVRCLQADHDKIVSGSYDGSLKVWCMATGELIRTLRGHQDAILCVQ----YDDSVIVSGSLDKTIKIWLF-NGECLFTLHGHVDPVACL---HLDY--KHNRIISGSHDNTLKFWDIRNKKCIRTIDWIESEGHKRVVRCLQADRYKFISGSDDKTIKVWDIENGTRLHTYQGHKDGVSCLQFNNEMLVSGSYDHSVILWDF 497          
BLAST of F-box and WD repeat domain containing 7 vs. Planmine SMEST
Match: SMESG000001039.1 (SMESG000001039.1)

HSP 1 Score: 125.946 bits (315), Expect = 1.795e-31
Identity = 100/332 (30.12%), Postives = 156/332 (46.99%), Query Frame = 3
Query:  357 ESIRVSIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQID--NSNKPIK---------LISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSV--WVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQLKHSFPGAMM 1313
            E + + I  +  I  + + D +I S S D TI + D+ + E +  L+GH     SLV   I    YI SSS D T+RLW F+ G  +  FRGH   V  ++ +  D  +SN   +         L+SGS D T ++W + T +C    +    GH GAI C+   +V  ++V+GS D TVR W I TG    +  GH   V  +++   ++ S S D T+R W I  G    V  GH+   S   + + + L+ +   D   R +   TG       G   H S +   QI+ ++    S  + T+++W+L++     D L + HS     M
Sbjct:   58 ECLGICIGHEDYINCVAMQDNYIVSGSADKTIRIWDVTSFEEVALLKGHS----SLVNRLILSDEYIFSSSYDRTIRLWSFINGSFIKEFRGHSRGVYPMIFISSDTKSSNSYDRSTTYASRSLLLSGSADFTAKLWSLDTGRCLFTFK----GHQGAITCMGTDAVAKYLVTGSTDFTVRSWSIATGESLHIFEGHKGAVICMNISNKIIYSGSSDHTVRAWVIDGGNSTRVYRGHQHTVSS--VRAVKGLLFTSCGDGVARCFDAKTGALKRIFKG---HCSNINAFQIIDNRLYTVSHDT-TLRIWDLNN--LQTDPLSVAHSTKNEEM 373          

HSP 2 Score: 99.7525 bits (247), Expect = 1.629e-22
Identity = 76/258 (29.46%), Postives = 123/258 (47.67%), Query Frame = 3
Query:  555 IASSSADCTVRLWDFVE-GRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVY------------------TIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLR 1271
            I + S D T+R+W  V+   C+ +  GHE+ + C V +Q DN      ++SGS D TIRIWDV + +   LL+    GH+  +  +  S  ++ S SYD T+R+W    G       GH+  VY                  T +   +++LS S D T ++W + TG C+    GH+   + M  ++    +V+G+ D T+R W ++TGE +    G +     +     + +K I S     TV+ W +D G   R
Sbjct:   39 IVTGSEDRTIRVWSTVDYCECLGICIGHEDYINC-VAMQ-DN-----YIVSGSADKTIRIWDVTSFEEVALLK----GHSSLVNRLILSDEYIFSSSYDRTIRLWSFINGSFIKEFRGHSRGVYPMIFISSDTKSSNSYDRSTTYASRSLLLSGSADFTAKLWSLDTGRCLFTFKGHQGAITCMGTDAVAKYLVTGSTDFTVRSWSIATGESLHIFEGHKGAVICMN----ISNKIIYSGSSDHTVRAWVIDGGNSTR 281          

HSP 3 Score: 87.4261 bits (215), Expect = 2.230e-18
Identity = 69/247 (27.94%), Postives = 114/247 (46.15%), Query Frame = 3
Query:  576 CTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDE----------------SLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFL 1268
            C+ ++ +  +   + +   H + + C+ T   D+S     +++GS D TIR+W      C+ L      GH   I CV     ++VSGS D T+R+WD+ +     +L GH+  V  + L    + S+S D TIR+W    G  I    GH      M+  S +                SL++SG+AD T ++W + TG C+    G Q   + + G   V  K++V+     TV+ W++  G  L
Sbjct:    4 CSTKIDEEDDKYVISIKYDHASGINCICT-SADHS----VIVTGSEDRTIRVWSTVDY-CECL--GICIGHEDYINCVAMQDNYIVSGSADKTIRIWDVTSFEEVALLKGHSSLVNRLILSDEYIFSSSYDRTIRLWSFINGSFIKEFRGHSRGVYPMIFISSDTKSSNSYDRSTTYASRSLLLSGSADFTAKLWSLDTGRCLFTFKGHQGAITCM-GTDAVA-KYLVTGSTDFTVRSWSIATGESL 240          
BLAST of F-box and WD repeat domain containing 7 vs. Planmine SMEST
Match: SMESG000008529.1 (SMESG000008529.1)

HSP 1 Score: 107.842 bits (268), Expect = 1.856e-25
Identity = 70/243 (28.81%), Postives = 115/243 (47.33%), Query Frame = 3
Query:  561 SSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPI--KLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQ--ASSVWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLG----ATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLD---KFIVSSELSGTVKLWNLDD 1256
