Protein regulator of cytokinesis 1

Overview
NameProtein regulator of cytokinesis 1
Smed IDSMED30003095
Length (bp)1942
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein regulator of cytokinesis 1 (SMED30003095) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein regulator of cytokinesis 1 (SMED30003095) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein regulator of cytokinesis 1 (SMED30003095) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein regulator of cytokinesis 1 (SMED30003095) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003095

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30003095h1SMcG0021017 Contig29213newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003095h1SMcG0021017 Contig29213uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30003095h1SMcG0021017 dd_Smed_v4_5754_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003095h1SMcG0021017 dd_Smed_v4_5754_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30003095h1SMcG0021017 dd_Smed_v4_5754_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003095h1SMcG0021017 dd_Smed_v4_5754_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003095h1SMcG0021017 dd_Smed_v4_5754_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Human
Match: PRC1 (protein regulator of cytokinesis 1 [Source:HGNC Symbol;Acc:HGNC:9341])

HSP 1 Score: 95.5153 bits (236), Expect = 7.242e-20
Identity = 117/471 (24.84%), Postives = 215/471 (45.65%), Query Frame = 2
Query:  224 ISSCDKRFHELSVIWDYIGYESSDKEKRIEEITNAFGEMLDGIIMKENQLRLEIESDIENKKREITQLCQQLKIPTYFPPRDLTSYNLLKVLKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLINDSEQCQKMKENIKNPDSDDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFDDLPKSNETVNLSEKLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKEFMQQCSGYKPDVLELLQEEVSKCQQMKWENISVYYSGXXXXXXXXXXXXXXSSVVKDXXXXXXXX--XXXXXXXXXXXIDQLKEKYEKYQTLYDTVANYQNLWMTYLDVESQMKDPAILSNRGGIXXXXXXXXXXXXXXXXXXXAIVAEAIAQYEKNNKTKFYVWNNLTFKDYVQHLWTEFRNRKDSAKYRR 1630
            I    K  + L  IW+ IG     + +R E +     E+LD +I +E  L+  +   I   ++E+  LC +L +  +    + T   L K L+ + + ++  + ER+Q             KL+      EQ Q++ E +  P  D   I    +P+  E+  FRQ++T+L        +++ S+   +      ++++ ++ FER ++ E +D               ++ E +  +Q L  ++  +K+   + CE LR+ +  +W RL I E+ ++      SG K  V + LQ EV + +++K +N+      +  E  +   +   S   +       +   +E  +   + EI +LK  YE ++ L++ V  ++  W  +L+ E +  DP   +NRGG LLK EK++ +L K LPK E  +   I  +E+ +   F V N   F +YV   W   R  K+ AK  R
Sbjct:   12 IVCLQKALNHLREIWELIGIPEDQRLQRTEVVKKHIKELLDMMIAEEESLKERLIKSISVCQKELNTLCSELHVEPFQEEGETTILQLEKDLRTQVELMRKQKKERKQEL-----------KLL-----QEQDQELCEILCMPHYD---IDSASVPSLEELNQFRQHVTTLRETKASRREEFVSIKRQIILCMEALDHTPDTSFERDVVCEDED------------AFCLSLENIATLQKLLRQLEMQKSQNEAVCEGLRTQIRELWDRLQIPEEEREAVATIMSGSKAKVRKALQLEVDRLEELKMQNMKKVIEAIRVELVQYWDQCFYSQEQRQAFAPFCAEDYTESLLQLHDAEIVRLKNYYEVHKELFEGVQKWEETWRLFLEFERKASDPNRFTNRGGNLLKEEKQRAKLQKMLPKLEEELKARIELWEQEHSKAFMV-NGQKFMEYVAEQWEMHRLEKERAKQER 450          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Human
Match: PRC1 (protein regulator of cytokinesis 1 [Source:HGNC Symbol;Acc:HGNC:9341])

HSP 1 Score: 95.1301 bits (235), Expect = 8.577e-20
Identity = 117/471 (24.84%), Postives = 215/471 (45.65%), Query Frame = 2
Query:  224 ISSCDKRFHELSVIWDYIGYESSDKEKRIEEITNAFGEMLDGIIMKENQLRLEIESDIENKKREITQLCQQLKIPTYFPPRDLTSYNLLKVLKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLINDSEQCQKMKENIKNPDSDDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFDDLPKSNETVNLSEKLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKEFMQQCSGYKPDVLELLQEEVSKCQQMKWENISVYYSGXXXXXXXXXXXXXXSSVVKDXXXXXXXX--XXXXXXXXXXXIDQLKEKYEKYQTLYDTVANYQNLWMTYLDVESQMKDPAILSNRGGIXXXXXXXXXXXXXXXXXXXAIVAEAIAQYEKNNKTKFYVWNNLTFKDYVQHLWTEFRNRKDSAKYRR 1630
            I    K  + L  IW+ IG     + +R E +     E+LD +I +E  L+  +   I   ++E+  LC +L +  +    + T   L K L+ + + ++  + ER+Q             KL+      EQ Q++ E +  P  D   I    +P+  E+  FRQ++T+L        +++ S+   +      ++++ ++ FER ++ E +D               ++ E +  +Q L  ++  +K+   + CE LR+ +  +W RL I E+ ++      SG K  V + LQ EV + +++K +N+      +  E  +   +   S   +       +   +E  +   + EI +LK  YE ++ L++ V  ++  W  +L+ E +  DP   +NRGG LLK EK++ +L K LPK E  +   I  +E+ +   F V N   F +YV   W   R  K+ AK  R
Sbjct:   12 IVCLQKALNHLREIWELIGIPEDQRLQRTEVVKKHIKELLDMMIAEEESLKERLIKSISVCQKELNTLCSELHVEPFQEEGETTILQLEKDLRTQVELMRKQKKERKQEL-----------KLL-----QEQDQELCEILCMPHYD---IDSASVPSLEELNQFRQHVTTLRETKASRREEFVSIKRQIILCMEALDHTPDTSFERDVVCEDED------------AFCLSLENIATLQKLLRQLEMQKSQNEAVCEGLRTQIRELWDRLQIPEEEREAVATIMSGSKAKVRKALQLEVDRLEELKMQNMKKVIEAIRVELVQYWDQCFYSQEQRQAFAPFCAEDYTESLLQLHDAEIVRLKNYYEVHKELFEGVQKWEETWRLFLEFERKASDPNRFTNRGGNLLKEEKQRAKLQKMLPKLEEELKARIELWEQEHSKAFMV-NGQKFMEYVAEQWEMHRLEKERAKQER 450          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Human
Match: PRC1 (protein regulator of cytokinesis 1 [Source:HGNC Symbol;Acc:HGNC:9341])

HSP 1 Score: 71.633 bits (174), Expect = 1.825e-12
Identity = 88/341 (25.81%), Postives = 161/341 (47.21%), Query Frame = 2
Query:  614 EQCQKMKENIKNPDSDDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFDDLPKSNETVNLSEKLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKEFMQQCSGYKPDVLELLQEEVSKCQQMKWENISVYYSGXXXXXXXXXXXXXXSSVVKDXXXXXXXX--XXXXXXXXXXXIDQLKEKYEKYQTLYDTVANYQNLWMTYLDVESQMKDPAILSNRGGIXXXXXXXXXXXXXXXXXXXAIVAEAIAQYEKNNKTKFYVWNNLTFKDYVQHLWTEFRNRKDSAKYRR 1630
            EQ Q++ E +  P  D   I    +P+  E+  FRQ++T+L        +++ S+   +      ++++ ++ FER ++ E +D               ++ E +  +Q L  ++  +K+   + CE LR+ +  +W RL I E+ ++      SG K  V + LQ EV + +++K +N+      +  E  +   +   S   +       +   +E  +   + EI +LK  YE ++ L++ V  ++  W  +L+ E +  DP   +NRGG LLK EK++ +L K LPK E  +   I  +E+ +   F V N   F +YV   W   R  K+ AK  R
Sbjct:   85 EQDQELCEILCMPHYD---IDSASVPSLEELNQFRQHVTTLRETKASRREEFVSIKRQIILCMEALDHTPDTSFERDVVCEDED------------AFCLSLENIATLQKLLRQLEMQKSQNEAVCEGLRTQIRELWDRLQIPEEEREAVATIMSGSKAKVRKALQLEVDRLEELKMQNMKKVIEAIRVELVQYWDQCFYSQEQRQAFAPFCAEDYTESLLQLHDAEIVRLKNYYEVHKELFEGVQKWEETWRLFLEFERKASDPNRFTNRGGNLLKEEKQRAKLQKMLPKLEEELKARIELWEQEHSKAFMV-NGQKFMEYVAEQWEMHRLEKERAKQER 409          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Fly
Match: sofe (gene:FBgn0030242 transcript:FBtr0346273)

HSP 1 Score: 52.7582 bits (125), Expect = 9.618e-7
Identity = 59/256 (23.05%), Postives = 117/256 (45.70%), Query Frame = 2
Query:  665 ISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFDDLPKSNETVNLSEKLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKEFMQQCSGYKPDVLELLQEEVSKCQQMKWENISVYYSGXXXXXXXXXXXXXXSSVVKDXXXX--XXXXXXXXXXXXXXXIDQLKEKYEKYQTLYDTVANYQNLWMTYLDVESQMKDPAILSNRGG 1426
            +S+  + LP   E++ FR++L  L     + L     L  ++ R    +E    +D E+ +L   +        V L E   +  E  D++Q+L           +   +E+R  +  +W RL + ++     +++ + Y     ++L+EE+ +CQ M+ +N+  +   L  E  E     L S+  +    +   ++ +E+ +   E+E+D LKE Y   + +++  AN   LW     +E++  DP   +NRGG
Sbjct:  140 LSLLADPLPLPEEMDPFREHLAQLRDQRVQRLRDMDELRQNIKRNIKLLELQLRTDSEKRLLNADNHKLTPYAYVRLQE---MDKEFADQVQDL-----------IDRIDEMRGKIECLWQRLRMTDEYAMRRVREATSYNQCTYDILREELERCQAMRQQNLIAFIEQLRIEINEWWDLSLKSTEERRRFTTYYCDTQTEDVLEQFEKELDNLKEFYNSNRKIFELYANRGELWTRMEALEAKANDPNRFNNRGG 381          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Fly
Match: sofe (gene:FBgn0030242 transcript:FBtr0073409)

HSP 1 Score: 52.7582 bits (125), Expect = 9.618e-7
Identity = 59/256 (23.05%), Postives = 117/256 (45.70%), Query Frame = 2
Query:  665 ISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFDDLPKSNETVNLSEKLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKEFMQQCSGYKPDVLELLQEEVSKCQQMKWENISVYYSGXXXXXXXXXXXXXXSSVVKDXXXX--XXXXXXXXXXXXXXXIDQLKEKYEKYQTLYDTVANYQNLWMTYLDVESQMKDPAILSNRGG 1426
            +S+  + LP   E++ FR++L  L     + L     L  ++ R    +E    +D E+ +L   +        V L E   +  E  D++Q+L           +   +E+R  +  +W RL + ++     +++ + Y     ++L+EE+ +CQ M+ +N+  +   L  E  E     L S+  +    +   ++ +E+ +   E+E+D LKE Y   + +++  AN   LW     +E++  DP   +NRGG
Sbjct:  140 LSLLADPLPLPEEMDPFREHLAQLRDQRVQRLRDMDELRQNIKRNIKLLELQLRTDSEKRLLNADNHKLTPYAYVRLQE---MDKEFADQVQDL-----------IDRIDEMRGKIECLWQRLRMTDEYAMRRVREATSYNQCTYDILREELERCQAMRQQNLIAFIEQLRIEINEWWDLSLKSTEERRRFTTYYCDTQTEDVLEQFEKELDNLKEFYNSNRKIFELYANRGELWTRMEALEAKANDPNRFNNRGG 381          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Zebrafish
Match: prc1b (protein regulator of cytokinesis 1b [Source:ZFIN;Acc:ZDB-GENE-040426-777])

HSP 1 Score: 92.0485 bits (227), Expect = 5.540e-19
Identity = 112/485 (23.09%), Postives = 212/485 (43.71%), Query Frame = 2
Query:  224 ISSCDKRFHELSVIWDYIGYESSDKEKRIEEITNAFGEMLDGIIMKENQLRLEIESDIENKKREITQLCQQLKIPTYFPPRDLTSYNLLKVLKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLINDSEQCQKMKENIKNPDSDDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFDDLPKSNETVNLSEKLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKEFMQQCSGYKPDVLELLQEEVSKCQQMKWEN-----------ISVY-----YSGXXXXXXXXXXXXXXSSVVKDXXXXXXXXXXXXXXXXXXXIDQLKEKYEKYQTLYDTVANYQNLWMTYLDVESQMKDPAILSNRGGIXXXXXXXXXXXXXXXXXXXAIVAEAIAQYEKNNKTKFYVWNNLTFKDYVQHLWTEFRNRKDSAKYRR 1630
            ++  +K    L  IW+ IG     + +R   + N    +LD +I +E  LR  + + IE   +E+++LC +L+ P +   +  T     K L+   + +   + +R Q+   + +   +L  L+                    S   SI    +P+  ++E F Q+++ L ++ +    ++ +L   +     D++   E+ FE+ ++ E +            E   ++ E +D ++ L  ++  RKA     C   R  +L +W RL I ++ +    +  +  K   +E LQ EV + +++K +N           I+VY     YS    +          S  +              +S  + EI QLK+ YE ++ L++ V  ++  W  ++++E + KDP+  +NRGG LLK EK++  ++K LPK E  +   I Q+E     +F V N   F  +V   W  +R  K+  K  R
Sbjct:   13 VACLNKALCHLKDIWEEIGIPEDQRLERTNVVKNHVKGLLDMMIAEEESLRKRLMTSIEKCHKELSKLCLELQSPPFQEEKSGTMLQREKELRTHVEVMLKEKNQRMQALKALTEQDQDLCDLLC-------------------SQPFSISPGCVPSMEQLENFHQHISCLTAEKERRHKEFVTLKKQIILCMDDLDQLPETSFEKDVVCEDE------------ESFCLSKENIDSLKVLLQQLENRKAENKRVCGSYREKILELWKRLQIPQEERDVISEHMTLSKKRNMEALQVEVKRLEELKLKNMQNVTETLRKEIAVYWEKCFYSADQRQAFMPYYDDDFSEEL--------------LSLHDAEIVQLKQYYEDHKELFEGVHKWEENWRLFIELEERAKDPSRFTNRGGNLLKEEKQRADIVKGLPKLEKKLKAEIEQWELEQNREFQV-NGQKFMQFVSDQWELYRLEKEREKQER 451          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Zebrafish
Match: prc1a (protein regulator of cytokinesis 1a [Source:ZFIN;Acc:ZDB-GENE-020801-3])

