Glycoprotein 3-alpha-L-fucosyltransferase A-like protein

Overview
NameGlycoprotein 3-alpha-L-fucosyltransferase A-like protein
Smed IDSMED30003087
Length (bp)1617
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein (SMED30003087) t-SNE clustered cells

Violin plots show distribution of expression levels for Glycoprotein 3-alpha-L-fucosyltransferase A-like protein (SMED30003087) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein (SMED30003087) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glycoprotein 3-alpha-L-fucosyltransferase A-like protein (SMED30003087) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003087

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30003087SMESG000054535.1 dd_Smed_v4_8368_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30003087SMESG000054535.1 dd_Smed_v4_8368_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003087SMESG000054535.1 dd_Smed_v4_8368_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003087SMESG000054535.1 dd_Smed_v4_8368_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30003087SMESG000054535.1 dd_Smed_v6_8368_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30003087SMESG000054535.1 dd_Smed_v4_8368_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Human
Match: FUT4 (fucosyltransferase 4 [Source:HGNC Symbol;Acc:HGNC:4015])

HSP 1 Score: 148.673 bits (374), Expect = 3.316e-38
Identity = 88/255 (34.51%), Postives = 128/255 (50.20%), Query Frame = 2
Query:  674 RPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANP-QPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNTCFNLLN--KHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTFF---WCRLCMMAHEGENVKSVLRDVYKW 1420
            RPP Q W +   ESP H+    +  +N   L NWT +YR DS +  PY    LY  ++P  P     P ++    K  + AW VS+      R+    +L +++ VD++G  G       QP     LL+    YKFYLAFENS   DYITEK + N L    +P+V+G    +Y R  P  ++IHV+DF S + LA Y+ +LD+N   Y  YF W+    V   +F+   WCR+C       +    +R++  W
Sbjct:  286 RPPGQRWVWMNFESPSHSPGLRSLASN---LFNWTLSYRADSDVFVPYG--YLYPRSHPGDPPSGLAPPLSR---KQGLVAWVVSHWDERQARVRYYHQLSQHVTVDVFGRGGP-----GQPVPEIGLLHTVARYKFYLAFENSQHLDYITEKLWRNALLAGAVPVVLGPDRANYERFVPRGAFIHVDDFPSASSLASYLLFLDRNPAVYRRYFHWRRSYAVHITSFWDEPWCRVCQAVQRAGDRPKSIRNLASW 527          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Human
Match: FUT7 (fucosyltransferase 7 [Source:HGNC Symbol;Acc:HGNC:4018])

HSP 1 Score: 141.354 bits (355), Expect = 6.576e-37
Identity = 88/270 (32.59%), Postives = 135/270 (50.00%), Query Frame = 2
Query:  581 VNQCKLTANRELATSAAVVLWMHNII------VPFHRRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGC-GKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTFFWCRLCMM 1369
            + +C L+ANR L  SA  V++ H  +      +P  +RP  Q W +  +ESP HT       ++   + NW  +YR DS I  PY +  L     P P   PLP       K ++AAW VSN      R  +  +L  +++VD++G   G+  C      +C       Y+FYL+FENS  RDYITEKF+ N L    +P+V+G     Y    P  +++HV+DF S  +LA ++  +  N++ Y  +F+W+    V   T +  R C +
Sbjct:   73 IARCHLSANRSLLASADAVVFHHRELQTRRSHLPLAQRPRGQPWVWASMESPSHTHGL----SHLRGIFNWVLSYRRDSDIFVPYGR--LEPHWGPSP---PLP------AKSRVAAWVVSNFQERQLRARLYRQLAPHLRVDVFGRANGRPLC-----ASCLVPTVAQYRFYLSFENSQHRDYITEKFWRNALVAGTVPVVLGPPRATYEAFVPADAFVHVDDFGSARELAAFLTGM--NESRYQRFFAWRDRLRVRLFTDWRERFCAI 320          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Human
Match: FUT6 (fucosyltransferase 6 [Source:HGNC Symbol;Acc:HGNC:4017])

HSP 1 Score: 136.732 bits (343), Expect = 4.487e-35
Identity = 96/288 (33.33%), Postives = 139/288 (48.26%), Query Frame = 2
Query:  590 CKLTANRELATSAAVVLWMHNII-------VPFHRRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTFFW----CRLCMMAHEGENVKSVLRDVYKW 1420
            C +TA+R++   A  V+  H  +       +P   R   Q W ++ +ESP H  Q    +       N T +YR DS I  PY          P   +   P +N +A K ++ AW VSN    + R+     LQ ++KVD+YG   K   P  Q  T    L++ YKFYLAFENS   DYITEK + N L+   +P+V+G    +Y R  PP ++IHV+DF S   LA Y++ LDK+   Y  YF W+    +   +F W    C+ C    E    ++  R +  W
Sbjct:   90 CNITADRKVYPQADAVIVHHREVMYNPSAQLPRSPRRQGQRWIWFSMESPSHCWQLKAMDG----YFNLTMSYRSDSDIFTPYG------WLEPWSGQPAHPPLNLSA-KTELVAWAVSNWGPNSARVRYYQSLQAHLKVDVYGRSHK---PLPQ-GTMMETLSR-YKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWR--ETLRPRSFSWALAFCKACWKLQEESRYQT--RGIAAW 357          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Human
Match: FUT6 (fucosyltransferase 6 [Source:HGNC Symbol;Acc:HGNC:4017])

HSP 1 Score: 136.732 bits (343), Expect = 4.487e-35
Identity = 96/288 (33.33%), Postives = 139/288 (48.26%), Query Frame = 2
Query:  590 CKLTANRELATSAAVVLWMHNII-------VPFHRRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTFFW----CRLCMMAHEGENVKSVLRDVYKW 1420
            C +TA+R++   A  V+  H  +       +P   R   Q W ++ +ESP H  Q    +       N T +YR DS I  PY          P   +   P +N +A K ++ AW VSN    + R+     LQ ++KVD+YG   K   P  Q  T    L++ YKFYLAFENS   DYITEK + N L+   +P+V+G    +Y R  PP ++IHV+DF S   LA Y++ LDK+   Y  YF W+    +   +F W    C+ C    E    ++  R +  W
Sbjct:   90 CNITADRKVYPQADAVIVHHREVMYNPSAQLPRSPRRQGQRWIWFSMESPSHCWQLKAMDG----YFNLTMSYRSDSDIFTPYG------WLEPWSGQPAHPPLNLSA-KTELVAWAVSNWGPNSARVRYYQSLQAHLKVDVYGRSHK---PLPQ-GTMMETLSR-YKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWR--ETLRPRSFSWALAFCKACWKLQEESRYQT--RGIAAW 357          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Human
Match: FUT6 (fucosyltransferase 6 [Source:HGNC Symbol;Acc:HGNC:4017])