            + S D T ++WD   G  +    GH+N+V  +        N P   K+++GS D T ++W        H  +    GHT  + CVQ   SS  V +G  D    +WD+ +G C   L GHT  V ++  G       +++ S D T+ +WD+H G  +  L+GH +  S  V N D + V + + D +I++W +  G    +L     HT  +  + +  D   K + S+    TV+LW++ D
Sbjct:  109 TGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIA------YNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFK----GHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGA--RDLFTLAGHTDEV--LDVTFDNVGKQVASAGADNTVRLWDVKD 337          

HSP 2 Score: 90.8929 bits (224), Expect = 8.866e-20
Identity = 70/240 (29.17%), Postives = 113/240 (47.08%), Query Frame = 3
Query:  429 SCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPY---IASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSV----WVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYT--IHLGATVMLSASLDTTIRVWDIHTGI-CIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRV 1118
            + S D T  V D   G  +  L GH+  V+S+     Y  P+   I + S D T ++W   +G   H F+GH   V C   VQ + S+  +   +G  D+   +WDV + KC   L+    GHT  +  +Q         +++GS+D TV +WD+  G     L GH   +     +   T + +AS+D +I++WD+  G   +  L GH      +  ++    V S  AD+T+R+W V
Sbjct:  109 TGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIA----YNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVC---VQFNPSSTLVG--TGGMDTLAMLWDVESGKCVSNLQ----GHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDV 335          

HSP 3 Score: 77.411 bits (189), Expect = 3.143e-15
Identity = 47/155 (30.32%), Postives = 75/155 (48.39%), Query Frame = 3
Query:  831 VSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLG---ATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVSTGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLRDILQL 1286
            ++GSYD T +VWD   G   F L GH + VY+I      +  +++ S D T ++W  + G   H   GH +    +  N   +LV +G  D+   +W V +G+C+  L G  A    L   Q    K +++     TV LW++ +G   R + QL
Sbjct:  108 LTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNG---RRVSQL 259          

HSP 4 Score: 55.0694 bits (131), Expect = 5.334e-8
Identity = 49/167 (29.34%), Postives = 78/167 (46.71%), Query Frame = 3
Query:  447 TISVL-DLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSV--WVVSGSYDCTVRVWDIRT-GICAFVLNGHTDRVYTIHL 935
            T+++L D+ +G+ +  L+GH   V SL     +   ++ + S D TV LWD   GR V    GH+  +   V    D +     + + S D +I+IWD+     D    A   GHT  +  V   +V   V S   D TVR+WD++     +F+  GH   V  + +
Sbjct:  199 TLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAV-FNFDGT----YVATASMDKSIKIWDLRMGARDLFTLA---GHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVSI 357          
BLAST of F-box and WD repeat domain containing 7 vs. Planmine SMEST
Match: SMESG000052999.1 (SMESG000052999.1)

HSP 1 Score: 110.153 bits (274), Expect = 3.122e-25
Identity = 97/300 (32.33%), Postives = 140/300 (46.67%), Query Frame = 3
Query:  414 DQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWSLVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGH-ENIVRCLVTVQIDNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASSVWVVSGSYDCTVRVWDIRTGICAFV--LNGHTDRVYTIHLGATVMLSASLDTTIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVW--------RVSTGECILELLGQQAHTSPLTGIQIVLDKF-IVSSELSGTVKLWN-LDDGVFLRD 1274
            D+ I S   D +I V D  T E +R L GH G V  L     Y    I S S+D TVR+W      CV+    H E ++       I        L++ S+D +I +WD+F    D  L     GH  A+  V      +VS S D T++VW+ ++  C F+  +NGH   +  +     +++S S D TIR+W I TG C+  L GH+ L   +    D   +VSG  D  I+VW        +       L+ L Q  HT  +  +Q   D+F IVSS    T+ +W+ LD GV  +D