HSP 1 Score: 83.9593 bits (206), Expect = 1.731e-16
Identity = 112/471 (23.78%), Postives = 218/471 (46.28%), Query Frame = 2
Query:  224 ISSCDKRFHELSVIWDYIGYESSDKEKRIEEITNAFGEMLDGIIMKENQLRLEIESDIENKKREITQLCQQLKIPTYFPPRDLTSYNLLKVLKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLINDSEQCQKMKENIKNPDSDDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFDDLPKSNETVNLSEKLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKEFMQQCSGYKPDVLELLQEEVSKCQQMKWENISVYYSGXXXXXXXXXXXXXXSSVVKDX--XXXXXXXXXXXXXXXXXXIDQLKEKYEKYQTLYDTVANYQNLWMTYLDVESQMKDPAILSNRGGIXXXXXXXXXXXXXXXXXXXAIVAEAIAQYEKNNKTKFYVWNNLTFKDYVQHLWTEFRNRKDSAKYRR 1630
            +SS +K  ++L  IW+ IG     + +R + +      +LD +I +E  L+  + + IE  + E++ LC +L++  +     LT   L K L+ + K +   ++ RQ           EL+ L+    D + C  + E++         I  E +P++ +++ +RQ++ +   + +    ++  +   +  +  D+E S ++ FE+  + E +D               ++ E +  ++ L  ++  RKA   +    +++ +  +W  L I  + +   M          L  LQ E  + + +K +NI      +  E  +  +K   S   +     F  + L ++ +   EQE+++LK+ Y +Y+ LYD V+ + + W  Y ++E +  DP+  +NRGG LLK EK++  L K LPK E  +   I Q+E     +F V N   F  YV+  W+  R +K+  K  R
Sbjct:   12 VSSLNKALNQLKDIWEEIGIPEDQRLQRTDAVHMHIKNLLDMMIAEEEGLKKRLLTSIEACRNEVSSLCDELQLQEFQEEDGLTMLQLEKDLRTQVKLMLKEKSSRQ----------TELKSLIQ--QDQDLCDVLCEDL-------FPIHPERVPSQQQLQNYRQHINTRNQEKERRHAEFVEMKRQITVLMEDLEQSPDTTFEKDAVCEDED------------AFCLSVENISSLKVLLRQLETRKAESEALSVSIQARIEELWEMLEIPLEERDGLMLHTHSSTKSRLNALQAEFQRMEGLKKKNIERVIRTIRSEIVKFWEKCYFSQEQRRAFLPFHSDDLDDDLLREHEQELERLKQNYTEYKELYDAVSTWSSNWTLYQELEKKATDPSRFNNRGGNLLKEEKQRVDLQKSLPKLEKSLKAQIDQWEAAQCKEFRV-NGQQFLQYVEEQWSHHRMQKEMEKQER 450          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Zebrafish
Match: prc1a (protein regulator of cytokinesis 1a [Source:ZFIN;Acc:ZDB-GENE-020801-3])

HSP 1 Score: 83.9593 bits (206), Expect = 2.140e-16
Identity = 112/471 (23.78%), Postives = 218/471 (46.28%), Query Frame = 2
Query:  224 ISSCDKRFHELSVIWDYIGYESSDKEKRIEEITNAFGEMLDGIIMKENQLRLEIESDIENKKREITQLCQQLKIPTYFPPRDLTSYNLLKVLKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLINDSEQCQKMKENIKNPDSDDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFDDLPKSNETVNLSEKLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKEFMQQCSGYKPDVLELLQEEVSKCQQMKWENISVYYSGXXXXXXXXXXXXXXSSVVKDX--XXXXXXXXXXXXXXXXXXIDQLKEKYEKYQTLYDTVANYQNLWMTYLDVESQMKDPAILSNRGGIXXXXXXXXXXXXXXXXXXXAIVAEAIAQYEKNNKTKFYVWNNLTFKDYVQHLWTEFRNRKDSAKYRR 1630
            +SS +K  ++L  IW+ IG     + +R + +      +LD +I +E  L+  + + IE  + E++ LC +L++  +     LT   L K L+ + K +   ++ RQ           EL+ L+    D + C  + E++         I  E +P++ +++ +RQ++ +   + +    ++  +   +  +  D+E S ++ FE+  + E +D               ++ E +  ++ L  ++  RKA   +    +++ +  +W  L I  + +   M          L  LQ E  + + +K +NI      +  E  +  +K   S   +     F  + L ++ +   EQE+++LK+ Y +Y+ LYD V+ + + W  Y ++E +  DP+  +NRGG LLK EK++  L K LPK E  +   I Q+E     +F V N   F  YV+  W+  R +K+  K  R
Sbjct:   12 VSSLNKALNQLKDIWEEIGIPEDQRLQRTDAVHMHIKNLLDMMIAEEEGLKKRLLTSIEACRNEVSSLCDELQLQEFQEEDGLTMLQLEKDLRTQVKLMLKEKSSRQ----------TELKSLIQ--QDQDLCDVLCEDL-------FPIHPERVPSQQQLQNYRQHINTRNQEKERRHAEFVEMKRQITVLMEDLEQSPDTTFEKDAVCEDED------------AFCLSVENISSLKVLLRQLETRKAESEALSVSIQARIEELWEMLEIPLEERDGLMLHTHSSTKSRLNALQAEFQRMEGLKKKNIERVIRTIRSEIVKFWEKCYFSQEQRRAFLPFHSDDLDDDLLREHEQELERLKQNYTEYKELYDAVSTWSSNWTLYQELEKKATDPSRFNNRGGNLLKEEKQRVDLQKSLPKLEKSLKAQIDQWEAAQCKEFRV-NGQQFLQYVEEQWSHHRMQKEMEKQER 450          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Xenopus
Match: prc1 (protein regulator of cytokinesis 1 [Source:NCBI gene;Acc:100216075])

HSP 1 Score: 99.7525 bits (247), Expect = 2.294e-21
Identity = 119/497 (23.94%), Postives = 226/497 (45.47%), Query Frame = 2
Query:  224 ISSCDKRFHELSVIWDYIGYESSDKEKRIEEITNAFGEMLDGIIMKENQLRLEIESDIENKKREITQLCQQLKIPTYFPPRDLTSYNLLKVLKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLINDSEQCQKMKENIKNPDSDDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFDDLPKSNETVNLSEKLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKEFMQQCSGYKPDVLELLQEEVSKCQQMKWENISVYYSGXXXXXXXXXXXXXXSSVVKDXXXXXXXX--XXXXXXXXXXXIDQLKEKYEKYQTLYDTVANYQNLWMTYLDVESQMKDPAILSNRGGIXXXXXXXXXXXXXXXXXXXAIVAEAIAQYEKNNKTKFYVWNNLTFKDYVQHLWTEFRNRKDSAKYRRPGP--------GSQSVTNSPKRVTSP 1684
            ++  +     L  IW+ IG     + +R + +      +L  +I +E  L+  +   I+  ++E+  LC +L++P +    + T   L K L+ + + +   + ER          + EL+ L     D + C  +     +P   D +     +P+  E++ FR++L  L ++ +    ++ S    +     +++   ++ FER ++ E +            E   ++ E L  +Q L +++ ++K      CEELRS +  +W RL I E+ +  F +  +G K   ++ LQEE  + Q++K +NI      +  E      K   S+  +       S   +E+ +   + EI ++K+ YE ++ ++D V  ++  W  +L+ + +  DP   +NRGG LLK EK++ +L K LPK E  +  +I  +E+  + +F+V N   F DYV   W  F   K+  K  R           GS   T + +RV  P
Sbjct:   12 VACLNSALARLRDIWEEIGIPEDQRLQRTDAVKRHVNLLLTRMIEEEENLKQRLLKSIDVCRKELNTLCMELQLPPFEEEEESTILQLEKDLRTRVEVMLKQKKER----------MHELKLLKE--RDQDLCDIL---CTSPYHIDGAC----VPSLQELDQFRRHLAGLSAEKEHREAEFKSTKKQIILCMEELDRLPDTSFERDVVCEDE------------EAFCLSKENLTALQELLIQLEEQKMKNQVLCEELRSKITELWERLQISEEERDAFGEYMTGSKGKTIKALQEEFDRLQELKLQNIKRIVEAIRLEISSYWDKCFYSAAQRQAFVPFSSEDYNEDLLCIHDAEISRIKQYYESHKEMFDGVQKWEENWRLFLEFDKKATDPNRFTNRGGNLLKEEKQRAKLQKMLPKLEEELKTSIIAWEQEQEQEFFV-NEKKFMDYVAEQWETFHQDKEREKQERKNRQLEEEMYYGSAPKTPNKRRVPGP 476          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Xenopus
Match: prc1 (protein regulator of cytokinesis 1 [Source:NCBI gene;Acc:100216075])

HSP 1 Score: 98.2117 bits (243), Expect = 8.070e-21
Identity = 114/497 (22.94%), Postives = 221/497 (44.47%), Query Frame = 2
Query:  224 ISSCDKRFHELSVIWDYIGYESSDKEKRIEEITNAFGEMLDGIIMKENQLRLEIESDIENKKREITQLCQQLKIPTYFPPRDLTSYNLLKVLKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLINDSEQCQKMKENIKNPDSDDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFDDLPKSNETVNLSEKLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKEFMQQCSGYKPDVLELLQEEVSKCQQMKWENISVYYSGXXXXXXXXXXXXXXSSVVKDXXXXXXXX--XXXXXXXXXXXIDQLKEKYEKYQTLYDTVANYQNLWMTYLDVESQMKDPAILSNRGGIXXXXXXXXXXXXXXXXXXXAIVAEAIAQYEKNNKTKFYVWNNLTFKDYVQHLWTEFRNRKDSAKYRRPGP--------GSQSVTNSPKRVTSP 1684
            ++  +     L  IW+ IG     + +R + +      +L  +I +E  L+  +   I+  ++E+  LC +L++P +    + T   L K L+ + + +   + ER      + +   +L  ++                    +    I    +P+  E++ FR++L  L ++ +    ++ S    +     +++   ++ FER ++ E +            E   ++ E L  +Q L +++ ++K      CEELRS +  +W RL I E+ +  F +  +G K   ++ LQEE  + Q++K +NI      +  E      K   S+  +       S   +E+ +   + EI ++K+ YE ++ ++D V  ++  W  +L+ + +  DP   +NRGG LLK EK++ +L K LPK E  +  +I  +E+  + +F+V N   F DYV   W  F   K+  K  R           GS   T + +RV  P
Sbjct:   12 VACLNSALARLRDIWEEIGIPEDQRLQRTDAVKRHVNLLLTRMIEEEENLKQRLLKSIDVCRKELNTLCMELQLPPFEEEEESTILQLEKDLRTRVEVMLKQKKERMHELKLLKERDQDLCDILC-------------------TSPYHIDGACVPSLQELDQFRRHLAGLSAEKEHREAEFKSTKKQIILCMEELDRLPDTSFERDVVCEDE------------EAFCLSKENLTALQELLIQLEEQKMKNQVLCEELRSKITELWERLQISEEERDAFGEYMTGSKGKTIKALQEEFDRLQELKLQNIKRIVEAIRLEISSYWDKCFYSAAQRQAFVPFSSEDYNEDLLCIHDAEISRIKQYYESHKEMFDGVQKWEENWRLFLEFDKKATDPNRFTNRGGNLLKEEKQRAKLQKMLPKLEEELKTSIIAWEQEQEQEFFV-NEKKFMDYVAEQWETFHQDKEREKQERKNRQLEEEMYYGSAPKTPNKRRVPGP 476          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Xenopus
Match: prc1 (protein regulator of cytokinesis 1 [Source:NCBI gene;Acc:100216075])