HSP 1 Score: 136.732 bits (343), Expect = 4.487e-35
Identity = 96/288 (33.33%), Postives = 139/288 (48.26%), Query Frame = 2
Query:  590 CKLTANRELATSAAVVLWMHNII-------VPFHRRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTFFW----CRLCMMAHEGENVKSVLRDVYKW 1420
            C +TA+R++   A  V+  H  +       +P   R   Q W ++ +ESP H  Q    +       N T +YR DS I  PY          P   +   P +N +A K ++ AW VSN    + R+     LQ ++KVD+YG   K   P  Q  T    L++ YKFYLAFENS   DYITEK + N L+   +P+V+G    +Y R  PP ++IHV+DF S   LA Y++ LDK+   Y  YF W+    +   +F W    C+ C    E    ++  R +  W
Sbjct:   90 CNITADRKVYPQADAVIVHHREVMYNPSAQLPRSPRRQGQRWIWFSMESPSHCWQLKAMDG----YFNLTMSYRSDSDIFTPYG------WLEPWSGQPAHPPLNLSA-KTELVAWAVSNWGPNSARVRYYQSLQAHLKVDVYGRSHK---PLPQ-GTMMETLSR-YKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWR--ETLRPRSFSWALAFCKACWKLQEESRYQT--RGIAAW 357          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Celegans
Match: fut-1 (Alpha-(1,3)-fucosyltransferase fut-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EDR5])

HSP 1 Score: 171.014 bits (432), Expect = 2.295e-47
Identity = 112/300 (37.33%), Postives = 163/300 (54.33%), Query Frame = 2
Query:  512 KEKLILLFNGMAGVTNKELEQCPVNQCKLTANRELATSAAVVLWMH--NIIVPFHRRPPNQIWAFYFLESPIHT-VQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWK-GYGLV-------DTNTFFW--CRLCMMA 1372
            +++LIL +N  AG +   L+ CP   C+ T  R  A  A  VL  H  N  VP     PNQ   ++  ESP ++ +Q P     P+  +N T  +RHD+   +PY  YT+  L         +   N   GK K AAWFVS+C + + R   V +LQK++++DIYGGCG + C R   + C  +L+  Y FY+ FENS C DY+TEK + +G +N IIP+V+    +      PP+S+I ++DF S+ ++ DY+ YL  N TAY EYF W+  Y +V       D     W  C++C MA
Sbjct:  116 QKRLILSWN--AGHSQDNLQGCPDWNCEFTQVRARAPDADAVLIAHMDNDFVP----KPNQYVVYFSQESPANSGIQIP----RPD-YINMTLGFRHDTPAGSPYG-YTV-KLGAKSRKTGQVVDANLVNGKAKGAAWFVSHCQTNSKREDFVKKLQKHLQIDIYGGCGPMKCARGD-SKCDTMLDTDYHFYVTFENSICEDYVTEKLWKSGYQNTIIPLVLKR--KLVEPFVPPNSFIAIDDFKSVKEMGDYLNYLMNNKTAYMEYFEWRHDYKVVFLDGSHHDVLERPWGFCQVCRMA 399          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Celegans
Match: fut-1 (Alpha-(1,3)-fucosyltransferase fut-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EDR5])

HSP 1 Score: 171.014 bits (432), Expect = 2.295e-47
Identity = 112/300 (37.33%), Postives = 163/300 (54.33%), Query Frame = 2
Query:  512 KEKLILLFNGMAGVTNKELEQCPVNQCKLTANRELATSAAVVLWMH--NIIVPFHRRPPNQIWAFYFLESPIHT-VQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWK-GYGLV-------DTNTFFW--CRLCMMA 1372
            +++LIL +N  AG +   L+ CP   C+ T  R  A  A  VL  H  N  VP     PNQ   ++  ESP ++ +Q P     P+  +N T  +RHD+   +PY  YT+  L         +   N   GK K AAWFVS+C + + R   V +LQK++++DIYGGCG + C R   + C  +L+  Y FY+ FENS C DY+TEK + +G +N IIP+V+    +      PP+S+I ++DF S+ ++ DY+ YL  N TAY EYF W+  Y +V       D     W  C++C MA
Sbjct:  116 QKRLILSWN--AGHSQDNLQGCPDWNCEFTQVRARAPDADAVLIAHMDNDFVP----KPNQYVVYFSQESPANSGIQIP----RPD-YINMTLGFRHDTPAGSPYG-YTV-KLGAKSRKTGQVVDANLVNGKAKGAAWFVSHCQTNSKREDFVKKLQKHLQIDIYGGCGPMKCARGD-SKCDTMLDTDYHFYVTFENSICEDYVTEKLWKSGYQNTIIPLVLKR--KLVEPFVPPNSFIAIDDFKSVKEMGDYLNYLMNNKTAYMEYFEWRHDYKVVFLDGSHHDVLERPWGFCQVCRMA 399          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Celegans
Match: fut-4 (Alpha-1->3-fucosyltransferase homologue; FUcosyl Transferase [Source:UniProtKB/TrEMBL;Acc:G5EEL7])

HSP 1 Score: 137.887 bits (346), Expect = 8.188e-36
Identity = 108/308 (35.06%), Postives = 161/308 (52.27%), Query Frame = 2
Query:  542 MAGVTNKELEQCPVNQCKLTAN-RELATSAAVVLWMHNI-----IVPFHR--RPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVEL-QKYIKVDIYGGCGK--LSCPRHQPNT--CFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPH-SYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSW-KGYGLVDTNTFF-WCRLCMMAHEGENVKSVLRDVYK 1417
            MA +T  EL++     C++T N  E +TS A++    N      I+P  +  R PN  W  + +ESP H  Q PT +N    L NWT TYR D+ + APY      D+    P +  +  I   + K K A W  SNC +PNNR+ ++ ++ QK ++ D++G CG    +C   Q  T  C   L + YKFYLA ENSNC DY+TEKF+ +      +PIV+    E  R++  P  +YI V+DF ++ +  D+++ +      Y ++  W K Y ++  N F  WCRLC    + EN+    R  YK
Sbjct:   71 MAFLTCPELKKF----CRVTRNFSEASTSDALLFHSRNFFEAVKILPNLKKLRKPNVPWILWNIESPSHE-QLPTEKN----LFNWTMTYRRDADLWAPYGYMEKMDV----PAKIDVNSI--WSLKTKTATWLGSNCNTPNNRIQLIGKMIQKGLEADVWGACGAPPGACMGVQKRTEPCVRELIEPYKFYLALENSNCVDYVTEKFWKSLGDRMAVPIVL--QREVVRQLGVPDPAYISVDDFQNLEEFVDFVEKVGSEKDFYLKFHEWRKDYRVIFDNGFSGWCRLCERLQD-ENLILENRKFYK 360          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Celegans
Match: fut-6 (Alpha-(1,3)-fucosyltransferase fut-6 [Source:UniProtKB/Swiss-Prot;Acc:G5EEE1])