Sbjct:  270 DKKIVSGLRDNSIKVWDARTLECVRVLTGHVGSVLCLQ----YDNNVIISGSSDSTVRVWSLSSWTCVNTIYHHCEAVLHLRFAHSI--------LVTCSKDRSIAVWDMFA-PSDIRLRRVLVGHRAAVNVVDFDQKNIVSASGDRTIKVWNTQS--CEFLHTMNGHRRGIACLQYRNNLVVSGSSDNTIRLWQIETGTCLRTLEGHEELVRCIRF--DSKYIVSGAYDGKIKVWDLVAALNPQSPANSLCLQTLNQ--HTGRVFRLQ--FDEFQIVSSSHDDTILIWDFLDTGVVSQD 548          
The following BLAST results are available for this feature:
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FBXW79.934e-10339.78F-box and WD repeat domain containing 7 [Source:HG... [more]
FBXW74.003e-10239.78F-box and WD repeat domain containing 7 [Source:HG... [more]
FBXW77.351e-10239.78F-box and WD repeat domain containing 7 [Source:HG... [more]
FBXW77.351e-10239.78F-box and WD repeat domain containing 7 [Source:HG... [more]
FBXW77.351e-10239.78F-box and WD repeat domain containing 7 [Source:HG... [more]
back to top
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sel-103.753e-7534.09F-box/WD repeat-containing protein sel-10 [Source... [more]
sel-103.945e-7534.09F-box/WD repeat-containing protein sel-10 [Source... [more]
sel-103.945e-7534.09F-box/WD repeat-containing protein sel-10 [Source... [more]
lin-239.346e-3028.05F-box/WD repeat-containing protein lin-23 [Source... [more]
lin-239.523e-3028.05F-box/WD repeat-containing protein lin-23 [Source... [more]
back to top
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ago8.010e-9438.05gene:FBgn0041171 transcript:FBtr0073246[more]
ago8.010e-9438.05gene:FBgn0041171 transcript:FBtr0073245[more]
ago8.010e-9438.05gene:FBgn0041171 transcript:FBtr0073247[more]
Lis-14.313e-2830.13gene:FBgn0015754 transcript:FBtr0087241[more]
Lis-14.313e-2830.13gene:FBgn0015754 transcript:FBtr0304747[more]
back to top
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbxw71.351e-10340.00F-box and WD repeat domain containing 7 [Source:ZF... [more]
fbxw76.912e-10240.00F-box and WD repeat domain containing 7 [Source:ZF... [more]
AL954386.11.443e-9740.14F-box and WD repeat domain containing 7 [Source:NC... [more]
CR381538.12.433e-9739.46F-box and WD repeat domain containing 7 [Source:NC... [more]
AL954386.12.749e-9740.14F-box and WD repeat domain containing 7 [Source:NC... [more]
back to top
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000008111.16.312e-10439.78F-box and WD repeat domain containing 7 [Source:NC... [more]
ENSXETT00000008122.19.890e-10439.78F-box and WD repeat domain containing 7 [Source:NC... [more]
ENSXETT00000008142.15.475e-10339.78F-box and WD repeat domain containing 7 [Source:NC... [more]
ENSXETT00000008237.11.214e-10239.78F-box and WD repeat domain containing 7 [Source:NC... [more]
ENSXETT00000008205.19.924e-10239.78F-box and WD repeat domain containing 7 [Source:NC... [more]
back to top
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fbxw75.625e-10339.78F-box and WD-40 domain protein 7 [Source:MGI Symbo... [more]
Fbxw74.632e-10239.78F-box and WD-40 domain protein 7 [Source:MGI Symbo... [more]
Fbxw76.096e-10239.78F-box and WD-40 domain protein 7 [Source:MGI Symbo... [more]
Fbxw76.096e-10239.78F-box and WD-40 domain protein 7 [Source:MGI Symbo... [more]
Btrc7.934e-3127.15beta-transducin repeat containing protein [Source:... [more]
back to top
BLAST of F-box and WD repeat domain containing 7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|F1MNN4|FBXW7_BOVIN2.006e-10139.78F-box/WD repeat-containing protein 7 OS=Bos taurus... [more]
sp|Q969H0|FBXW7_HUMAN3.530e-10139.78F-box/WD repeat-containing protein 7 OS=Homo sapie... [more]