HSP 1 Score: 97.8265 bits (242), Expect = 1.119e-20
Identity = 119/500 (23.80%), Postives = 226/500 (45.20%), Query Frame = 2
Query:  224 ISSCDKRFHELSVIWDYIGYESSDKEKRIEEITNAFGEMLDGIIMKENQLRLEIESDIENKKREITQLCQQLKIPTYFPPRDLTSYNLLKVLKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLINDSEQCQKMKENIKNPDSDDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFDDLPKSNETVNLSEKLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKEFMQQCSGYKPDVLELLQEEVSKCQQMKWENISVYYSGXXXXXXXXXXXXXXSSVVKDXXXXXXXX--XXXXXXXXXXXIDQLKEKYEKYQTLYDTVANYQNLWMTYLDVESQMKDPAILSNRGGIXXXXXXXXXXXXXXXXXXXAIVAEAIAQYEKNNKTKFYVWNNLTFKDYVQHLWTEFRNRKDSAKYRRPGP-----------GSQSVTNSPKRVTSP 1684
            ++  +     L  IW+ IG     + +R + +      +L  +I +E  L+  +   I+  ++E+  LC +L++P +    + T   L K L+ + + +   + ER          + EL+ L     D + C  +     +P   D +     +P+  E++ FR++L  L ++ +    ++ S    +     +++   ++ FER ++ E +            E   ++ E L  +Q L +++ ++K      CEELRS +  +W RL I E+ +  F +  +G K   ++ LQEE  + Q++K +NI      +  E      K   S+  +       S   +E+ +   + EI ++K+ YE ++ ++D V  ++  W  +L+ + +  DP   +NRGG LLK EK++ +L K LPK E  +  +I  +E+  + +F+V N   F DYV   W  F   K+  K  R              GS   T + +RV  P
Sbjct:   16 VACLNSALARLRDIWEEIGIPEDQRLQRTDAVKRHVNLLLTRMIEEEENLKQRLLKSIDVCRKELNTLCMELQLPPFEEEEESTILQLEKDLRTRVEVMLKQKKER----------MHELKLLKE--RDQDLCDIL---CTSPYHIDGAC----VPSLQELDQFRRHLAGLSAEKEHREAEFKSTKKQIILCMEELDRLPDTSFERDVVCEDE------------EAFCLSKENLTALQELLIQLEEQKMKNQVLCEELRSKITELWERLQISEEERDAFGEYMTGSKGKTIKALQEEFDRLQELKLQNIKRIVEAIRLEISSYWDKCFYSAAQRQAFVPFSSEDYNEDLLCIHDAEISRIKQYYESHKEMFDGVQKWEENWRLFLEFDKKATDPNRFTNRGGNLLKEEKQRAKLQKMLPKLEEELKTSIIAWEQEQEQEFFV-NEKKFMDYVAEQWETFHQDKEREKQERLMKKNRQLEEEMYYGSAPKTPNKRRVPGP 483          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Xenopus
Match: prc1 (protein regulator of cytokinesis 1 [Source:NCBI gene;Acc:100216075])

HSP 1 Score: 96.2857 bits (238), Expect = 3.900e-20
Identity = 119/500 (23.80%), Postives = 226/500 (45.20%), Query Frame = 2
Query:  224 ISSCDKRFHELSVIWDYIGYESSDKEKRIEEITNAFGEMLDGIIMKENQLRLEIESDIENKKREITQLCQQLKIPTYFPPRDLTSYNLLKVLKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLINDSEQCQKMKENIKNPDSDDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFDDLPKSNETVNLSEKLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKEFMQQCSGYKPDVLELLQEEVSKCQQMKWENISVYYSGXXXXXXXXXXXXXXSSVVKDXXXXXXXX--XXXXXXXXXXXIDQLKEKYEKYQTLYDTVANYQNLWMTYLDVESQMKDPAILSNRGGIXXXXXXXXXXXXXXXXXXXAIVAEAIAQYEKNNKTKFYVWNNLTFKDYVQHLWTEFRNRKDSAKYRRPGP-----------GSQSVTNSPKRVTSP 1684
            ++  +     L  IW+ IG     + +R + +      +L  +I +E  L+  +   I+  ++E+  LC +L++P +    + T   L K L+ + + +   + ER          + EL+ L     D + C  +     +P   D +     +P+  E++ FR++L  L ++ +    ++ S    +     +++   ++ FER ++ E +            E   ++ E L  +Q L +++ ++K      CEELRS +  +W RL I E+ +  F +  +G K   ++ LQEE  + Q++K +NI      +  E      K   S+  +       S   +E+ +   + EI ++K+ YE ++ ++D V  ++  W  +L+ + +  DP   +NRGG LLK EK++ +L K LPK E  +  +I  +E+  + +F+V N   F DYV   W  F   K+  K  R              GS   T + +RV  P
Sbjct:   16 VACLNSALARLRDIWEEIGIPEDQRLQRTDAVKRHVNLLLTRMIEEEENLKQRLLKSIDVCRKELNTLCMELQLPPFEEEEESTILQLEKDLRTRVEVMLKQKKER----------MHELKLLKE--RDQDLCDIL---CTSPYHIDGAC----VPSLQELDQFRRHLAGLSAEKEHREAEFKSTKKQIILCMEELDRLPDTSFERDVVCEDE------------EAFCLSKENLTALQELLIQLEEQKMKNQVLCEELRSKITELWERLQISEEERDAFGEYMTGSKGKTIKALQEEFDRLQELKLQNIKRIVEAIRLEISSYWDKCFYSAAQRQAFVPFSSEDYNEDLLCIHDAEISRIKQYYESHKEMFDGVQKWEENWRLFLEFDKKATDPNRFTNRGGNLLKEEKQRAKLQKMLPKLEEELKTSIIAWEQEQEQEFFV-NEKKFMDYVAEQWETFHQDKEREKQERLMKKNRQLEEEMYYGSAPKTPNKRRVPGP 483          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Xenopus
Match: prc1 (protein regulator of cytokinesis 1 [Source:NCBI gene;Acc:100216075])

HSP 1 Score: 96.2857 bits (238), Expect = 4.011e-20
Identity = 114/500 (22.80%), Postives = 221/500 (44.20%), Query Frame = 2
Query:  224 ISSCDKRFHELSVIWDYIGYESSDKEKRIEEITNAFGEMLDGIIMKENQLRLEIESDIENKKREITQLCQQLKIPTYFPPRDLTSYNLLKVLKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLINDSEQCQKMKENIKNPDSDDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFDDLPKSNETVNLSEKLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKEFMQQCSGYKPDVLELLQEEVSKCQQMKWENISVYYSGXXXXXXXXXXXXXXSSVVKDXXXXXXXX--XXXXXXXXXXXIDQLKEKYEKYQTLYDTVANYQNLWMTYLDVESQMKDPAILSNRGGIXXXXXXXXXXXXXXXXXXXAIVAEAIAQYEKNNKTKFYVWNNLTFKDYVQHLWTEFRNRKDSAKYRRPGP-----------GSQSVTNSPKRVTSP 1684
            ++  +     L  IW+ IG     + +R + +      +L  +I +E  L+  +   I+  ++E+  LC +L++P +    + T   L K L+ + + +   + ER      + +   +L  ++                    +    I    +P+  E++ FR++L  L ++ +    ++ S    +     +++   ++ FER ++ E +            E   ++ E L  +Q L +++ ++K      CEELRS +  +W RL I E+ +  F +  +G K   ++ LQEE  + Q++K +NI      +  E      K   S+  +       S   +E+ +   + EI ++K+ YE ++ ++D V  ++  W  +L+ + +  DP   +NRGG LLK EK++ +L K LPK E  +  +I  +E+  + +F+V N   F DYV   W  F   K+  K  R              GS   T + +RV  P
Sbjct:   12 VACLNSALARLRDIWEEIGIPEDQRLQRTDAVKRHVNLLLTRMIEEEENLKQRLLKSIDVCRKELNTLCMELQLPPFEEEEESTILQLEKDLRTRVEVMLKQKKERMHELKLLKERDQDLCDILC-------------------TSPYHIDGACVPSLQELDQFRRHLAGLSAEKEHREAEFKSTKKQIILCMEELDRLPDTSFERDVVCEDE------------EAFCLSKENLTALQELLIQLEEQKMKNQVLCEELRSKITELWERLQISEEERDAFGEYMTGSKGKTIKALQEEFDRLQELKLQNIKRIVEAIRLEISSYWDKCFYSAAQRQAFVPFSSEDYNEDLLCIHDAEISRIKQYYESHKEMFDGVQKWEENWRLFLEFDKKATDPNRFTNRGGNLLKEEKQRAKLQKMLPKLEEELKTSIIAWEQEQEQEFFV-NEKKFMDYVAEQWETFHQDKEREKQERLMKKNRQLEEEMYYGSAPKTPNKRRVPGP 479          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Mouse
Match: Prc1 (protein regulator of cytokinesis 1 [Source:MGI Symbol;Acc:MGI:1858961])

HSP 1 Score: 101.679 bits (252), Expect = 3.963e-22
Identity = 118/476 (24.79%), Postives = 219/476 (46.01%), Query Frame = 2
Query:  209 LLDIVISSCDKRFHELSVIWDYIGYESSDKEKRIEEITNAFGEMLDGIIMKENQLRLEIESDIENKKREITQLCQQLKIPTYFPPRDLTSYNLLKVLKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLINDSEQCQKMKENIKNPDSDDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFDDLPKSNETVNLSEKLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKEFMQQCSGYKPDVLELLQEEVSKCQQMKWENISVYYSGXXXXXXXXXXXXXXSSVVKDXXXX--XXXXXXXXXXXXXXXIDQLKEKYEKYQTLYDTVANYQNLWMTYLDVESQMKDPAILSNRGGIXXXXXXXXXXXXXXXXXXXAIVAEAIAQYEKNNKTKFYVWNNLTFKDYVQHLWTEFRNRKDSAKYRR 1630
            L D  I+   K    L  IW+ IG     + +R E +     ++LD +I +E  LR  +   I   ++E++ LC +L++  +   +D T   L K L+ + + ++  + ER+Q    + +   ELR ++ +      C          D D  S+     PT  E++ FRQ + +L    +   +++ ++   +     ++E+S ++ FER ++ E +                ++ E +  +Q L  ++  +K+   + CE LR+ +  +W RL I E+ ++      +G K  +   L+ EV + +++K +NI      +  E  +   +   S   +        E  +E  +   + EI +L+  Y+ ++ L+  V  ++  W  +L+ E +  DP   +NRGG LLK EKE+ +L K LPK E  +   I Q+E+ + T F V N   F +YV   W   R  K+ AK  R
Sbjct:    7 LADESITCLQKALTHLREIWELIGIPEEQRLQRTEVVKKHIKDLLDRMIAEEESLRERLLKSISICQKELSTLCSELQVKPFQEEKDTTILQLEKDLRTQVELMRKQKKERKQELKLLQEQEQELRDILCM----PPC----------DVDSTSV-----PTLEELKLFRQRVATLRETKESRREEFVNIKKQIILCMEELEHSPDTSFERDVVCEDES------------AFCLSLENIATLQKLLKQLEMKKSQNEAECEGLRTQIRELWDRLQIPEEEREPVEAIMTGSKTKIRNALKLEVDRLEELKMQNIKQVIEKIRVELAQFWDQCFYSQEQRQAFAPYYSEDYTENLLHLHDAEIVRLRNYYDVHKELFQGVQKWEESWKLFLEFERKASDPGRFTNRGGNLLKEEKERAKLQKTLPKLEEELKARIEQWEQEHSTAFVV-NGQKFMEYVTEQWELHRLEKERAKQER 450          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Mouse
Match: Prc1 (protein regulator of cytokinesis 1 [Source:MGI Symbol;Acc:MGI:1858961])

HSP 1 Score: 101.293 bits (251), Expect = 7.682e-22
Identity = 118/476 (24.79%), Postives = 219/476 (46.01%), Query Frame = 2
Query:  209 LLDIVISSCDKRFHELSVIWDYIGYESSDKEKRIEEITNAFGEMLDGIIMKENQLRLEIESDIENKKREITQLCQQLKIPTYFPPRDLTSYNLLKVLKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLINDSEQCQKMKENIKNPDSDDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFDDLPKSNETVNLSEKLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKEFMQQCSGYKPDVLELLQEEVSKCQQMKWENISVYYSGXXXXXXXXXXXXXXSSVVKDXXXX--XXXXXXXXXXXXXXXIDQLKEKYEKYQTLYDTVANYQNLWMTYLDVESQMKDPAILSNRGGIXXXXXXXXXXXXXXXXXXXAIVAEAIAQYEKNNKTKFYVWNNLTFKDYVQHLWTEFRNRKDSAKYRR 1630
            L D  I+   K    L  IW+ IG     + +R E +     ++LD +I +E  LR  +   I   ++E++ LC +L++  +   +D T   L K L+ + + ++  + ER+Q    + +   ELR ++ +      C          D D  S+     PT  E++ FRQ + +L    +   +++ ++   +     ++E+S ++ FER ++ E +                ++ E +  +Q L  ++  +K+   + CE LR+ +  +W RL I E+ ++      +G K  +   L+ EV + +++K +NI      +  E  +   +   S   +        E  +E  +   + EI +L+  Y+ ++ L+  V  ++  W  +L+ E +  DP   +NRGG LLK EKE+ +L K LPK E  +   I Q+E+ + T F V N   F +YV   W   R  K+ AK  R
Sbjct:    7 LADESITCLQKALTHLREIWELIGIPEEQRLQRTEVVKKHIKDLLDRMIAEEESLRERLLKSISICQKELSTLCSELQVKPFQEEKDTTILQLEKDLRTQVELMRKQKKERKQELKLLQEQEQELRDILCM----PPC----------DVDSTSV-----PTLEELKLFRQRVATLRETKESRREEFVNIKKQIILCMEELEHSPDTSFERDVVCEDES------------AFCLSLENIATLQKLLKQLEMKKSQNEAECEGLRTQIRELWDRLQIPEEEREPVEAIMTGSKTKIRNALKLEVDRLEELKMQNIKQVIEKIRVELAQFWDQCFYSQEQRQAFAPYYSEDYTENLLHLHDAEIVRLRNYYDVHKELFQGVQKWEESWKLFLEFERKASDPGRFTNRGGNLLKEEKERAKLQKTLPKLEEELKARIEQWEQEHSTAFVV-NGQKFMEYVTEQWELHRLEKERAKQER 450          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Mouse
Match: Prc1 (protein regulator of cytokinesis 1 [Source:MGI Symbol;Acc:MGI:1858961])