HSP 1 Score: 120.168 bits (300), Expect = 1.920e-29
Identity = 102/327 (31.19%), Postives = 155/327 (47.40%), Query Frame = 2
Query:  533 FNGMAGVTNKELEQCP--VNQCKLTANRELATSAAVVLWMHNI-----IVPFHR----RPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAA---GKDKMAAWFVSNCASPNNRMGIVVEL-QKYIKVDIYGGCGK----LSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHS-YIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTFF--WCRLCMMAHEGE----NVKSVLRDVYKWWSGGE 1435
            F G    T + L  CP   N C++T       +A  VL  HN         F +    R P   +  + LESP + +  P      + ++NWT TYR DS + APY   T+  L NP        +++  A   GK K A W  SNC + N+R  ++ ++     ++DI+G CGK     +   +Q + C   L K YKFY++ ENSNC+DY+TEKF+        IPIV+    + Y+ +  P S YI V+D+ ++ +   ++K ++K    +  Y  W+    V   + F  WC LC    + +    N KS  +DV  WW   E
Sbjct:   74 FFGHPITTERFLATCPDVQNYCRITQEESEFDNADAVL-FHNADYRGSTDKFKKMKSQRKPGVPYVLWSLESPTNDMFRPD-----SHMINWTMTYRTDSDVWAPYG--TIVKLKNPV-------EVDLNAIWEGKTKTATWLASNCITQNHRFDLIKKIIDNGFEIDIWGNCGKQVSQCAGVDNQESPCVLELIKPYKFYISMENSNCKDYVTEKFWKALNDRMTIPIVLAR--KYYKDLGVPDSAYIAVDDYATLDEFLAHVKKVNKEKDLFLSYHQWRKEWKVIIGSGFSGWCTLCNKLQDKDYILKNPKS-YKDV-AWWHSFE 381          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Celegans
Match: fut-3 (Alpha-(1,3)-fucosyltransferase fut-3 [Source:UniProtKB/Swiss-Prot;Acc:G5EFP5])

HSP 1 Score: 113.62 bits (283), Expect = 4.397e-27
Identity = 94/338 (27.81%), Postives = 161/338 (47.63%), Query Frame = 2
Query:  509 IKEKLILLFNGMAGVT--NKELEQCP--VNQCKLTANRELATSAAVVLWMHNIIVPFH---RRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTL-YDLANPQPDR----YPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCG-----KLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTF-------FWCRLCMMAHEGEN----VKSVLRDVYKWWSGGEQ 1438
            +  K IL +  + G T  +  L  CP   ++C +  NR    SA  V++    I  F     R P+QI+ F  +E+P ++ +F      P+   NWT+T+ + S  +  Y  + +   +A  +  +    Y  PK      K       +SNC + + R   + EL K+I V I G C      K  CP      C ++  + Y FY+A EN+ C DY+TEK + + +    IPIVM      Y+ + PP S+I ++D+ + +++A++++ L+ N TAY EYF W+  GL  +  +         CR+C +  + ++    V     +++KW+    Q
Sbjct:   62 LAPKRILYWTTIFGATVPSTALSDCPGLTDRCVIDTNRHQLDSADAVVFHAADISKFPLPVSRKPDQIFVFNSMETPDNSGRFAV----PDGFFNWTSTHLYSSDAIHKYGTFLIPTQIAESRGFKVQSYYVQPKRLVKTMKGIFG--LISNCHTKSKRELALQELGKHINVTIGGKCASDDRLKSICPAGV--ECIDVF-EQYPFYIAIENTVCNDYVTEKIW-SRITVPSIPIVM--RRRVYQNILPPKSFIAMDDYKNPSEMANHLRSLEANSTAYGEYFEWRQKGLWTSAPWNAPGYRNGLCRVCELLWKAKDNETEVYKSYDNIWKWFDNESQ 387          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Fly
Match: FucTA (gene:FBgn0036485 transcript:FBtr0331831)

HSP 1 Score: 308.145 bits (788), Expect = 1.437e-98
Identity = 167/367 (45.50%), Postives = 219/367 (59.67%), Query Frame = 2
Query:  416 LFPHLTNDSNDDRIWNQMRYRPNQFINGSLNIKEKLILLFNGMAGVTNKELE------QCPVNQCKLTANRELATSAAVVLWMHNIIVPFHRRPPN--QIWAFYFLESPIHT--VQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTFFWCRLCMMAHEGENVKSV--LRDVYKWWSGGEQKICIKAEMWKNQKS 1480
            L PH   D   DRI NQ+ Y P+ +     + K K ILL+NG+     K+        +CPV+ C+LTANR+LA++A ++L+  + I    RRP N  Q+   Y+LE P HT  V+ P         +NWTATYR DSTIVAPY K+  YD    Q ++     IN++  K K  AWFVSNC + N R+    ELQKYI+VDIYG CG   C R   + CF +L+  YKFYLAFENSNC+DYITEKFF+N L   ++PIVMGA PEDY   AP  SYIHV++F S  +LA+Y++ LD +D  YN YF WKG G    NT++WCR+C   H  E ++      D+  WW G    +C     W+N K+
Sbjct:  143 LLPH--QDPYSDRIINQLMYVPHNYEEIKSSGKLKTILLYNGLGPWNVKKGRDVFLKAKCPVDTCELTANRDLASTADMILYKDHYIPTGIRRPSNSKQVSMLYYLECPYHTQNVKVP-------DAINWTATYRRDSTIVAPYEKWQYYDTKVQQQEQ----DINYSVNKTKKVAWFVSNCGARNGRLQYAHELQKYIEVDIYGACGNFKCSRSTADKCFEILDNDYKFYLAFENSNCKDYITEKFFVNALNRRVLPIVMGARPEDYEVSAPRRSYIHVDEFSSPKELAEYLRILDHDDELYNSYFKWKGTGEF-INTYYWCRVCATLHNEEQLRKPRWYTDLNDWWRG--PGVCT-TRSWRNFKA 492          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Fly
Match: FucTA (gene:FBgn0036485 transcript:FBtr0075641)