sp|Q8VBV4|FBXW7_MOUSE4.264e-10139.78F-box/WD repeat-containing protein 7 OS=Mus muscul... [more]
sp|D3Z902|FBXW7_RAT7.795e-10139.55F-box/WD repeat-containing protein 7 OS=Rattus nor... [more]
sp|Q9VZF4|FBXW7_DROME8.029e-9338.05F-box/WD repeat-containing protein 7 OS=Drosophila... [more]
back to top
BLAST of F-box and WD repeat domain containing 7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q3FW276.025e-10441.26Uncharacterized protein OS=Labrus bergylta OX=5672... [more]
A0A1A8JFH26.502e-10440.54F-box and WD repeat domain containing 7, E3 ubiqui... [more]
A0A1A8I2V06.916e-10440.54F-box and WD repeat domain containing 7, E3 ubiqui... [more]
A0A1A8FKX91.053e-10340.77F-box and WD repeat domain containing 7, E3 ubiqui... [more]
A0A3P8PN024.952e-10340.50Uncharacterized protein OS=Astatotilapia callipter... [more]
back to top
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbxw73.953e-10340.22F-box and WD repeat domain containing 7 [Source:NC... [more]
fbxw79.186e-10140.22F-box and WD repeat domain containing 7 [Source:NC... [more]
wdr51.297e-2830.58WD repeat domain 5 [Source:NCBI gene;Acc:103033424... [more]
pafah1b1a4.350e-2830.00lissencephaly-1 homolog A-like [Source:NCBI gene;A... [more]
fbxw11b4.611e-2826.68F-box/WD repeat-containing protein 11-like [Source... [more]
back to top
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008862.11.636e-10540.27pep scaffold:Pmarinus_7.0:GL476579:86637:114999:1 ... [more]
pafah1b1b1.849e-2930.77platelet-activating factor acetylhydrolase 1b, reg... [more]
BTRC1.430e-2526.10beta-transducin repeat containing E3 ubiquitin pro... [more]
plrg11.697e-2528.14pleiotropic regulator 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
WDR865.328e-2129.72WD repeat domain 86 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC42.837e-4630.02F-box protein required for both the G1/S and G2/M ... [more]
MET301.908e-3427.15F-box protein containing five copies of the WD40 m... [more]
TUP14.539e-2028.15General repressor of transcription; forms complex ... [more]
PRP466.568e-2028.83Member of the NineTeen Complex (NTC); this complex... [more]
SEC279.034e-2027.51Essential beta'-coat protein of the COPI coatomer;... [more]
back to top
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO423061.140e-9536.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO440938.666e-3832.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO390723.559e-3727.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO321982.491e-3327.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487202.296e-3027.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of F-box and WD repeat domain containing 7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000003546.22.701e-10440.18F-box/WD repeat-containing protein 7 [Source:NCBI ... [more]
fbxw77.694e-10440.22F-box and WD repeat domain containing 7 [Source:NC... [more]
fbxw73.403e-10240.22F-box and WD repeat domain containing 7 [Source:NC... [more]
wdr51.569e-2830.58WD repeat domain 5 [Source:NCBI gene;Acc:101166483... [more]
PAFAH1B11.727e-2829.77platelet activating factor acetylhydrolase 1b regu... [more]
back to top
BLAST of F-box and WD repeat domain containing 7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065201.10.000e+094.03SMESG000065201.1[more]
SMESG000011456.11.086e-3625.69SMESG000011456.1[more]
SMESG000001039.11.795e-3130.12SMESG000001039.1[more]
SMESG000008529.11.856e-2528.81SMESG000008529.1[more]