HSP 1 Score: 100.908 bits (250), Expect = 8.384e-22
Identity = 118/476 (24.79%), Postives = 219/476 (46.01%), Query Frame = 2
Query:  209 LLDIVISSCDKRFHELSVIWDYIGYESSDKEKRIEEITNAFGEMLDGIIMKENQLRLEIESDIENKKREITQLCQQLKIPTYFPPRDLTSYNLLKVLKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLINDSEQCQKMKENIKNPDSDDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFDDLPKSNETVNLSEKLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKEFMQQCSGYKPDVLELLQEEVSKCQQMKWENISVYYSGXXXXXXXXXXXXXXSSVVKDXXXX--XXXXXXXXXXXXXXXIDQLKEKYEKYQTLYDTVANYQNLWMTYLDVESQMKDPAILSNRGGIXXXXXXXXXXXXXXXXXXXAIVAEAIAQYEKNNKTKFYVWNNLTFKDYVQHLWTEFRNRKDSAKYRR 1630
            L D  I+   K    L  IW+ IG     + +R E +     ++LD +I +E  LR  +   I   ++E++ LC +L++  +   +D T   L K L+ + + ++  + ER+Q    + +   ELR ++ +      C          D D  S+     PT  E++ FRQ + +L    +   +++ ++   +     ++E+S ++ FER ++ E +                ++ E +  +Q L  ++  +K+   + CE LR+ +  +W RL I E+ ++      +G K  +   L+ EV + +++K +NI      +  E  +   +   S   +        E  +E  +   + EI +L+  Y+ ++ L+  V  ++  W  +L+ E +  DP   +NRGG LLK EKE+ +L K LPK E  +   I Q+E+ + T F V N   F +YV   W   R  K+ AK  R
Sbjct:    7 LADESITCLQKALTHLREIWELIGIPEEQRLQRTEVVKKHIKDLLDRMIAEEESLRERLLKSISICQKELSTLCSELQVKPFQEEKDTTILQLEKDLRTQVELMRKQKKERKQELKLLQEQEQELRDILCM----PPC----------DVDSTSV-----PTLEELKLFRQRVATLRETKESRREEFVNIKKQIILCMEELEHSPDTSFERDVVCEDES------------AFCLSLENIATLQKLLKQLEMKKSQNEAECEGLRTQIRELWDRLQIPEEEREPVEAIMTGSKTKIRNALKLEVDRLEELKMQNIKQVIEKIRVELAQFWDQCFYSQEQRQAFAPYYSEDYTENLLHLHDAEIVRLRNYYDVHKELFQGVQKWEESWKLFLEFERKASDPGRFTNRGGNLLKEEKERAKLQKTLPKLEEELKARIEQWEQEHSTAFVV-NGQKFMEYVTEQWELHRLEKERAKQER 450          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Mouse
Match: Prc1 (protein regulator of cytokinesis 1 [Source:MGI Symbol;Acc:MGI:1858961])

HSP 1 Score: 100.908 bits (250), Expect = 8.760e-22
Identity = 118/476 (24.79%), Postives = 219/476 (46.01%), Query Frame = 2
Query:  209 LLDIVISSCDKRFHELSVIWDYIGYESSDKEKRIEEITNAFGEMLDGIIMKENQLRLEIESDIENKKREITQLCQQLKIPTYFPPRDLTSYNLLKVLKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLINDSEQCQKMKENIKNPDSDDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFDDLPKSNETVNLSEKLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKEFMQQCSGYKPDVLELLQEEVSKCQQMKWENISVYYSGXXXXXXXXXXXXXXSSVVKDXXXX--XXXXXXXXXXXXXXXIDQLKEKYEKYQTLYDTVANYQNLWMTYLDVESQMKDPAILSNRGGIXXXXXXXXXXXXXXXXXXXAIVAEAIAQYEKNNKTKFYVWNNLTFKDYVQHLWTEFRNRKDSAKYRR 1630
            L D  I+   K    L  IW+ IG     + +R E +     ++LD +I +E  LR  +   I   ++E++ LC +L++  +   +D T   L K L+ + + ++  + ER+Q    + +   ELR ++ +      C          D D  S+     PT  E++ FRQ + +L    +   +++ ++   +     ++E+S ++ FER ++ E +                ++ E +  +Q L  ++  +K+   + CE LR+ +  +W RL I E+ ++      +G K  +   L+ EV + +++K +NI      +  E  +   +   S   +        E  +E  +   + EI +L+  Y+ ++ L+  V  ++  W  +L+ E +  DP   +NRGG LLK EKE+ +L K LPK E  +   I Q+E+ + T F V N   F +YV   W   R  K+ AK  R
Sbjct:    7 LADESITCLQKALTHLREIWELIGIPEEQRLQRTEVVKKHIKDLLDRMIAEEESLRERLLKSISICQKELSTLCSELQVKPFQEEKDTTILQLEKDLRTQVELMRKQKKERKQELKLLQEQEQELRDILCM----PPC----------DVDSTSV-----PTLEELKLFRQRVATLRETKESRREEFVNIKKQIILCMEELEHSPDTSFERDVVCEDES------------AFCLSLENIATLQKLLKQLEMKKSQNEAECEGLRTQIRELWDRLQIPEEEREPVEAIMTGSKTKIRNALKLEVDRLEELKMQNIKQVIEKIRVELAQFWDQCFYSQEQRQAFAPYYSEDYTENLLHLHDAEIVRLRNYYDVHKELFQGVQKWEESWKLFLEFERKASDPGRFTNRGGNLLKEEKERAKLQKTLPKLEEELKARIEQWEQEHSTAFVV-NGQKFMEYVTEQWELHRLEKERAKQER 450          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Mouse
Match: Prc1 (protein regulator of cytokinesis 1 [Source:MGI Symbol;Acc:MGI:1858961])

HSP 1 Score: 69.707 bits (169), Expect = 5.872e-12
Identity = 96/391 (24.55%), Postives = 179/391 (45.78%), Query Frame = 2
Query:  464 RDLTSYNLLKVLKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLINDSEQCQKMKENIKNPDSDDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFDDLPKSNETVNLSEKLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKEFMQQCSGYKPDVLELLQEEVSKCQQMKWENISVYYSGXXXXXXXXXXXXXXSSVVKDXXXX--XXXXXXXXXXXXXXXIDQLKEKYEKYQTLYDTVANYQNLWMTYLDVESQMKDPAILSNRGGIXXXXXXXXXXXXXXXXXXXAIVAEAIAQYEKNNKTKFYVWNNLTFKDYVQHLWTEFRNRKDSAKYRR 1630
            +D T   L K L+ + + ++  + ER+Q    + +   ELR ++ +      C          D D  S+     PT  E++ FRQ + +L    +   +++ ++   +     ++E+S ++ FER ++ E +                ++ E +  +Q L  ++  +K+   + CE LR+ +  +W RL I E+ ++      +G K  +   L+ EV + +++K +NI      +  E  +   +   S   +        E  +E  +   + EI +L+  Y+ ++ L+  V  ++  W  +L+ E +  DP   +NRGG LLK EKE+ +L K LPK E  +   I Q+E+ + T F V N   F +YV   W   R  K+ AK  R
Sbjct:   51 KDTTILQLEKDLRTQVELMRKQKKERKQELKLLQEQEQELRDILCM----PPC----------DVDSTSV-----PTLEELKLFRQRVATLRETKESRREEFVNIKKQIILCMEELEHSPDTSFERDVVCEDESA------------FCLSLENIATLQKLLKQLEMKKSQNEAECEGLRTQIRELWDRLQIPEEEREPVEAIMTGSKTKIRNALKLEVDRLEELKMQNIKQVIEKIRVELAQFWDQCFYSQEQRQAFAPYYSEDYTENLLHLHDAEIVRLRNYYDVHKELFQGVQKWEESWKLFLEFERKASDPGRFTNRGGNLLKEEKERAKLQKTLPKLEEELKARIEQWEQEHSTAFVV-NGQKFMEYVTEQWELHRLEKERAKQER 409          
BLAST of Protein regulator of cytokinesis 1 vs. UniProt/SwissProt
Match: sp|Q99K43|PRC1_MOUSE (Protein regulator of cytokinesis 1 OS=Mus musculus OX=10090 GN=Prc1 PE=1 SV=2)

HSP 1 Score: 100.908 bits (250), Expect = 5.864e-21
Identity = 118/476 (24.79%), Postives = 219/476 (46.01%), Query Frame = 2
Query:  209 LLDIVISSCDKRFHELSVIWDYIGYESSDKEKRIEEITNAFGEMLDGIIMKENQLRLEIESDIENKKREITQLCQQLKIPTYFPPRDLTSYNLLKVLKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLINDSEQCQKMKENIKNPDSDDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFDDLPKSNETVNLSEKLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKEFMQQCSGYKPDVLELLQEEVSKCQQMKWENISVYYSGXXXXXXXXXXXXXXSSVVKDXXXX--XXXXXXXXXXXXXXXIDQLKEKYEKYQTLYDTVANYQNLWMTYLDVESQMKDPAILSNRGGIXXXXXXXXXXXXXXXXXXXAIVAEAIAQYEKNNKTKFYVWNNLTFKDYVQHLWTEFRNRKDSAKYRR 1630
            L D  I+   K    L  IW+ IG     + +R E +     ++LD +I +E  LR  +   I   ++E++ LC +L++  +   +D T   L K L+ + + ++  + ER+Q    + +   ELR ++ +      C          D D  S+     PT  E++ FRQ + +L    +   +++ ++   +     ++E+S ++ FER ++ E +                ++ E +  +Q L  ++  +K+   + CE LR+ +  +W RL I E+ ++      +G K  +   L+ EV + +++K +NI      +  E  +   +   S   +        E  +E  +   + EI +L+  Y+ ++ L+  V  ++  W  +L+ E +  DP   +NRGG LLK EKE+ +L K LPK E  +   I Q+E+ + T F V N   F +YV   W   R  K+ AK  R
Sbjct:    7 LADESITCLQKALTHLREIWELIGIPEEQRLQRTEVVKKHIKDLLDRMIAEEESLRERLLKSISICQKELSTLCSELQVKPFQEEKDTTILQLEKDLRTQVELMRKQKKERKQELKLLQEQEQELRDILCM----PPC----------DVDSTSV-----PTLEELKLFRQRVATLRETKESRREEFVNIKKQIILCMEELEHSPDTSFERDVVCEDES------------AFCLSLENIATLQKLLKQLEMKKSQNEAECEGLRTQIRELWDRLQIPEEEREPVEAIMTGSKTKIRNALKLEVDRLEELKMQNIKQVIEKIRVELAQFWDQCFYSQEQRQAFAPYYSEDYTENLLHLHDAEIVRLRNYYDVHKELFQGVQKWEESWKLFLEFERKASDPGRFTNRGGNLLKEEKERAKLQKTLPKLEEELKARIEQWEQEHSTAFVV-NGQKFMEYVTEQWELHRLEKERAKQER 450          
BLAST of Protein regulator of cytokinesis 1 vs. UniProt/SwissProt
Match: sp|O43663|PRC1_HUMAN (Protein regulator of cytokinesis 1 OS=Homo sapiens OX=9606 GN=PRC1 PE=1 SV=2)