HSP 1 Score: 308.145 bits (788), Expect = 1.437e-98
Identity = 167/367 (45.50%), Postives = 219/367 (59.67%), Query Frame = 2
Query:  416 LFPHLTNDSNDDRIWNQMRYRPNQFINGSLNIKEKLILLFNGMAGVTNKELE------QCPVNQCKLTANRELATSAAVVLWMHNIIVPFHRRPPN--QIWAFYFLESPIHT--VQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTFFWCRLCMMAHEGENVKSV--LRDVYKWWSGGEQKICIKAEMWKNQKS 1480
            L PH   D   DRI NQ+ Y P+ +     + K K ILL+NG+     K+        +CPV+ C+LTANR+LA++A ++L+  + I    RRP N  Q+   Y+LE P HT  V+ P         +NWTATYR DSTIVAPY K+  YD    Q ++     IN++  K K  AWFVSNC + N R+    ELQKYI+VDIYG CG   C R   + CF +L+  YKFYLAFENSNC+DYITEKFF+N L   ++PIVMGA PEDY   AP  SYIHV++F S  +LA+Y++ LD +D  YN YF WKG G    NT++WCR+C   H  E ++      D+  WW G    +C     W+N K+
Sbjct:  143 LLPH--QDPYSDRIINQLMYVPHNYEEIKSSGKLKTILLYNGLGPWNVKKGRDVFLKAKCPVDTCELTANRDLASTADMILYKDHYIPTGIRRPSNSKQVSMLYYLECPYHTQNVKVP-------DAINWTATYRRDSTIVAPYEKWQYYDTKVQQQEQ----DINYSVNKTKKVAWFVSNCGARNGRLQYAHELQKYIEVDIYGACGNFKCSRSTADKCFEILDNDYKFYLAFENSNCKDYITEKFFVNALNRRVLPIVMGARPEDYEVSAPRRSYIHVDEFSSPKELAEYLRILDHDDELYNSYFKWKGTGEF-INTYYWCRVCATLHNEEQLRKPRWYTDLNDWWRG--PGVCT-TRSWRNFKA 492          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Fly
Match: FucTC (gene:FBgn0044872 transcript:FBtr0299926)

HSP 1 Score: 159.458 bits (402), Expect = 4.294e-43
Identity = 105/307 (34.20%), Postives = 151/307 (49.19%), Query Frame = 2
Query:  572 QCPVNQCKLTANRELATSAAV---VLWMHNIIVPFHR-----RPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKY---TLYDLANPQ---PDRYPLPKIN------FAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKG-YGLVDTNTFFWCRLCMMAHEGE--NVKSVLRDVYKWW 1423
             CPV QC+++       +  +   +++    + P  R     R P+Q++ F  +E P  T       ++     N T TYR DS +  PY +    T   +  P    P R P    N        +GK K AAWFVS+C + + R  +   LQ++ +VDIYG CG LSC R  P+ C  +L+  Y FYLAFENS C DY+TEK F + L+  +IP+V G    DY R+ PPHSY+    F S+  LA Y+K +  +   Y  YF W+  Y L  ++ F  C LC   H+    +      D+  WW
Sbjct:  116 HCPVYQCEISNQNAFLPAVELYDAIVFHAAEMFPLLRPVPSQRSPHQVYVFALMEPPGETKHR---LDDEQGFYNLTMTYRIDSDVFWPYGQLLDITADAVVAPSVKPPWRKPPVAFNDSLVWDLWSGKTKTAAWFVSHCETLSKREVLANRLQEFFEVDIYGNCGTLSCTRGDPH-CAEMLDTDYFFYLAFENSLCDDYVTEKLF-DALERTVIPVVFGG--ADYSRILPPHSYVDANRFMSVEGLAQYMKLVVADPDLYVSYFWWRSHYRLTYSSPF--CDLCARLHDPSFGHKTQFYHDIQSWW 413          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Fly
Match: FucTD (gene:FBgn0035217 transcript:FBtr0072693)

HSP 1 Score: 67.0106 bits (162), Expect = 1.719e-11
Identity = 66/270 (24.44%), Postives = 107/270 (39.63%), Query Frame = 2
Query:  692 WAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASP---NNRMGIVV----------------ELQKYIKVDIYGGC-GKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTFFWCRLCMMAHEGENVKSVLRDVYK-----WWS 1426
            +A Y  + P+ + Q P   N      N T TYR DS ++     ++  +LA  +   +  P  +FA   D M A  V    S     +R+ + +                EL+KY  +D +  C G   C              HY F L FE S C DY+  +  +  +   ++P+++G    +   + P HSYI  +DF +   L  ++K L  N   Y  YF W     +   +  +C LC +  +      V +  Y      WW+
Sbjct:  187 YAVYAAKKPLSSTQNP-LTNFTLPPFNLTMTYRLDSQLIWTDYYFSHTNLAR-RLKWFRAPSKSFA---DDMPATTVLRLESEILKKSRLAVYLVYEVNEKTLPESLYMEELRKYADLDAHDNCLGTDDC-------------SHYHFMLIFETSACPDYVPPQMSM-AMDKLLVPVLIGGG--NLTNLVPSHSYISSQDFATPQDLIIHLKDLANNQLEYRRYFWWHSIYRLRKTSQPYCALCSLIQQSPGGHEVRQRSYSLGFINWWT 435          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Fly
Match: FucTB (gene:FBgn0032117 transcript:FBtr0079811)

HSP 1 Score: 66.6254 bits (161), Expect = 2.182e-11
Identity = 78/267 (29.21%), Postives = 113/267 (42.32%), Query Frame = 2
Query:  569 EQCPVNQCKLTANRELATSA-AVVLWMHNIIVPFHRRPPN--QIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAA---GKDKMA-------AWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGK-LSCPRH-QPNTCFNLLN-------KHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEY 1303
             QC ++ C++T  R     A  V+ +  NI       P N  QIWA    ESP +T     F +N   L ++     H ++  + YS   L  +  P  +   L   ++     GK K          +  S+C + + R   V EL K++ +D YG C +    P   Q +   NL +         YKF +A EN+ C DYITEKF+   L   +IPI  G+ P          S I V DF +   L +Y+  L  N   YN Y
Sbjct:   58 RQCGIHTCRITNKRSRRPWARGVLFYGSNIKTGDFPLPRNEHQIWALLHEESPRNT----PFVSNKEFLRHF-----HFTSTFSRYSNLPLTTMYLPSGE--ALTSKDYYVTFDGKSKYGYRPSTSVVFLQSDCDTMSGREDYVKELMKHLPIDSYGSCLRNRDLPESLQKDYLNNLYSPELLRFLSEYKFMIAIENAACPDYITEKFW-RPLIMGVIPIYFGS-PTIKDWEPNNKSAIFVNDFQNPQALVEYLNKLADNKKLYNSY 311          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Zebrafish
Match: ft1 (alpha(1,3)fucosyltransferase gene 1 [Source:ZFIN;Acc:ZDB-GENE-990715-17])