SMESG000052999.13.122e-2532.33SMESG000052999.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003098 ID=SMED30003098|Name=F-box and WD repeat domain containing 7|organism=Schmidtea mediterranea sexual|type=transcript|length=1490bp
CTATATAAATCTTATATGATATACAAATTTATGACTGCAATTTTTGTCTG
AATTAATATTTCTGAACTGCAATGAAAGATAAACCAGGAAAGAATTACAT
TGATCATCTTCCAACAGAATTATTTTTTCATATCTTCAAATTTATTAACA
TTAAAGATTTATTGTCCTGTTCTCAGGTATCAAAAAGTTGGCACAGTTTA
TCAAATGATGATTTGGTTTGGACAAGTAAATGCCGCCAGATTACATTCCT
AAAGACAAAGGAGTTCCATGACCTCCTAAAGTATGGTTCGACTCTCAAAC
AACAATATATCTATTATTTGAAATTATTTACGAATTGGCAATGCAATCAT
GAAAAGGAATCAATTCGGGTATCCATTCACTCCAAGTCTATCATTACCGG
ATTAATAGTATTCGATCAATGGATAGCTTCATGTTCCGATGATTGGACAA
TTTCTGTCTTGGATTTGGTTACTGGTGAAAGAATAAGGTTTCTCAGAGGT
CACGAAGGTGGTGTCTGGTCATTAGTGGCGCTTGCAATTTATCAAAAGCC
ATATATAGCATCAAGTAGTGCAGATTGTACAGTTCGATTATGGGATTTTG
TAGAAGGACGATGTGTTCATGTGTTTAGGGGTCACGAGAATATCGTCCGC
TGTTTGGTTACCGTTCAGATCGATAATTCTAATAAACCAATTAAACTTAT
TAGTGGAAGTAGGGATTCGACGATCCGGATTTGGGATGTTTTTACAAGAA
AGTGTGATCACTTGTTAGAAGCATCACCCACAGGTCATACCGGTGCGATA
CGCTGCGTACAAGCTAGCTCAGTTTGGGTAGTTTCTGGTAGTTATGACTG
CACCGTTCGAGTGTGGGATATCAGAACTGGAATTTGTGCATTTGTATTGA
ATGGCCACACTGATCGAGTATATACAATCCATTTGGGTGCCACTGTCATG
CTGTCCGCTAGCCTCGACACGACAATCCGAGTCTGGGACATTCACACAGG
GATTTGCATTCATGTTCTAGTTGGTCATAAATCGTTGACATCTGGGATGG
TTATGAACAGTGATGAGTCACTGGTCGTCAGTGGCAACGCGGACAGCACA
ATAAGGGTGTGGCGGGTGAGCACCGGGGAATGTATATTGGAACTACTGGG
ACAACAAGCGCACACATCACCATTGACTGGCATTCAGATCGTATTGGATA
AATTCATTGTCAGCTCAGAACTGAGTGGCACTGTCAAATTATGGAATCTC
GATGACGGAGTGTTTCTCAGAGACATTCTTCAGTTGAAGCACTCATTTCC
TGGAGCAATGATGTGGCGGGCGGTGGTCAGCAATACGCATTTGGTTTGTG
CTGTTGGCACCGGCAATCGATTGGACTTTTCCAAGCTTTACATATTTGAT
TTTTCGGTGAAGTCTCCCTGTGACTATTGACTGACCTATGTTGATTGTGA
TTGTGATTTATATTTTTGACATAAATAATAAATATTCGAC
back to top

protein sequence of SMED30003098-orf-1

>SMED30003098-orf-1 ID=SMED30003098-orf-1|Name=SMED30003098-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=453bp
MKDKPGKNYIDHLPTELFFHIFKFINIKDLLSCSQVSKSWHSLSNDDLVW
TSKCRQITFLKTKEFHDLLKYGSTLKQQYIYYLKLFTNWQCNHEKESIRV
SIHSKSIITGLIVFDQWIASCSDDWTISVLDLVTGERIRFLRGHEGGVWS
LVALAIYQKPYIASSSADCTVRLWDFVEGRCVHVFRGHENIVRCLVTVQI
DNSNKPIKLISGSRDSTIRIWDVFTRKCDHLLEASPTGHTGAIRCVQASS
VWVVSGSYDCTVRVWDIRTGICAFVLNGHTDRVYTIHLGATVMLSASLDT
TIRVWDIHTGICIHVLVGHKSLTSGMVMNSDESLVVSGNADSTIRVWRVS
TGECILELLGQQAHTSPLTGIQIVLDKFIVSSELSGTVKLWNLDDGVFLR
DILQLKHSFPGAMMWRAVVSNTHLVCAVGTGNRLDFSKLYIFDFSVKSPC
DY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0001525angiogenesis
GO:0031641regulation of myelination
GO:0031642negative regulation of myelination
GO:0032006regulation of TOR signaling
GO:0045746negative regulation of Notch signaling pathway
GO:0001570vasculogenesis
GO:0016567protein ubiquitination
GO:0030324lung development
GO:0031146SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
GO:0031398positive regulation of protein ubiquitination
GO:0031648protein destabilization
GO:0032876negative regulation of DNA endoreduplication
GO:0034644cellular response to UV
GO:0045741positive regulation of epidermal growth factor-activated receptor activity
GO:0050821protein stabilization
GO:0051443positive regulation of ubiquitin-protein transferase activity
GO:0070374positive regulation of ERK1 and ERK2 cascade
GO:0090049regulation of cell migration involved in sprouting angiogenesis
GO:1901800positive regulation of proteasomal protein catabolic process
GO:1903026negative regulation of RNA polymerase II regulatory region sequence-specific DNA binding
GO:1903146regulation of mitophagy
GO:1903378positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway
GO:1903955positive regulation of protein targeting to mitochondrion