HSP 1 Score: 95.1301 bits (235), Expect = 4.119e-19
Identity = 117/471 (24.84%), Postives = 215/471 (45.65%), Query Frame = 2
Query:  224 ISSCDKRFHELSVIWDYIGYESSDKEKRIEEITNAFGEMLDGIIMKENQLRLEIESDIENKKREITQLCQQLKIPTYFPPRDLTSYNLLKVLKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLINDSEQCQKMKENIKNPDSDDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFDDLPKSNETVNLSEKLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKEFMQQCSGYKPDVLELLQEEVSKCQQMKWENISVYYSGXXXXXXXXXXXXXXSSVVKDXXXXXXXX--XXXXXXXXXXXIDQLKEKYEKYQTLYDTVANYQNLWMTYLDVESQMKDPAILSNRGGIXXXXXXXXXXXXXXXXXXXAIVAEAIAQYEKNNKTKFYVWNNLTFKDYVQHLWTEFRNRKDSAKYRR 1630
            I    K  + L  IW+ IG     + +R E +     E+LD +I +E  L+  +   I   ++E+  LC +L +  +    + T   L K L+ + + ++  + ER+Q             KL+      EQ Q++ E +  P  D   I    +P+  E+  FRQ++T+L        +++ S+   +      ++++ ++ FER ++ E +D               ++ E +  +Q L  ++  +K+   + CE LR+ +  +W RL I E+ ++      SG K  V + LQ EV + +++K +N+      +  E  +   +   S   +       +   +E  +   + EI +LK  YE ++ L++ V  ++  W  +L+ E +  DP   +NRGG LLK EK++ +L K LPK E  +   I  +E+ +   F V N   F +YV   W   R  K+ AK  R
Sbjct:   12 IVCLQKALNHLREIWELIGIPEDQRLQRTEVVKKHIKELLDMMIAEEESLKERLIKSISVCQKELNTLCSELHVEPFQEEGETTILQLEKDLRTQVELMRKQKKERKQEL-----------KLL-----QEQDQELCEILCMPHYD---IDSASVPSLEELNQFRQHVTTLRETKASRREEFVSIKRQIILCMEALDHTPDTSFERDVVCEDED------------AFCLSLENIATLQKLLRQLEMQKSQNEAVCEGLRTQIRELWDRLQIPEEEREAVATIMSGSKAKVRKALQLEVDRLEELKMQNMKKVIEAIRVELVQYWDQCFYSQEQRQAFAPFCAEDYTESLLQLHDAEIVRLKNYYEVHKELFEGVQKWEETWRLFLEFERKASDPNRFTNRGGNLLKEEKQRAKLQKMLPKLEEELKARIELWEQEHSKAFMV-NGQKFMEYVAEQWEMHRLEKERAKQER 450          
BLAST of Protein regulator of cytokinesis 1 vs. TrEMBL
Match: A0A504YCV0 (Protein regulator of cytokinesis OS=Fasciola gigantica OX=46835 GN=FGIG_00670 PE=4 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 1.801e-75
Identity = 182/540 (33.70%), Postives = 292/540 (54.07%), Query Frame = 2
Query:  221 VISSCDKRFHELSVIWDYIGYESSDKEKRIEEITNAFGEMLDGIIMKENQLRLEIESDIENKKREITQLCQQLKIPTYFPPRDLTSYNLLKVLKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLIND--------------------SEQCQKMKENIKNPDSDDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILK-----EFDDLPKSNETVNLSEKLT--------------------------ITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKEFMQQCSGYKPDVLELLQEEVSKCQQMKWENISVYYSGXXXXXXXXXXX-XXXSSVVKDXXXXXXXXXXXXXXXXXXXIDQLKEKYEKYQTLYDTVANYQNLWMTYLDVESQMKDPAILSNRGGIXXXXXXXXXXXXXXXXXXXAIVAEAIAQYEKNNKTKFYVWNNLTFKDYVQHLWTEFRNRKDSAKYRRPGPGSQSVTNSPKRVTSP 1684
            +I+S      EL  IWDY+GY S ++ +R+        + L+ +I +EN++R+E+E  IE K+RE+  LCQQL+IP Y P R LTS  L+K L+ K+ EL  I+ +R   +  +   ++ L +L+S   D                    S      ++  ++P  D +S   + +P E E++        L + Y  L +++ +L  D+GRI+A+IEY  +SD ER +L+     E       + T  +  KLT                          + +E L  + + RL++VK KA LV TCEELR+YL +MW+RL+     + EF++   G+KP+ LE LQEEV +CQQMKWE +  Y + L  E  ++ K   +  ++++  +       E   + LE  ++QL + Y +++ +YD++A+Y+ LW +  ++E ++KDPAI SNRGGILLKTEKEKKRL+KE+ + E  V  AI QYE  N T F + +  TFK YV   W+  +  +++++ RR   GS +   +   V++P
Sbjct:   11 LIASIRPTLCELVSIWDYVGYSSEERTERLHLSIQYIQKTLEEVIAEENEIRMEMEQRIETKRREVADLCQQLRIPAYLPQRGLTSSELMKNLEQKSTELCGIKRDRCSQYVELRSRVLRLSELLSEPADKSLKRVANFPQLTPLSPTDASGDKSITRQLSQSPLGDPVSY--DRIPEEREIKALADVRDELNALYLPLAEQHAALRKDIGRIAAEIEYEPQSDRERDVLQGIGLVELSSKVNPSATPGVVRKLTDTPDGHDADGSDKENASGVQDPYEPIVDEETLKWLTDWRLRLVKEKARLVGTCEELRAYLTTMWHRLDKPPGEQTEFLKMHGGFKPEDLEALQEEVDRCQQMKWEKLETYLNRLATEAMKLAKNCCVDDAIIQLPDDQDSGDPEVMANHLENVLEQLTQTYAQHRPIYDSIASYEELWQSLQEIEIRLKDPAIFSNRGGILLKTEKEKKRLVKEVQRAEQEVQSAIEQYEAKNNTTFSLSDGRTFKQYVTDRWSSGKTSRETSRPRRSVFGSPNTRTNSTAVSNP 548          
BLAST of Protein regulator of cytokinesis 1 vs. TrEMBL
Match: A0A4E0S104 (Protein regulator of cytokinesis OS=Fasciola hepatica OX=6192 GN=D915_005325 PE=4 SV=1)

HSP 1 Score: 258.455 bits (659), Expect = 2.761e-74
Identity = 182/534 (34.08%), Postives = 289/534 (54.12%), Query Frame = 2
Query:  221 VISSCDKRFHELSVIWDYIGYESSDKEKRIEEITNAFGEMLDGIIMKENQLRLEIESDIENKKREITQLCQQLKIPTYFPPRDLTSYNLLKVLKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLIND--------------------SEQCQKMKENIKNPDSDDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFD---------------------DLPKSNET----------VNLSEKLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKEFMQQCSGYKPDVLELLQEEVSKCQQMKWENISVYYSGXXXXXXXXXXX-XXXSSVVKDXXXXXXXXXXXXXXXXXXXIDQLKEKYEKYQTLYDTVANYQNLWMTYLDVESQMKDPAILSNRGGIXXXXXXXXXXXXXXXXXXXAIVAEAIAQYEKNNKTKFYVWNNLTFKDYVQHLWTEFRNRKDSAKYRRPGPGSQSV-TNS 1663
            +I+S      EL  IWDY+GY S ++ +R+        + L+ +I +EN++R+E+E  IE K+RE+  LCQQL+IP Y P R LTS  L+K L+ K+ EL+ I+ +R   +  +   ++ L +L+S   D                    S      ++  ++P  D +S   + +P E E++        L + Y  L +++ +L  D+GRI+A+IEY  +SD ER +L+                        D P  N+           V    +  + +E L  + + RL++VK KA LV TCEELR+YL +MW RL+     + EF++   G+KP+ LE LQEEV +CQQMKWE +  Y + L  E  ++ K   +  ++++  +       E   + LE  ++QL + Y +++ +YD++A+Y+ LW +  ++E ++KDPAI SNRGGILLKTEKEKKRL+KE+ + E  V  AI QYE  N T F + +  TFK YV   W+  +  +++++ RR   GS +  TNS
Sbjct:   11 LIASIRPTLCELVSIWDYVGYSSEERTERLHMSIQYIQKTLEEVIAEENEIRMEMEQRIETKRREVADLCQQLRIPAYLPQRGLTSSELMKNLEQKSTELRGIKRDRCSQYVELRSRVLRLSELLSEPADKSLKRVANFPQLTPLSPTDASGDKSITRQLSQSPLGDPVSY--DRIPEEREIKALADVRDELNALYLPLAEQHAALRKDIGRIAAEIEYEPQSDRERDVLQGIGLVELSSKVNPAATPGVVRKPTDTPDGNDADGSDKENASGVQDPYEPIVDEETLKWLTDWRLRLVKEKARLVGTCEELRAYLTTMWRRLDKPPGEQTEFLKMHGGFKPEDLEALQEEVDRCQQMKWEKLETYLNRLATEAMKLAKNCCVDDAIIQLPDDQDSGDPEVMANHLENVLEQLTQTYAQHRPIYDSIASYEELWQSLQEIEIRLKDPAIFSNRGGILLKTEKEKKRLVKEVQRAEQEVQSAIEQYEAKNNTTFSLSDGRTFKQYVTDRWSSGKTSRETSRPRRSVFGSPNTRTNS 542          
BLAST of Protein regulator of cytokinesis 1 vs. TrEMBL
Match: A0A267EBI6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031035g1 PE=4 SV=1)

HSP 1 Score: 246.128 bits (627), Expect = 7.052e-70
Identity = 166/495 (33.54%), Postives = 274/495 (55.35%), Query Frame = 2
Query:  215 DIVISSCDKRFHELSVIWDYIGYESSDKEKRIEEITNAFGEMLDGIIMKENQLRLEIESDIENKKREITQLCQQLKIPTYFPPRDLTSYNLLKVLKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLINDSEQCQKMKENIKNPDS-DDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFDDLPKSNETVNLSE----KLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKEFMQQCSGYKPDVLELLQEEVSKCQQMKWENISVYYSGXXXXXXXXXXXXXXSSVVKDXXXXXX------XXXXXXXXXXXXXIDQLKEKYEKYQTLYDTVANYQNLWMTYLDVESQMKDPAILSNRGGIXXXXXXXXXXXXXXXXXXXAIVAEAIAQYEKNNKTKFYVWNNLTFKDYVQHLWTEFRNRKDSAKY-RRPGPGSQSVTNS 1663
            +I++   +    EL  IWDYIGY    + +R+  +       +   I  ENQ R+++++DIE +KR   Q+CQ L++P YFPPR L S +LL+ L     + +    ERQ     +   +  L + + L +++   +  +    + D  D  +  ++ +P+E ++E  +  +  LE    ++L +   L  DV RI+ DIE++G      +     DD  ++ E   L+     +L ++D  L +++ LRL++VK KAMLV TC+ELR ++  MW RL+I  + ++ F+ Q +GY+   L+ LQEE  KCQ++KW   + Y + L  E  E+     +     + +            +EE V++LE+ ID+L+E YEK + LY  V  YQ+ W  YLDVE +MKDPAILSNRGG+LLKT+KE+K+L KELPK E  V+E + + +  +  +       TF+ +V+HLW   R+ ++++K+ R+ G  +   T S
Sbjct:    4 EIILDVIEPGLGELESIWDYIGYPDEQRTERLHTLAEQLQARMFDFISAENQRRVQLDTDIEARKRRAAQICQTLRLPPYFPPRGLPSLSLLEHLDAHIAQFEAEIKERQARQSELTAQVRSLCERLGLPDETATTKPAEATTTDGDGVDSTTDADDAIPSEQDLERLQSRVVELERRRDDMLKRLSGLAEDVRRIALDIEFAGSPAGSGA-----DDAAQALEDAVLAGEETTRLPLSDATLSQLEALRLRLVKHKAMLVGTCDELRQHIRVMWTRLDIPHEEQEAFLAQHAGYRQSTLDALQEESDKCQELKWSQATAYLANLRREASELRATCFLDDTGDEADEDATLIGGDLDDTEEGVAALERRIDELRESYEKNRELYAAVGLYQDTWRAYLDVEQRMKDPAILSNRGGVLLKTDKERKQLQKELPKVEKKVSELLQKLQGGDNFRI---RGRTFEQHVRHLWDSLRSEQEASKFNRKAGAVAGGRTGS 490          
BLAST of Protein regulator of cytokinesis 1 vs. TrEMBL
Match: A0A1I8GGR8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 2.436e-69
Identity = 165/495 (33.33%), Postives = 274/495 (55.35%), Query Frame = 2
Query:  215 DIVISSCDKRFHELSVIWDYIGYESSDKEKRIEEITNAFGEMLDGIIMKENQLRLEIESDIENKKREITQLCQQLKIPTYFPPRDLTSYNLLKVLKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLINDSEQCQKMKENIKNPDS-DDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFDDLPKSNETVNLSE----KLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKEFMQQCSGYKPDVLELLQEEVSKCQQMKWENISVYYSGXXXXXXXXXXXXXXSSVVKDXXXXXX------XXXXXXXXXXXXXIDQLKEKYEKYQTLYDTVANYQNLWMTYLDVESQMKDPAILSNRGGIXXXXXXXXXXXXXXXXXXXAIVAEAIAQYEKNNKTKFYVWNNLTFKDYVQHLWTEFRNRKDSAKY-RRPGPGSQSVTNS 1663
            +I++   +    EL  IWDYIGY    + +R+  +       +   I  ENQ R++++++IE +KR   Q+CQ L++P YFPPR L S +LL+ L     + +    ERQ     +   +  L + + L +++   +  +    + D  D  +  ++ +P+E ++E  +  +  LE    ++L +   L  DV RI+ DIE++G      +     DD  ++ E   L+     +L ++D  L +++ LRL++VK KAMLV TC+ELR ++  MW RL+I  + ++ F+ Q +GY+   L+ LQEE  KCQ++KW   + Y + L  E  E+     +     + +            +EE V++LE+ ID+L+E YEK + LY  V  YQ+ W  YLDVE +MKDPAILSNRGG+LLKT+KE+K+L KELPK E  V+E + + +  +  +       TF+ +V+HLW   R+ ++++K+ R+ G  +   T S
Sbjct:    4 EIILDVIEPGLGELESIWDYIGYPDEQRTERLHTLAEQLQARMFDFISAENQRRVQLDTEIEARKRRAAQICQTLRLPPYFPPRGLPSLSLLEHLDAHIAQFEAEIKERQARQSELTAQVRSLCERLGLPDETATTKPAEATTTDGDGVDSTTDADDAIPSEQDLERLQSRVAELERRRDDMLKRLSGLAEDVRRIALDIEFAGSPAGSGA-----DDAAQALEDAVLAGEETTRLPLSDATLSQLEALRLRLVKHKAMLVGTCDELRQHIRVMWTRLDIPHEEQEAFLAQHAGYRQSTLDALQEESDKCQELKWSQATAYLANLRREASELRATCFLDDTGDEADEDAALIGGDLDDTEEGVAALERRIDELRESYEKNRELYAAVGLYQDTWRAYLDVEQRMKDPAILSNRGGVLLKTDKERKQLQKELPKVEKKVSELLQKLQGGDNFRI---RGRTFEQHVRHLWDSLRSEQEASKFNRKAGAVAGGRTGS 490          
BLAST of Protein regulator of cytokinesis 1 vs. TrEMBL
Match: A0A267FQF1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030562g1 PE=4 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 2.513e-69
Identity = 165/495 (33.33%), Postives = 273/495 (55.15%), Query Frame = 2
Query:  215 DIVISSCDKRFHELSVIWDYIGYESSDKEKRIEEITNAFGEMLDGIIMKENQLRLEIESDIENKKREITQLCQQLKIPTYFPPRDLTSYNLLKVLKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLINDSEQCQKMKENIKNPDS-DDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFDDLPKSNETVNLSE----KLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKEFMQQCSGYKPDVLELLQEEVSKCQQMKWENISVYYSGXXXXXXXXXXXXXXSSVVKDXXXXXX------XXXXXXXXXXXXXIDQLKEKYEKYQTLYDTVANYQNLWMTYLDVESQMKDPAILSNRGGIXXXXXXXXXXXXXXXXXXXAIVAEAIAQYEKNNKTKFYVWNNLTFKDYVQHLWTEFRNRKDSAKY-RRPGPGSQSVTNS 1663
            +I++   +    EL  IWDYIGY    + +R+  +       +   I  ENQ R++++++IE +KR   Q+CQ L++P YFPPR L S +LL+ L     + +    ERQ     +   +  L + + L +++   +  +    + D  D  +  ++ +P+E ++E  +  +  LE    ++L +   L  DV RI+ DIE++G      +     DD  ++ E   L+     +L ++D  L +++ LRL++VK KAMLV TC+ELR ++  MW RL+I  + ++ F+ Q +GY+   L+ LQEE  KCQ++KW   + Y + L  E  E+     +     + +            +EE V++LE+ ID+L+E YEK + LY  V  YQ+ W  YLDVE +MKDPAILSNRGG+LLKT+KE+K+L KELPK E  V+E + + +  +  +       TF+ +V HLW   R+ ++++K+ R+ G  +   T S
Sbjct:    4 EIILDVIEPGLGELESIWDYIGYPDEQRTERLHTLAEQLQARMFDFISAENQRRVQLDTEIEARKRRAAQICQTLRLPPYFPPRGLPSLSLLEHLDAHIAQFEAEIKERQARQSELTAQVRSLCERLGLPDETATTKPAEATTTDGDGVDSTTDADDAIPSEQDLERLQSRVAELERRRDDMLKRLSGLAEDVRRIALDIEFAGSPAGSGA-----DDAAQALEDAVLAGEETTRLPLSDATLSQLEALRLRLVKHKAMLVGTCDELRQHIRVMWTRLDIPHEEQEAFLAQHAGYRQSTLDALQEESDKCQELKWSQATAYLANLRREASELRATCFLDDTGDEADEDAALIGGDLDDTEEGVAALERRIDELRESYEKNRELYAAVGLYQDTWRAYLDVEQRMKDPAILSNRGGVLLKTDKERKQLQKELPKVEKKVSELLQKLQGGDNFRI---RGRTFEQHVHHLWDSLRSEQEASKFNRKAGAVAGGRTGS 490          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Cavefish
Match: prc1a (protein regulator of cytokinesis 1 [Source:NCBI gene;Acc:103032078])