HSP 1 Score: 135.191 bits (339), Expect = 1.933e-34
Identity = 97/293 (33.11%), Postives = 156/293 (53.24%), Query Frame = 2
Query:  581 VNQCKLTANRELATSAAVVLWMHNII---VPFHRRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVN----WTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTF---FWCRLCMMAHEGENVKSVLRDVYKWWSG 1429
            ++ C LT +R +   A  V++ H  +   +P   RP  Q W ++ +ESP ++        +PNSL+N     T+++R DS I  PY +  L D  + Q + + +PK      KDK+  W VSN    + R     EL K+IKV+ YGG       R       N+++   KFYL+FENS  RDY TEK F N L    +P+V+G   ++Y    P  ++IHV+DF +  +LAD++K LD+N+  Y +YFSW+ + +  +++F     CR C      ++  ++ +D+  W+ G
Sbjct:  136 IHGCHLTDDRSMIQKAHGVMFHHRDLSADLPQPPRPAFQKWIWWNMESPSNS--------HPNSLINDGFNLTSSFRKDSDIPVPYGR--LIDATDEQKN-FTIPK------KDKLVCWIVSNFQEHHKRSQYYNELVKHIKVEAYGGHFN---NRVNDEDYGNVVSS-CKFYLSFENSIHRDYFTEKLF-NPLALGTVPVVLGPSRDNYEEFIPRDAFIHVDDFPTPKELADHLKLLDQNEEQYRQYFSWRKHFISMSSSFGLEHACRTCDYLKRNKHYIAI-KDLKGWFWG 405          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Zebrafish
Match: fut7 (fucosyltransferase 7 (alpha (1,3) fucosyltransferase) [Source:ZFIN;Acc:ZDB-GENE-060929-997])

HSP 1 Score: 133.265 bits (334), Expect = 3.326e-34
Identity = 90/269 (33.46%), Postives = 131/269 (48.70%), Query Frame = 2
Query:  581 VNQCKLTANRELATSAAVVLWMHNIIVPFHR--------RPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTFFWCRLC 1363
            ++ C L  N+ L  SA +V+  HN  + FH+        RP  Q W +  LE+P +      F+N    + N T +Y   + I  PY K  L    NP  D      +     K   A W +SN    + R  +  EL K + V +YG  G+   P+         +++ Y FYLAFEN     YITEK + N  +   +P+V+G    DY  V PP S+IHV+DF S+  L++Y++ L K+   YNEYFSW+   +V   T +  RLC
Sbjct:   80 ISGCILVDNQTLYESADLVV-FHNFELMFHKQQLPLHLYRPAKQRWVWLSLEAPQNNGNLSPFKN----IFNLTMSYHPGADITVPYGKLLLR--TNPGLD------VIVPKSKRYEACWVISNYKKWHKRSEVFQELTKSLNVQLYGSFGQKPLPKE---ALLPTISRCY-FYLAFENVQSPHYITEKLWRNAFQARTVPVVLGPPRTDYEAVTPPKSFIHVDDFKSVKALSEYLRGLIKDPEKYNEYFSWQKKYVVKLYTDWRERLC 331          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Zebrafish
Match: fut9b (fucosyltransferase 9b [Source:ZFIN;Acc:ZDB-GENE-030131-9925])

HSP 1 Score: 130.568 bits (327), Expect = 3.582e-33
Identity = 102/303 (33.66%), Postives = 147/303 (48.51%), Query Frame = 2
Query:  581 VNQCKLTANRELATSAAVVLWMHNII------VPFHRRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSN---CASPNNRMGIVVELQKYIKVDIYGGCGK--LSCPRHQP--NTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNG-LKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKG------YGLVDTNTFFW--CRLCMMAHEGENVKSVLRDVYKWW 1423
            ++ CKLT +R L T++  V+  H  I      +P   RPP Q W +  LESP +T + P  EN    L N T +YR D+ I     +  L     P  D + +PK      KDK+  W VSN       + R     EL K+IKV ++G      LS   + P  ++C        KFYL+FENS  +DYITEK  +NG L    +P+V+G   ++Y    P  ++IHVEDF     LA+Y+  LD++D AY  YF+W+       + ++ T  F    C  C       + K    D+Y W+
Sbjct:   76 IDNCKLTDDRSLYTNSDAVMVYHRGISWDLSNLPPSPRPPFQKWIWLHLESPTNTKKIPGLEN----LFNLTLSYRQDADIAV---RMRLKTRKKPAED-FVVPK------KDKLVCWIVSNNDPSTGVSARNKYYQELSKHIKVTLFGRAYSWFLSYDEYYPTLSSC--------KFYLSFENSIHKDYITEK--INGPLAAGTVPVVLGPPRKNYENFVPGDAFIHVEDFQDPKSLAEYLHLLDRDDVAYRRYFNWRKHLTPTPHLILQTQEFVLAICTACDYIARHRDYKEA-HDIYDWY 353          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Zebrafish
Match: fut9b (fucosyltransferase 9b [Source:ZFIN;Acc:ZDB-GENE-030131-9925])

HSP 1 Score: 130.954 bits (328), Expect = 3.595e-33
Identity = 102/303 (33.66%), Postives = 147/303 (48.51%), Query Frame = 2
Query:  581 VNQCKLTANRELATSAAVVLWMHNII------VPFHRRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSN---CASPNNRMGIVVELQKYIKVDIYGGCGK--LSCPRHQP--NTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNG-LKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKG------YGLVDTNTFFW--CRLCMMAHEGENVKSVLRDVYKWW 1423
            ++ CKLT +R L T++  V+  H  I      +P   RPP Q W +  LESP +T + P  EN    L N T +YR D+ I     +  L     P  D + +PK      KDK+  W VSN       + R     EL K+IKV ++G      LS   + P  ++C        KFYL+FENS  +DYITEK  +NG L    +P+V+G   ++Y    P  ++IHVEDF     LA+Y+  LD++D AY  YF+W+       + ++ T  F    C  C       + K    D+Y W+
Sbjct:   93 IDNCKLTDDRSLYTNSDAVMVYHRGISWDLSNLPPSPRPPFQKWIWLHLESPTNTKKIPGLEN----LFNLTLSYRQDADIAV---RMRLKTRKKPAED-FVVPK------KDKLVCWIVSNNDPSTGVSARNKYYQELSKHIKVTLFGRAYSWFLSYDEYYPTLSSC--------KFYLSFENSIHKDYITEK--INGPLAAGTVPVVLGPPRKNYENFVPGDAFIHVEDFQDPKSLAEYLHLLDRDDVAYRRYFNWRKHLTPTPHLILQTQEFVLAICTACDYIARHRDYKEA-HDIYDWY 370          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Zebrafish
Match: si:ch1073-440p11.2 (si:ch1073-440p11.2 [Source:ZFIN;Acc:ZDB-GENE-140106-39])