GO:2000060positive regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process
GO:0006355regulation of transcription, DNA-templated
GO:0006974cellular response to DNA damage stimulus
GO:0007062sister chromatid cohesion
GO:0007219Notch signaling pathway
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000025nervous system
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR036047F-box-like_dom_sf
IPR036322WD40_repeat_dom_sf
IPR020472G-protein_beta_WD-40_rep
IPR001810F-box_dom
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: cellular component
TermDefinition
GO:0048471perinuclear region of cytoplasm
GO:0019005SCF ubiquitin ligase complex
GO:0043234protein complex
GO:1990452Parkin-FBXW7-Cul1 ubiquitin ligase complex
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005730nucleolus
GO:0005737cytoplasm
GO:0005739mitochondrion
GO:0005783endoplasmic reticulum
GO:0005794Golgi apparatus
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0004842ubiquitin-protein transferase activity
GO:0030332cyclin binding
GO:0030674protein binding, bridging
GO:0031625ubiquitin protein ligase binding
GO:0042802identical protein binding
GO:0050816phosphothreonine binding
GO:0097027ubiquitin-protein transferase activator activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020472G-protein beta WD-40 repeatPRINTSPR00320GPROTEINBRPTcoord: 253..267
score: 43.2
coord: 209..223
score: 43.6
coord: 293..307
score: 36.63
IPR001810F-box domainSMARTSM00256fbox_2coord: 13..53
e-value: 4.8E-9
score: 46.1
IPR001810F-box domainPFAMPF12937F-box-likecoord: 10..55
e-value: 2.0E-12
score: 46.8
IPR001810F-box domainPROSITEPS50181FBOXcoord: 7..53
score: 13.737
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 94..131
e-value: 8.5
score: 11.1
coord: 225..266
e-value: 3.4E-6
score: 36.6
coord: 178..222
e-value: 1.3E-5
score: 34.7
coord: 309..348
e-value: 1.8E-4
score: 30.8
coord: 134..175
e-value: 9.9E-6
score: 35.0
coord: 351..392
e-value: 0.1
score: 21.7
coord: 269..306
e-value: 1.5E-4
score: 31.1
IPR001680WD40 repeatPFAMPF00400WD40coord: 312..347
e-value: 0.0013
score: 19.5
coord: 179..222
e-value: 1.9E-7
score: 31.7
coord: 272..306
e-value: 0.032
score: 15.1
coord: 136..175
e-value: 4.5E-4
score: 21.0
coord: 235..266
e-value: 3.5E-5
score: 24.5
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 141..184
score: 10.174
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 316..357
score: 13.75
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 276..315
score: 12.58
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 236..267
score: 10.241
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 209..223
score: 10.007
NoneNo IPR availableGENE3DG3DSA:1.20.1280.50coord: 1..90
e-value: 2.5E-18
score: 67.8
NoneNo IPR availablePANTHERPTHR44129FAMILY NOT NAMEDcoord: 7..446
NoneNo IPR availablePANTHERPTHR44129:SF9coord: 7..446
NoneNo IPR availableCDDcd00200WD40coord: 116..392
e-value: 4.58923E-61
score: 198.713
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 94..449
e-value: 6.9E-81
score: 273.5
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 293..307
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 209..223
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 162..176
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 253..267
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 100..401
score: 47.484
IPR036047F-box-like domain superfamilySUPERFAMILYSSF81383F-box domaincoord: 4..74
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 105..429