HSP 1 Score: 89.3521 bits (220), Expect = 3.734e-18
Identity = 113/472 (23.94%), Postives = 209/472 (44.28%), Query Frame = 2
Query:  224 ISSCDKRFHELSVIWDYIGYESSDKEKRIEEITNAFGEMLDGIIMKENQLRLEIESDIENKKREITQLCQQLKIPTYFPPRDLTSYNLLKVLKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLINDSEQCQKMKENIKNPDSDDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFDDLPKSNETVNLS-EKLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKEFMQQCSGYKPDVLELLQEEVSKCQQMKWENISVYYSGXXXXXXXXXXXXXXSSVVKDXXXXXXXXXXXXXXXXXXXIDQ--LKEKYEKYQTLYDTVANYQNLWMTYLDVESQMKDPAILSNRGGIXXXXXXXXXXXXXXXXXXXAIVAEAIAQYEKNNKTKFYVWNNLTFKDYVQHLWTEFRNRKDSAKYRR 1630
            ++  +K    L  IW+ IG     + +R + +      +L  +I +E  L+  + S I   ++E+  LC++L++P +     LT   L  V++   K +   +T+R          + EL+ L+    D E C  + +N         +I  + +P+  +++ + Q++ +   + +    ++ ++   +     D++   ++ FER ++ E        E   LS E +T    LL++++N       RKA   + C   R  +  +W RL I +D +    +     K   +E L  E+ + +++K +N+      +  E   + +K   S   +       S           E ++  LK+ YE ++ LYD V N+QN W  Y  +E +  DP+  +NRGG LL+ EK++  L K LPK E  +   I Q+E    T+F V N   F  YV+  W      K+  K  R
Sbjct:   12 VACLNKALTHLRDIWEEIGIPEDQRVQRTDAVRMHVKNLLTMMIEEEEGLKKRLLSSIGTCRKELDTLCEELQLPPFEEEDGLTMLQLESVIRTHLKVMLKQKTQR----------MNELKDLIQ--QDRELCDILCDN-------PYAISPDRVPSAEQLKDYSQHIATRNQEKERRHAEFVTIKRQIVLCMEDLDQMPDTSFERDVVCE------DEEAFCLSTENITALKVLLNQLEN-------RKAENEALCVSYRDRIGELWERLQIPQDERDSIAEHMKSSKKKNMEALHAELERLKELKMKNMQSVIETIRAEIALLWEKCFYSLEQRQAFVPYYSDDFSEELLAMHEEEEQRLKQHYEHHRELYDGVTNWQNNWTLYQTLEKKATDPSRFNNRGGNLLREEKQRADLQKSLPKLEKSLKTQIEQWEAEQGTQFLV-NGQHFMQYVEEQWNLHHLEKEREKLER 450          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Cavefish
Match: prc1a (protein regulator of cytokinesis 1 [Source:NCBI gene;Acc:103032078])

HSP 1 Score: 62.3882 bits (150), Expect = 9.790e-10
Identity = 64/311 (20.58%), Postives = 138/311 (44.37%), Query Frame = 2
Query:  224 ISSCDKRFHELSVIWDYIGYESSDKEKRIEEITNAFGEMLDGIIMKENQLRLEIESDIENKKREITQLCQQLKIPTYFPPRDLTSYNLLKVLKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLINDSEQCQKMKENIKNPDSDDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFDDLPKSNETVNLS-EKLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKEFMQQCSGYKPDVLELLQEEVSKCQQMKWENI 1153
            ++  +K    L  IW+ IG     + +R + +      +L  +I +E  L+  + S I   ++E+  LC++L++P +     LT   L  V++   K +   +T+R          + EL+ L+    D E C  + +N         +I  + +P+  +++ + Q++ +   + +    ++ ++   +     D++   ++ FER ++ E        E   LS E +T    LL++++N       RKA   + C   R  +  +W RL I +D +    +     K   +E L  E+ + +++K +N+
Sbjct:   12 VACLNKALTHLRDIWEEIGIPEDQRVQRTDAVRMHVKNLLTMMIEEEEGLKKRLLSSIGTCRKELDTLCEELQLPPFEEEDGLTMLQLESVIRTHLKVMLKQKTQR----------MNELKDLIQ--QDRELCDILCDN-------PYAISPDRVPSAEQLKDYSQHIATRNQEKERRHAEFVTIKRQIVLCMEDLDQMPDTSFERDVVCE------DEEAFCLSTENITALKVLLNQLEN-------RKAENEALCVSYRDRIGELWERLQIPQDERDSIAEHMKSSKKKNMEALHAELERLKELKMKNM 290          

HSP 2 Score: 56.225 bits (134), Expect = 7.812e-8
Identity = 44/112 (39.29%), Postives = 61/112 (54.46%), Query Frame = 2
Query: 1295 QLKEKYEKYQTLYDTVANYQNLWMTYLDVESQMKDPAILSNRGGIXXXXXXXXXXXXXXXXXXXAIVAEAIAQYEKNNKTKFYVWNNLTFKDYVQHLWTEFRNRKDSAKYRR 1630
            +LK+ YE ++ LYD V N+QN W  Y  +E +  DP+  +NRGG LL+ EK++  L K LPK E  +   I Q+E    T+F V N   F  YV+  W      K+  K  R
Sbjct:  340 RLKQHYEHHRELYDGVTNWQNNWTLYQTLEKKATDPSRFNNRGGNLLREEKQRADLQKSLPKLEKSLKTQIEQWEAEQGTQFLV-NGQHFMQYVEEQWNLHHLEKEREKLER 450          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Cavefish
Match: zgc:86764 (protein regulator of cytokinesis 1-like [Source:NCBI gene;Acc:103035917])

HSP 1 Score: 58.9214 bits (141), Expect = 1.196e-8
Identity = 60/285 (21.05%), Postives = 130/285 (45.61%), Query Frame = 2
Query:  221 VISSCDKRFHELSVIWDYIGYESSDKEKRIEEITNAFGEMLDGIIMKENQLRLEIESDIENKKREITQLCQQLKIPTYFPPRDLTSYNLLKVLKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLINDSEQCQKMKENIKNPDSDDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFDDLPKSNETVNLSEKLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKEFMQQC 1075
            ++S  +     L  IWD IG     + +R++ +     ++L  +I +E  LR  I + I   ++E+  LC ++ +  Y    DLT   L K L+ + + LQ  + ER        + + +LR+      D E C  +        S    I    LP++++++  ++++ +L  + +  +  +  L  D+  +  ++ +  E+  ER  +    D+              +T E +  ++ L  ++  +K  L+S+ ++L++   S+W+RL+  E+  +EF Q+ 
Sbjct:   13 LVSGINHAMARLVDIWDSIGIMEDQRIERMQTVKKHIEDLLRDMITEEETLRHRIRTSIITTQKELETLCLEMSMDPYRLEEDLTVLQLEKNLRCQLETLQKEKNER-------LRELNDLRQ-----QDEELCVTL-------CSTPYYIPSGSLPSQTQLQELKEHIKNLSVEKESRVKVFSGLREDIKNLMDEMGHEPETSLERDSVGSDTDI------------FLLTHENIQALKLLLSQLEIKKESLISSRDKLKNRATSLWHRLSYPEEEAEEFKQEA 266          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Cavefish
Match: zgc:86764 (protein regulator of cytokinesis 1-like [Source:NCBI gene;Acc:103035917])

HSP 1 Score: 58.9214 bits (141), Expect = 1.221e-8
Identity = 60/285 (21.05%), Postives = 130/285 (45.61%), Query Frame = 2
Query:  221 VISSCDKRFHELSVIWDYIGYESSDKEKRIEEITNAFGEMLDGIIMKENQLRLEIESDIENKKREITQLCQQLKIPTYFPPRDLTSYNLLKVLKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLINDSEQCQKMKENIKNPDSDDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFDDLPKSNETVNLSEKLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKEFMQQC 1075
            ++S  +     L  IWD IG     + +R++ +     ++L  +I +E  LR  I + I   ++E+  LC ++ +  Y    DLT   L K L+ + + LQ  + ER        + + +LR+      D E C  +        S    I    LP++++++  ++++ +L  + +  +  +  L  D+  +  ++ +  E+  ER  +    D+              +T E +  ++ L  ++  +K  L+S+ ++L++   S+W+RL+  E+  +EF Q+ 
Sbjct:   13 LVSGINHAMARLVDIWDSIGIMEDQRIERMQTVKKHIEDLLRDMITEEETLRHRIRTSIITTQKELETLCLEMSMDPYRLEEDLTVLQLEKNLRCQLETLQKEKNER-------LRELNDLRQ-----QDEELCVTL-------CSTPYYIPSGSLPSQTQLQELKEHIKNLSVEKESRVKVFSGLREDIKNLMDEMGHEPETSLERDSVGSDTDI------------FLLTHENIQALKLLLSQLEIKKESLISSRDKLKNRATSLWHRLSYPEEEAEEFKQEA 266          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Cavefish
Match: zgc:86764 (protein regulator of cytokinesis 1-like [Source:NCBI gene;Acc:103035917])