HSP 1 Score: 126.331 bits (316), Expect = 1.126e-31
Identity = 89/302 (29.47%), Postives = 144/302 (47.68%), Query Frame = 2
Query:  563 ELEQCP----VNQCKLTANRELATSAAVVLWMHNII------VPFHRRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTF---FWCRLCMMAHEGENVKSVLRDVYKWWSG 1429
            +L+ C     ++ C LT +R     A  V + H  I      +P   RP  Q W +  +ESP ++ ++ + ++    L N T++YR DS I  PY +      +   P             K K+  W VSN  S   R     EL+K+I +D+YG     +  +   +  +  +    +FYL+FENS  +DYITEK F N L    +P+V+G    +Y    P  ++IH+EDF     LA+++K L+KN+  Y +YFSW+   +   ++F     CR C       N + V+ ++  W+ G
Sbjct:   77 DLDSCSSMFDIHSCHLTDDRGYFQEADGVFFHHRDIDADLSNIPNQPRPRLQKWIWMNMESPSNSPRYSSLDD----LFNLTSSYRLDSDISVPYGRLISGKTSGSIPK------------KTKLVCWIVSNWNSTYKRSQYYQELKKHINIDVYGN----AFSKRISSEDYTSVVSSCRFYLSFENSVHKDYITEKLF-NPLILGTVPVVLGPPRRNYEEQIPAGAFIHIEDFSGPEGLAEHLKLLEKNEDLYMQYFSWREEFVASESSFGLEHACRACDHVRRHRNYR-VVNELNGWYWG 356          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Xenopus
Match: map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:Xenbase;Acc:XB-GENE-6046272])

HSP 1 Score: 160.229 bits (404), Expect = 9.250e-44
Identity = 112/307 (36.48%), Postives = 158/307 (51.47%), Query Frame = 2
Query:  518 KLILLFNGMAGVTNKELEQCPV----NQCKLTANREL-ATSAAVVLWMHNII-----VPFHRRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWK---GYGLVDTNTFFWCRLCMMAHEGENVKSV 1399
            K+ILL+    G T   L QCP       C  TANR L + +AAVVL   ++      +P  +RPPNQ W ++ LESP H       E     L+N T TYR DS I  PY     +D      +   +P+      K K+ AW VSN    + R+    EL+ ++ VD++G   +L  PR   +     L+K YKFYLAFENS   DYITEK + N L +  +P+V+G    +Y R  PP ++IHV+DF +   LADY+  LDK+D  Y +YF W+     G        +C++C    E  + ++V
Sbjct:   55 KIILLWTWPFG-TAFPLNQCPSQFDGTGCFFTANRSLYSEAAAVVLHSRDVCSSKNQLPQMQRPPNQYWIWFTLESPSHNYNTSFVEK----LINLTMTYRADSDIFTPYGWLERHDGT----ENVSIPE------KTKLVAWVVSNWNPNSRRVKYYGELKNHLAVDVFGN-QRLQLPR---DKHIETLSK-YKFYLAFENSIHEDYITEKLWRNALASWAVPVVLGPTRANYERFLPPDAFIHVDDFPTAKGLADYLHALDKDDNRYKQYFYWRRSLKLGAPARLNSHYCKVCKAIKEAPSYRTV 341          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Xenopus
Match: pdx1 (pancreatic and duodenal homeobox 1 [Source:Xenbase;Acc:XB-GENE-483331])

HSP 1 Score: 159.073 bits (401), Expect = 3.408e-43
Identity = 104/288 (36.11%), Postives = 142/288 (49.31%), Query Frame = 2
Query:  581 VNQCKLTANRELATSAAVVLWMHNII-----VPFHRRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTFF---WCRLCMMAHEGENVKSVLRDVYKW 1420
            V  C +T NR L   A  +++ H  I     +PF RR  +Q W +   ESP H+    +       + NWT +YR DS I  PY       L + +  +  LP+      K K+ AW +SN    + R+    EL+ YI++DIYG  G       + N    +    YKFYLAFENS   DYITEK + N  K+N IPIVMG    +Y    P +S+IHV+DF S  KLA Y+K+LDKN   Y  YF+WK    V   +F+   +C  C       N +    D+  W
Sbjct:   93 VTGCHITTNRSLYQEADAIVFHHRDIADFSDLPFRRRQSSQKWIWMNFESPSHSPWLASL----GGIFNWTMSYRVDSDIFMPYGF-----LFSKKHAKIVLPR------KRKLVAWVISNWNEDHERVQYYNELRNYIQIDIYGRYG---LDLKEDNIIKTV--SEYKFYLAFENSLHTDYITEKLWRNAFKSNAIPIVMGPSRHNYEMFIPRNSFIHVDDFSSPRKLAMYLKHLDKNTHLYRRYFTWKKRYDVHVTSFWDEHYCTACQSVKAAGNQRRTASDLAGW 360          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Xenopus
Match: ENSXETT00000024642.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:14774369:14775646:-1 gene:ENSXETG00000015101.1 transcript:ENSXETT00000024642.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 157.918 bits (398), Expect = 6.838e-43
Identity = 106/324 (32.72%), Postives = 163/324 (50.31%), Query Frame = 2
Query:  500 SLNIKEKLILLFNGMAGVTNKELEQCPVNQCKLTANRELATSAAVVLWMHNII------VPFHRRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNTCFNLLNK--HYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGY-------GLVDTNTFFWCRLCMMAHEGENVKSVLRDVYKWWS 1426
            ++  K  +++L       +   L +CP   C  T +R + +SA  V++ H  +      +P   RPP Q W ++ LESPI+T          N L+N T +YR DS I  PY   T  +        + +P+      K K+ AW VSN    + R+ +  +L++YI +D+YG        +H   +   L  K   YKFYLAFENS  RDYITEKF+ N L +  +PIV+G   E+Y R  P  ++IHV+DF +  +LADY+  LDK+D  Y +YF W+         G  D    ++C  C +  +    ++V   + KW++
Sbjct:   55 AVRKKSSVVILLWTWPFDSRFPLNRCPEPGCWYTDDRNMYSSANAVIFHHRDVYKSKSQLPQMPRPPGQYWVWFNLESPINTPNLDMM----NDLMNLTMSYRADSDIFTPYGSITRQNSNK----TFTIPE------KSKLVAWAVSNWNPNSMRVQVYEQLKQYIHIDVYGR-------KHSILSNAKLFEKISQYKFYLAFENSVHRDYITEKFWRNALFSGSVPIVLGPPRENYERFIPRDAFIHVDDFSNTKQLADYLLQLDKDDKKYQQYFKWRSRYKSKHFTGWAD----YYCAACKVLKDAPEFRTVT-SLEKWFT 352          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Xenopus
Match: acmsd (aminocarboxymuconate semialdehyde decarboxylase [Source:Xenbase;Acc:XB-GENE-962248])