HSP 1 Score: 51.6026 bits (122), Expect = 2.100e-6
Identity = 61/284 (21.48%), Postives = 131/284 (46.13%), Query Frame = 2
Query:  221 VISSCDKRFHELSVIWDYIGYESSDKEKRIEEITNAFGEMLDGIIMKENQLRLEIESDIENKKREITQLCQQLKIPTYFPPRDLTSYNLLKVLKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLINDSEQCQKMKENIKNPDSDDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFER-SILKEFDDLPKSNETVNLSEKLTITDELLDKMQNL--RLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKEF 1063
            ++S  +     L  IWD IG     + +R++ +     ++L  +I +E  LR  I + I   ++E+  LC ++ +  Y    DLT   L K L+ + + LQ  + ER        + + +LR+      D E C  +        S    I    LP++++++  ++++ +L  + +  +  +  L  D+  +  ++ +  E+  ER S+  + D    ++E +  + KL     LL + +N   RL++++R A L    +++R  L+ +W +     + ++ F
Sbjct:   13 LVSGINHAMARLVDIWDSIGIMEDQRIERMQTVKKHIEDLLRDMITEEETLRHRIRTSIITTQKELETLCLEMSMDPYRLEEDLTVLQLEKNLRCQLETLQKEKNER-------LRELNDLRQ-----QDEELCVTL-------CSTPYYIPSGSLPSQTQLQELKEHIKNLSVEKESRVKVFSGLREDIKNLMDEMGHEPETSLERDSVGSDTDIFLLTHENIQ-ALKL-----LLSQWRNTVERLEVLQR-ARLEEVIDKVRQELVVLWDKCMFGPEQREPF 270          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003386.1 (pep scaffold:Pmarinus_7.0:GL476526:231695:243607:-1 gene:ENSPMAG00000003080.1 transcript:ENSPMAT00000003386.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.3673 bits (246), Expect = 2.719e-22
Identity = 114/464 (24.57%), Postives = 205/464 (44.18%), Query Frame = 2
Query:  245 FHELSVIWDYIGYESSDKEKRIEEITNAFGEMLDGIIMKENQLRLEIESDIENKKREITQLCQQLKIPTYFPPRDLTSYNLLKVLKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLINDSEQCQKMKENIKNPDSDDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFDDLPKSNETVNLSEKLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKEFMQQCSGYKPDVLELLQEEVSKCQQMKWENI----------------SVYYSGXXXXXXXXXXXXXXSSVVKDXXXXXXXXXXXXXXXXXXXIDQLKEKYEKYQTLYDTVANYQNLWMTYLDVESQMKDPAILSNRGGIXXXXXXXXXXXXXXXXXXXAIVAEAIAQYEKNNKTKFYVWNNLTFKDYV--QH 1582
             + L  +W+ +G     +E+RI+++ +   ++++ +I +E  LR  +E  I      I +LC++L +P Y P  +     L   L+ K ++L+  + ER                 +S++ + E  Q M        S         +PTE E+ T R Y+  LE         + +    +      +    E++FER ++  F++           EKL ++D+ L K++ L  ++  +K    +TC+ LRS L +MW  L + E+ +KEF  +   Y+  V E L  E+ +  Q++ +NI                  YY     +          +  V              +   E+E++++K  Y++Y  L+  VA ++  W  +L+ E +  DP   +NRGG LLK EKE+ +L K LPK E  +A  + ++E+    KF V +   F  Y+  QH
Sbjct:   17 LNRLQTLWEDMGIVKVQQEERIKKVKDLVEQLMEQMIAEEEDLRDSLEERIHEHMSNIQELCKELTLPAYEPVEEYLVLQLESHLRQKLQQLRVKKAER-----------------LSVLQELEHQQAMLTKALGVSSHPKPAGS--VPTEDELNTLRHYVDGLELQKNSNFKVFVAYKEQIEACFQILGVGPETEFEREVI--FNN-----------EKLCLSDDGLLKVEELLKEVQFKKEKAEATCQRLRSELEAMWNLLQVPENERKEFAAKTQSYQKSVEEALTSELKRLAQVRKDNIKWLIIPIRNEIEGYWGKSYYGQEQRKAFSPFYNDEYTEDV--------------LVEHERELERMKGYYDQYCKLFSLVAKWEQSWKMFLEFEQKAADPNRFANRGGNLLKEEKERAKLQKMLPKLEEELAVQVGEWEEAQGCKFLV-DGCNFLAYISMQH 433          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008406.1 (pep scaffold:Pmarinus_7.0:GL486182:143584:152595:-1 gene:ENSPMAG00000007591.1 transcript:ENSPMAT00000008406.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.6481 bits (200), Expect = 1.482e-16
Identity = 109/466 (23.39%), Postives = 212/466 (45.49%), Query Frame = 2
Query:  221 VISSCDKRFHELSVIWDYIGYESSDKEKRIEEITNAFGEMLDGIIMKENQLRLEIESDIENKKREITQLCQQLKIPTYFPPRDLTSYNLLKVLKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLINDSEQ--CQKMKENIKNPDSDDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFDDLPKSNETVNLSEKLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKEFMQQCSGYKPDVLELLQEEVSKCQQMKWENISVYYSGXXXXXXXXXXXXXXSS----VVKDXXXXXXXXXXXXXXXXXXXIDQLKEKYEKYQTLYDTVANYQNLWMTYLDVESQMKDPAILSNRGGIXXXXXXXXXXXXXXXXXXXAIVAEAIAQYEKNNKTKFYVWNNLTFKDYVQHLWTEFR 1600
            +++S +     L  IW+ IG     + +R + +      +L+ ++ +E  L+  +   +   K E+  LC  L +P + P  +LT   LL++ KD    ++ +  E+++           LR+L SL +D+E+  C  + E  + P     S     +P+  ++   RQ + +L ++     + +      +    A +E S +S FER +  E +            E+  ++ + +  +Q L  ++ +  A+    C ELR  +  +W RLN+++  +  F       KP  ++ L++E+S+  ++K +N+    +G+  E   + +K  +S              +  +EE +   E+E ++L+  +E+++ LYD V  +   W     V  +  DP   SNRGG LL+ EK++  L K LPK E  +   IA +E+    +F V       DY+   W  F+
Sbjct:   12 LVASLNHAMVNLRDIWEDIGIPEEQRLERTQVVKKYMERLLNEMVSEEEALKDRLMKSVATCKMELQGLCSDLSLPAFQPDENLT---LLQLEKDTRTRMETLVREKRE----------RLRELQSL-DDAEERLCGVLCE--RRPHRPPTSGP---VPSIEQLALLRQAVATLVAEKTRRQELFTQTRQQIVMCMAQLERSPDSSFERDVACEDE------------EEFCLSKDNILSLQTLLTQLERECALNDEVCSELRDEVGRLWDRLNVEQGERDAFTACVHDSKPSDMDKLKQELSRLVELKRQNVRTVLAGVRSEIAALWEKCYVSEEEQRAFTPYHSGADDATEELLVQHEEEANRLRGHHEQHRALYDGVRRWDAAWQPVPGVRGRAADPNRFSNRGGSLLREEKQRAHLQKGLPKLEEDLKAQIAVWEEQAGRRFQVAGRPLL-DYIAAQWEAFK 445          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Nematostella
Match: EDO48824 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIL7])

HSP 1 Score: 67.781 bits (164), Expect = 6.472e-12
Identity = 95/474 (20.04%), Postives = 224/474 (47.26%), Query Frame = 2
Query:  221 VISSCDKRFHELSVIWDYIGYESSDKEKRIEEITNAFGEMLDGIIMKENQLRLEIESDIENKKREITQLCQQLKIPTYFPPRDLTSYNLLKVLKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLINDSEQ--CQKMKENIKNPDSDDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFDDLPKSNETVNLSEKLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKEFMQQCSGYKPDVLELLQEEVSKCQQMKWENISVYYSGXXXXXXXXXXXXXXSSVVKDXXX--XXXXXXXXXXXXXXXXIDQLKEKYEKYQTLYDTVANYQNLWMTYLDVESQMKDPAILSNRGGIXXXXXXXXXXXXXXXXXXXAIVAEAIAQYEKNNKTKFYVWNNLTFKDYVQHLWTEFRNRKDSAKYRR 1630
            ++S  +     L  IW+ IG     KE R + +      +L  ++ +E  L+  + ++++    E+ +L Q+L +P  +P  D  S  +L++  D   ++ +++ E+ +             K++ ++ D+E+  C +++  + + +  D+ +     P + ++      +  L+   Q+  D++  +   +  +   +EY  ++  E+ +++     P S     LS   T+    LD ++ L+L++ +++     T  +L     S+W +L +DE+ ++ F  +  G+KP  +  +++E  + Q +K +++  +  GL  E      K       ++        + +EE ++  E +++ +K  +E+ + ++  V   + ++    ++E +  D    SNRGG LLK  + ++ L KELPK E  +   IA++E+ N+ +F V +   + + ++  W   + +K+  K  R
Sbjct:   10 LVSCLENSMENLQKIWNEIGIADEQKEDRTQVVLKHLQSLLQEMVEEEELLKNTLLANVKTCTEELEKLSQELGVP--YPQLD-QSQTILRLENDLRTKVDELKMEKHERI-----------KVLKVLRDTERQLCDRLR--LPSHNIGDVVV-----PNKEQMRELEANIDYLQKQLQKRTDEFIRMKASIQGMWTSLEYRPQTALEKKMVE-----PNSESHFELS---TVN---LDALKVLQLELEQQQRANCETAAKLLDDCKSLWKKLEVDEEEQEAFTAKWKGFKPSTIAAMKDEKQRLQALKLQHMQKFIEGLREELVSFWDKCYYGEDQRNTFVPFFDTNFTEELLAIHEHQVEVMKGFFEENKHMFKMVEKRETMFKKMEELELKQNDVNRFSNRGGALLKECRSRRVLEKELPKLEKELRTEIAKWEEENEQQFMV-HGTRYAELMEQQWENLKIQKEQVKQER 450          
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Medaka
Match: prc1a (protein regulator of cytokinesis 1 [Source:NCBI gene;Acc:101163655])

HSP 1 Score: 90.1225 bits (222), Expect = 1.885e-18
Identity = 110/449 (24.50%), Postives = 214/449 (47.66%), Query Frame = 2
Query:  254 LSVIWDYIGYESSDKEKRIEEITNAFGEMLDGIIMKENQLRLEIESDIENKKREITQLCQQLKIPTYFPPRDLTSYNLLKVLKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLINDSEQCQKMKENIKNPDSDDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFDDLPKSNETVNLSEKLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKEFMQQCSGYKPDVLELLQEEVSKCQQMKWENISVYYSGXXXXXXXXXXXXXXSSVVKDXXXX--XXXXXXXXXXXXXXXIDQLKEKYEKYQTLYDTVANYQNLWMTYLDVESQMKDPAILSNRGGIXXXXXXXXXXXXXXXXXXXAIVAEAIAQYEKNNKTKFYVWNNLTFKDYVQHLWTE 1594
            L  IW+ IG     + +R  ++      +LD +I +E +L+  +   IE  ++E++ LC +L++P   P  +     +L++ K+    L+ ++  ++Q        + ELR L+S   D E C+ M      P      I    +P+  ++ET++ YL  L  + +   D++ S+  ++     D+E   E+ FE  ++ E +D               ++++ +  ++ L  ++ +RKA     C   R  +  +W RL I ++ +  F +     K   +E LQ EV + + +K +++  +   +  E   + K    S   ++       +S +E+ ++  E E+ +LK  Y+ ++ L++ V  + + W  YL+++ +  DP+  +NRGG LLK EK++  L K LPK E  +   I  +E+ +   F V N   F DYVQ  W +
Sbjct:    4 LQEIWEEIGIPEEQRIQRTNDVHKHIKGLLDLMIAEEAELKKRLTESIEVCRKELSSLCAELQLP---PFEEEDGCTMLQLEKNSRTRLEVMKEHKKQ-------RMEELRGLIS--KDQELCEIM---CTTP----FFINHSSVPSLDQLETYKAYLNDLTKEKERRRDEFVSIKKEIVVCMDDLEQIPETSFETDVICEDED------------AFCLSNDNIAALKLLLGQLEERKAKNELLCSGYRRQIQELWERLQIPQEERDAFSEHMLKSKKKNIEALQAEVQRLEVLKKQSLKSFTENIRTEIASLWKSCFYSQEQQEAFAPYYDDSFTEDLLNLHEAEVGELKRYYDDHKELFEGVMKWHDNWNLYLELDKKANDPSRFNNRGGNLLKEEKQRTDLQKSLPKLERSLKVQIDAWEQEHGRDFLV-NGQKFLDYVQQQWIQ 420          
BLAST of Protein regulator of cytokinesis 1 vs. Planmine SMEST
Match: SMESG000016705.1 (SMESG000016705.1)

HSP 1 Score: 912.524 bits (2357), Expect = 0.000e+0
Identity = 509/511 (99.61%), Postives = 510/511 (99.80%), Query Frame = 2
Query:  161 NLENKEKPLPISMGSPLLDIVISSCDKRFHELSVIWDYIGYESSDKEKRIEEITNAFGEMLDGIIMKENQLRLEIESDIENKKREITQLCQQLKIPTYFPPRDLTSYNLLKVLKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLINDSEQCQKMKENIKNPDSDDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFDDLPKSNETVNLSEKLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKEFMQQCSGYKPDVLELLQEEVSKCQQMKWENISVYYSGXXXXXXXXXXXXXXSSVVKDXXXXXXXXXXXXXXXXXXXIDQLKEKYEKYQTLYDTVANYQNLWMTYLDVESQMKDPAILSNRGGIXXXXXXXXXXXXXXXXXXXAIVAEAIAQYEKNNKTKFYVWNNLTFKDYVQHLWTEFRNRKDSAKYRRPGPGSQSVTNSPKRVTSPRVK 1693
            NLENKEKPLPISMGSPLLD VISSCDKRFHELSVIWDYIGYESSDKEKRIEEITNAFGEMLDGIIMKENQLRLEIESDIENKKREITQLCQQLKIPTYFPPRDLTSYNLLKVLKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLINDSEQCQKMKENIKNPDSDDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFDDLPKSNETVNLSEKLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKK+FMQQCSGYKPDVLELLQEEVSKCQQMKWENISVYYSGLLYEKEEIEKKLLISSVVKDVEFSVESLSEESVSSLEQEIDQLKEKYEKYQTLYDTVANYQNLWMTYLDVESQMKDPAILSNRGGILLKTEKEKKRLLKELPKTEAIVAEAIAQYEKNNKTKFYVWNNLTFKDYVQHLWTEFRNRKDSAKYRRPGPGSQSVTNSPKRVTSPRVK
Sbjct:    2 NLENKEKPLPISMGSPLLDTVISSCDKRFHELSVIWDYIGYESSDKEKRIEEITNAFGEMLDGIIMKENQLRLEIESDIENKKREITQLCQQLKIPTYFPPRDLTSYNLLKVLKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLINDSEQCQKMKENIKNPDSDDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFDDLPKSNETVNLSEKLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKDFMQQCSGYKPDVLELLQEEVSKCQQMKWENISVYYSGLLYEKEEIEKKLLISSVVKDVEFSVESLSEESVSSLEQEIDQLKEKYEKYQTLYDTVANYQNLWMTYLDVESQMKDPAILSNRGGILLKTEKEKKRLLKELPKTEAIVAEAIAQYEKNNKTKFYVWNNLTFKDYVQHLWTEFRNRKDSAKYRRPGPGSQSVTNSPKRVTSPRVK 512          
BLAST of Protein regulator of cytokinesis 1 vs. Planmine SMEST
Match: SMESG000016705.1 (SMESG000016705.1)

HSP 1 Score: 889.412 bits (2297), Expect = 0.000e+0
Identity = 497/499 (99.60%), Postives = 498/499 (99.80%), Query Frame = 2
Query:  197 MGSPLLDIVISSCDKRFHELSVIWDYIGYESSDKEKRIEEITNAFGEMLDGIIMKENQLRLEIESDIENKKREITQLCQQLKIPTYFPPRDLTSYNLLKVLKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLINDSEQCQKMKENIKNPDSDDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFDDLPKSNETVNLSEKLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKEFMQQCSGYKPDVLELLQEEVSKCQQMKWENISVYYSGXXXXXXXXXXXXXXSSVVKDXXXXXXXXXXXXXXXXXXXIDQLKEKYEKYQTLYDTVANYQNLWMTYLDVESQMKDPAILSNRGGIXXXXXXXXXXXXXXXXXXXAIVAEAIAQYEKNNKTKFYVWNNLTFKDYVQHLWTEFRNRKDSAKYRRPGPGSQSVTNSPKRVTSPRVK 1693
            MGSPLLD VISSCDKRFHELSVIWDYIGYESSDKEKRIEEITNAFGEMLDGIIMKENQLRLEIESDIENKKREITQLCQQLKIPTYFPPRDLTSYNLLKVLKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLINDSEQCQKMKENIKNPDSDDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFDDLPKSNETVNLSEKLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKK+FMQQCSGYKPDVLELLQEEVSKCQQMKWENISVYYSGLLYEKEEIEKKLLISSVVKDVEFSVESLSEESVSSLEQEIDQLKEKYEKYQTLYDTVANYQNLWMTYLDVESQMKDPAILSNRGGILLKTEKEKKRLLKELPKTEAIVAEAIAQYEKNNKTKFYVWNNLTFKDYVQHLWTEFRNRKDSAKYRRPGPGSQSVTNSPKRVTSPRVK
Sbjct:    1 MGSPLLDTVISSCDKRFHELSVIWDYIGYESSDKEKRIEEITNAFGEMLDGIIMKENQLRLEIESDIENKKREITQLCQQLKIPTYFPPRDLTSYNLLKVLKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLINDSEQCQKMKENIKNPDSDDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGRISADIEYSGESDFERSILKEFDDLPKSNETVNLSEKLTITDELLDKMQNLRLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKDFMQQCSGYKPDVLELLQEEVSKCQQMKWENISVYYSGLLYEKEEIEKKLLISSVVKDVEFSVESLSEESVSSLEQEIDQLKEKYEKYQTLYDTVANYQNLWMTYLDVESQMKDPAILSNRGGILLKTEKEKKRLLKELPKTEAIVAEAIAQYEKNNKTKFYVWNNLTFKDYVQHLWTEFRNRKDSAKYRRPGPGSQSVTNSPKRVTSPRVK 499          
The following BLAST results are available for this feature:
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
PRC17.242e-2024.84protein regulator of cytokinesis 1 [Source:HGNC Sy... [more]
PRC18.577e-2024.84protein regulator of cytokinesis 1 [Source:HGNC Sy... [more]
PRC11.825e-1225.81protein regulator of cytokinesis 1 [Source:HGNC Sy... [more]
back to top
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sofe9.618e-723.05gene:FBgn0030242 transcript:FBtr0346273[more]
sofe9.618e-723.05gene:FBgn0030242 transcript:FBtr0073409[more]
back to top
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
prc1b5.540e-1923.09protein regulator of cytokinesis 1b [Source:ZFIN;A... [more]
prc1a1.731e-1623.78protein regulator of cytokinesis 1a [Source:ZFIN;A... [more]
prc1a2.140e-1623.78protein regulator of cytokinesis 1a [Source:ZFIN;A... [more]
back to top
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prc12.294e-2123.94protein regulator of cytokinesis 1 [Source:NCBI ge... [more]
prc18.070e-2122.94protein regulator of cytokinesis 1 [Source:NCBI ge... [more]
prc11.119e-2023.80protein regulator of cytokinesis 1 [Source:NCBI ge... [more]
prc13.900e-2023.80protein regulator of cytokinesis 1 [Source:NCBI ge... [more]
prc14.011e-2022.80protein regulator of cytokinesis 1 [Source:NCBI ge... [more]
back to top
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prc13.963e-2224.79protein regulator of cytokinesis 1 [Source:MGI Sym... [more]
Prc17.682e-2224.79protein regulator of cytokinesis 1 [Source:MGI Sym... [more]
Prc18.384e-2224.79protein regulator of cytokinesis 1 [Source:MGI Sym... [more]
Prc18.760e-2224.79protein regulator of cytokinesis 1 [Source:MGI Sym... [more]
Prc15.872e-1224.55protein regulator of cytokinesis 1 [Source:MGI Sym... [more]
back to top
BLAST of Protein regulator of cytokinesis 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q99K43|PRC1_MOUSE5.864e-2124.79Protein regulator of cytokinesis 1 OS=Mus musculus... [more]
sp|O43663|PRC1_HUMAN4.119e-1924.84Protein regulator of cytokinesis 1 OS=Homo sapiens... [more]
back to top
BLAST of Protein regulator of cytokinesis 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YCV01.801e-7533.70Protein regulator of cytokinesis OS=Fasciola gigan... [more]
A0A4E0S1042.761e-7434.08Protein regulator of cytokinesis OS=Fasciola hepat... [more]
A0A267EBI67.052e-7033.54Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GGR82.436e-6933.33Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FQF12.513e-6933.33Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prc1a3.734e-1823.94protein regulator of cytokinesis 1 [Source:NCBI ge... [more]
prc1a9.790e-1020.58protein regulator of cytokinesis 1 [Source:NCBI ge... [more]
zgc:867641.196e-821.05protein regulator of cytokinesis 1-like [Source:NC... [more]
zgc:867641.221e-821.05protein regulator of cytokinesis 1-like [Source:NC... [more]
zgc:867642.100e-621.48protein regulator of cytokinesis 1-like [Source:NC... [more]
back to top
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000003386.12.719e-2224.57pep scaffold:Pmarinus_7.0:GL476526:231695:243607:-... [more]
ENSPMAT00000008406.11.482e-1623.39pep scaffold:Pmarinus_7.0:GL486182:143584:152595:-... [more]
back to top
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO488246.472e-1220.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein regulator of cytokinesis 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
prc1a1.885e-1824.50protein regulator of cytokinesis 1 [Source:NCBI ge... [more]
back to top
BLAST of Protein regulator of cytokinesis 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000016705.10.000e+099.61SMESG000016705.1[more]
SMESG000016705.10.000e+099.60SMESG000016705.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003095 ID=SMED30003095|Name=Protein regulator of cytokinesis 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1942bp
TTTCTCTTCAATTGGCACACACACGTGCACGCACACAGACGCGTGCATCA
GCAAAGTCCGTAATTCGATTCACTCTACCCCAATAGGCATGCATTTTCAA
TAACAATTACTTCGTCAACTGGACAATATTGTATTTATTGATTGGATCTA
TTCTTCGAAAAATCTAGAAAACAAAGAAAAACCCCTGCCAATTTCAATGG
GATCACCTTTGCTTGATATAGTTATATCCAGTTGCGATAAGCGTTTCCAT
GAACTTTCCGTCATTTGGGATTATATCGGCTATGAATCGAGTGATAAAGA
AAAACGAATCGAAGAAATCACAAATGCGTTCGGGGAAATGTTAGATGGAA
TCATAATGAAAGAGAATCAGCTTCGACTAGAAATCGAGTCGGATATTGAA
AACAAAAAACGCGAAATTACACAGCTTTGTCAGCAATTAAAAATACCGAC
ATATTTCCCCCCTCGAGATTTGACGTCATATAATTTATTGAAGGTGCTAA
AAGATAAAACCAAAGAGCTTCAAGATATTCGAACAGAACGTCAACAGTCA
TTCTTTACTATTTATAAAAATATAATGGAACTAAGAAAATTAATGTCCTT
AATCAACGATTCAGAACAATGTCAGAAAATGAAAGAAAACATTAAAAATC
CAGACAGTGATGATATTTCAATCAAAGAAGAATATTTACCCACAGAATCC
GAAGTTGAAACATTCCGTCAATATCTTACCTCATTAGAGTCAGATTATCA
AGAATTATTAGACAAATATTATAGCCTTTTAAACGACGTTGGAAGAATCT
CAGCAGATATTGAATATTCAGGTGAATCTGATTTCGAAAGATCCATATTA
AAAGAGTTCGACGATCTTCCGAAAAGCAATGAAACTGTAAATCTATCAGA
AAAATTAACCATTACCGATGAATTATTGGACAAAATGCAAAATTTGAGAT
TGAAAATGGTTAAACGAAAAGCAATGCTTGTAAGTACATGTGAAGAATTA
AGATCTTATCTTCTCTCCATGTGGTATCGGCTAAACATTGACGAAGACTC
GAAAAAAGAATTTATGCAACAATGTTCTGGATACAAACCTGATGTCCTTG
AATTGCTTCAGGAAGAAGTGAGTAAATGTCAGCAAATGAAATGGGAAAAC
ATTTCAGTCTATTATTCTGGTTTATTATACGAGAAAGAAGAGATTGAAAA
AAAACTGTTAATAAGTTCAGTCGTAAAAGACGTCGAGTTTTCAGTTGAGA
GCCTTTCTGAAGAATCTGTCAGTTCTTTGGAACAAGAAATCGATCAGTTA
AAGGAGAAATACGAAAAATATCAGACATTATATGACACCGTAGCAAATTA
TCAAAATCTTTGGATGACATATTTAGACGTAGAAAGTCAAATGAAAGATC
CAGCAATTCTTAGTAATAGGGGTGGTATTTTGCTCAAAACAGAAAAAGAA
AAAAAACGCCTGTTGAAAGAACTACCAAAAACCGAAGCCATTGTTGCTGA
AGCCATTGCTCAATATGAAAAAAATAACAAAACCAAATTCTACGTTTGGA
ACAATTTAACTTTTAAAGATTACGTTCAACATTTGTGGACCGAGTTCAGA
AATCGAAAGGATAGCGCAAAATACAGACGGCCGGGTCCAGGTTCACAATC
TGTCACAAATTCTCCGAAAAGAGTCACCTCACCAAGAGTAAAATAAGTAT
GAATGTCAATAAAACTGATCTCGAGTTTTGTGGAAAATTTAGTATCCATT
AGTATTAATAAATTTTTGATTTGGAAAAAAAAATATTGAATCGCTTTTTT
TTCACGTTAAATTTTTTTTAATTGAAAAAAATCAGTCGATTTGCTATTTA
TACACAATTTTTGTCATTTTTTCATTGAGTTTTTTTGTTTCGTCGGTTGA
TGTTATTACAAATCACTTTTCGTTTGAAATTTTATTTTTTTC
back to top

protein sequence of SMED30003095-orf-1

>SMED30003095-orf-1 ID=SMED30003095-orf-1|Name=SMED30003095-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=500bp
MGSPLLDIVISSCDKRFHELSVIWDYIGYESSDKEKRIEEITNAFGEMLD
GIIMKENQLRLEIESDIENKKREITQLCQQLKIPTYFPPRDLTSYNLLKV
LKDKTKELQDIRTERQQSFFTIYKNIMELRKLMSLINDSEQCQKMKENIK
NPDSDDISIKEEYLPTESEVETFRQYLTSLESDYQELLDKYYSLLNDVGR
ISADIEYSGESDFERSILKEFDDLPKSNETVNLSEKLTITDELLDKMQNL
RLKMVKRKAMLVSTCEELRSYLLSMWYRLNIDEDSKKEFMQQCSGYKPDV
LELLQEEVSKCQQMKWENISVYYSGLLYEKEEIEKKLLISSVVKDVEFSV
ESLSEESVSSLEQEIDQLKEKYEKYQTLYDTVANYQNLWMTYLDVESQMK
DPAILSNRGGILLKTEKEKKRLLKELPKTEAIVAEAIAQYEKNNKTKFYV
WNNLTFKDYVQHLWTEFRNRKDSAKYRRPGPGSQSVTNSPKRVTSPRVK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR007145MAP65_Ase1_PRC1
IPR011528NERD
Vocabulary: biological process
TermDefinition
GO:0000226microtubule cytoskeleton organization
GO:0000910cytokinesis
Vocabulary: molecular function
TermDefinition
GO:0008017microtubule binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 351..378
NoneNo IPR availableCOILSCoilCoilcoord: 53..80
NoneNo IPR availableGENE3DG3DSA:1.20.58.1520coord: 365..487
e-value: 2.0E-25
score: 91.3
NoneNo IPR availablePFAMPF03999MAP65_ASE1coord: 34..477
e-value: 1.3E-45
score: 156.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 480..499
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 474..499
NoneNo IPR availablePANTHERPTHR19321:SF0FASCETTO-RELATEDcoord: 17..478
IPR007145Microtubule-associated protein, MAP65/Ase1/PRC1PANTHERPTHR19321PROTEIN REGULATOR OF CYTOKINESIS 1 PRC1-RELATEDcoord: 17..478