HSP 1 Score: 156.377 bits (394), Expect = 2.147e-42
Identity = 111/312 (35.58%), Postives = 161/312 (51.60%), Query Frame = 2
Query:  518 KLILLFNGMAGVTNKELEQCPV----NQCKLTANREL-ATSAAVVLWMHNII-----VPFHRRPPNQIWAFYFLESPIHTVQFPTFENNPNS-----LVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGY---GLVDTNTFFWCRLCMMAHEGENVKSV 1399
            K+ILL+    G     L QCP       C  T NR L + +AAVVL   ++      +P  +RPPNQ W ++ LESP H         NPN+     L+N T TYR DS I  PY     +D      +   +P+      K K+ AW VSN    + R+    EL+ ++ VD++G   +L  PR   +     L+K YKFYLAFENS   DYITEK + N L +  +P+V+G    +Y R  PP ++IHV+DF +   LADY+  LDK+D  Y ++F+W+        D+    +C++C    E  + ++V
Sbjct:   55 KIILLWTWPFGFAF-PLNQCPSQFDGTGCFFTVNRSLYSEAAAVVLHSRDVCSSKNQLPQMQRPPNQYWIWFTLESPSH---------NPNTGFMEKLINLTMTYRADSDIFTPYGWLERHDGT----ENVSIPE------KTKLVAWVVSNWNPNSRRVKYYGELKNHLAVDVFGN-QRLQLPR---DKHIETLSK-YKFYLAFENSIHEDYITEKLWHNALASWAVPVVLGPTRANYERFLPPDAFIHVDDFPTAKGLADYLHALDKDDNRYKQHFNWRRSLKPVAPDSWNTHYCKVCKAIKEAPSYRTV 341          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Xenopus
Match: clca3p (chloride channel accessory 3, pseudogene [Source:Xenbase;Acc:XB-GENE-5813523])

HSP 1 Score: 155.606 bits (392), Expect = 4.470e-42
Identity = 112/313 (35.78%), Postives = 161/313 (51.44%), Query Frame = 2
Query:  518 KLILLFNGMAGVTNKELEQCPV----NQCKLTANREL-ATSAAVVLWMHNII-----VPFHRRPPNQIWAFYFLESPIHTVQFPTFENNPNS-----LVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSW----KGYGLVDTNTFFWCRLCMMAHEGENVKSV 1399
            K+ILL+    G T   L QCP       C  T NR L + +AAVVL   ++      +P  +RPPNQ W ++ +ESP H         NPN+     L+N T TYR DS I  PY     +D      +   +P+      K K+ AW VSN    + R+    EL+ ++ VD++G   +L  PR +       L+K YKFYLAFENS   DYITEK + N L +  +P+V+G    +Y R  PP ++IHV+DF +   LADY+  LDK+D  + +YF W    K       N+ + C++C    E  + ++V
Sbjct:   55 KIILLWTWPFG-TAFPLNQCPSQFDGTGCFFTVNRSLYSEAAAVVLHSRDVCSSKNQLPQMQRPPNQYWIWFTMESPSH---------NPNTGFMEKLINLTMTYRADSDIFTPYGWLERHDGT----ENVSIPE------KTKLVAWVVSNWNPNSRRVKYYGELKNHLAVDVFGN-QRLPLPREK---HIETLSK-YKFYLAFENSIHEDYITEKLWHNALASWAVPVVLGPTRANYERFLPPDAFIHVDDFPTAKGLADYLHALDKDDNRHKQYFYWRRSLKPVAPARLNSHY-CKVCKAIKEAPSYRTV 341          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Mouse
Match: Fut4 (fucosyltransferase 4 [Source:MGI Symbol;Acc:MGI:95594])

HSP 1 Score: 147.517 bits (371), Expect = 1.612e-38
Identity = 90/249 (36.14%), Postives = 124/249 (49.80%), Query Frame = 2
Query:  674 RPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPL-PKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNTCFNLLN--KHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTFF---WCRLCMMAH-EGENVKSV 1399
            RPP Q W +   ESP HT   P        L NWT +YR DS +  PY    LY  ++P      L P++   A K  + AW VSN      R+    +L +++ VD++G  G       +P     LL+    YKFYLAFENS   DYITEK + N      +P+V+G    +Y R  P  ++IHV+DF + A LA Y+ +LD+N   Y  YF W+    V   +F+   WCR C      G+  KS+
Sbjct:  189 RPPGQRWVWMNFESPSHT---PGLRGLAKDLFNWTLSYRTDSDVFVPYG--FLYSRSDPTEQPSGLGPQL---ARKRGLVAWVVSNWNEHQARVRYYHQLSRHVSVDVFGRTGP-----GRPVPAIGLLHTVARYKFYLAFENSRHVDYITEKLWRNAFLAGAVPVVLGPDRANYERFVPRGAFIHVDDFPNAASLAAYLLFLDRNVAVYRRYFRWRRSFAVHITSFWDEQWCRTCQAVQTSGDQPKSI 424          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Mouse
Match: Fut7 (fucosyltransferase 7 [Source:MGI Symbol;Acc:MGI:107692])

HSP 1 Score: 143.665 bits (361), Expect = 6.164e-38
Identity = 85/252 (33.73%), Postives = 128/252 (50.79%), Query Frame = 2
Query:  581 VNQCKLTANRELATSAAVVLWMH------NIIVPFHRRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYG-GCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWK 1315
            +  C+L+ANR L  SA  V++ H        ++P  +RP  Q W +  +ESP +T     F      + NW  +YR DS I  PY +  L  L+ P     PLP       K +MAAW +SN      R  +  +L  +++VD++G   G+  C       C       Y+FYLAFENS  RDYITEKF+ N L    +P+ +G     Y    PP +++HV+DF S  +LA ++  +  N++ Y  +F+W+
Sbjct:   73 MASCRLSANRSLLASADAVVFHHRELQTRQSLLPLDQRPHGQPWVWASMESPSNTHGLHRFRG----IFNWVLSYRRDSDIFVPYGR--LEPLSGPTS---PLP------AKSRMAAWVISNFQERQQRAKLYRQLAPHLQVDVFGRASGRPLC-----ANCLLPTLARYRFYLAFENSQHRDYITEKFWRNALAAGAVPVALGPPRATYEAFVPPDAFVHVDDFSSARELAVFL--VSMNESRYRGFFAWR 302          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Mouse
Match: Fut7 (fucosyltransferase 7 [Source:MGI Symbol;Acc:MGI:107692])

HSP 1 Score: 143.665 bits (361), Expect = 6.164e-38
Identity = 85/252 (33.73%), Postives = 128/252 (50.79%), Query Frame = 2
Query:  581 VNQCKLTANRELATSAAVVLWMH------NIIVPFHRRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYG-GCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWK 1315
            +  C+L+ANR L  SA  V++ H        ++P  +RP  Q W +  +ESP +T     F      + NW  +YR DS I  PY +  L  L+ P     PLP       K +MAAW +SN      R  +  +L  +++VD++G   G+  C       C       Y+FYLAFENS  RDYITEKF+ N L    +P+ +G     Y    PP +++HV+DF S  +LA ++  +  N++ Y  +F+W+
Sbjct:   73 MASCRLSANRSLLASADAVVFHHRELQTRQSLLPLDQRPHGQPWVWASMESPSNTHGLHRFRG----IFNWVLSYRRDSDIFVPYGR--LEPLSGPTS---PLP------AKSRMAAWVISNFQERQQRAKLYRQLAPHLQVDVFGRASGRPLC-----ANCLLPTLARYRFYLAFENSQHRDYITEKFWRNALAAGAVPVALGPPRATYEAFVPPDAFVHVDDFSSARELAVFL--VSMNESRYRGFFAWR 302          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Mouse
Match: Fut7 (fucosyltransferase 7 [Source:MGI Symbol;Acc:MGI:107692])

HSP 1 Score: 143.28 bits (360), Expect = 2.281e-37
Identity = 85/252 (33.73%), Postives = 128/252 (50.79%), Query Frame = 2
Query:  581 VNQCKLTANRELATSAAVVLWMH------NIIVPFHRRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYG-GCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWK 1315
            +  C+L+ANR L  SA  V++ H        ++P  +RP  Q W +  +ESP +T     F      + NW  +YR DS I  PY +  L  L+ P     PLP       K +MAAW +SN      R  +  +L  +++VD++G   G+  C       C       Y+FYLAFENS  RDYITEKF+ N L    +P+ +G     Y    PP +++HV+DF S  +LA ++  +  N++ Y  +F+W+
Sbjct:  120 MASCRLSANRSLLASADAVVFHHRELQTRQSLLPLDQRPHGQPWVWASMESPSNTHGLHRFRG----IFNWVLSYRRDSDIFVPYGR--LEPLSGPT---SPLP------AKSRMAAWVISNFQERQQRAKLYRQLAPHLQVDVFGRASGRPLC-----ANCLLPTLARYRFYLAFENSQHRDYITEKFWRNALAAGAVPVALGPPRATYEAFVPPDAFVHVDDFSSARELAVFL--VSMNESRYRGFFAWR 349          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Mouse
Match: Fut9 (fucosyltransferase 9 [Source:MGI Symbol;Acc:MGI:1330859])

HSP 1 Score: 133.265 bits (334), Expect = 4.780e-34
Identity = 96/272 (35.29%), Postives = 135/272 (49.63%), Query Frame = 2
Query:  581 VNQCKLTANRELATSAAVVLWMHNII------VPFHRRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGC-GKLSCPRH---QPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTFFWCRLCM 1366
            +  C LT +R L   +  VL  H  I      +P   RPP Q W +  LESP HT Q    E+    L N T TYR DS I  PY   T+    +  P  + +P       K+K+  W VSN    + R+    EL K I++  YG   G+    ++     +TC        KFYL+FENS  +DYITEK + N      +P+V+G   E+Y    P  S+IHVEDF+S ++LA Y+K +DKN+  Y  YF+W+    V+   F+    C+
Sbjct:   88 IQGCHLTTDRSLYNKSHAVLIHHRDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEH----LFNLTLTYRRDSDIQVPYGFLTV----STNPFVFEVP------SKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQAFGEYVNDKNLIPTISTC--------KFYLSFENSIHKDYITEKLY-NAFLAGSVPVVLGPSRENYENYIPADSFIHVEDFNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFWESHACL 336          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. UniProt/SwissProt
Match: sp|Q9VUL9|FUCTA_DROME (Glycoprotein 3-alpha-L-fucosyltransferase A OS=Drosophila melanogaster OX=7227 GN=FucTA PE=2 SV=2)

HSP 1 Score: 308.145 bits (788), Expect = 1.441e-97
Identity = 167/367 (45.50%), Postives = 219/367 (59.67%), Query Frame = 2
Query:  416 LFPHLTNDSNDDRIWNQMRYRPNQFINGSLNIKEKLILLFNGMAGVTNKELE------QCPVNQCKLTANRELATSAAVVLWMHNIIVPFHRRPPN--QIWAFYFLESPIHT--VQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTFFWCRLCMMAHEGENVKSV--LRDVYKWWSGGEQKICIKAEMWKNQKS 1480
            L PH   D   DRI NQ+ Y P+ +     + K K ILL+NG+     K+        +CPV+ C+LTANR+LA++A ++L+  + I    RRP N  Q+   Y+LE P HT  V+ P         +NWTATYR DSTIVAPY K+  YD    Q ++     IN++  K K  AWFVSNC + N R+    ELQKYI+VDIYG CG   C R   + CF +L+  YKFYLAFENSNC+DYITEKFF+N L   ++PIVMGA PEDY   AP  SYIHV++F S  +LA+Y++ LD +D  YN YF WKG G    NT++WCR+C   H  E ++      D+  WW G    +C     W+N K+
Sbjct:  143 LLPH--QDPYSDRIINQLMYVPHNYEEIKSSGKLKTILLYNGLGPWNVKKGRDVFLKAKCPVDTCELTANRDLASTADMILYKDHYIPTGIRRPSNSKQVSMLYYLECPYHTQNVKVP-------DAINWTATYRRDSTIVAPYEKWQYYDTKVQQQEQ----DINYSVNKTKKVAWFVSNCGARNGRLQYAHELQKYIEVDIYGACGNFKCSRSTADKCFEILDNDYKFYLAFENSNCKDYITEKFFVNALNRRVLPIVMGARPEDYEVSAPRRSYIHVDEFSSPKELAEYLRILDHDDELYNSYFKWKGTGEF-INTYYWCRVCATLHNEEQLRKPRWYTDLNDWWRG--PGVCT-TRSWRNFKA 492          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. UniProt/SwissProt
Match: sp|G5EDR5|FUTA_CAEEL (Alpha-(1,3)-fucosyltransferase fut-1 OS=Caenorhabditis elegans OX=6239 GN=fut-1 PE=1 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 2.919e-46
Identity = 112/300 (37.33%), Postives = 163/300 (54.33%), Query Frame = 2
Query:  512 KEKLILLFNGMAGVTNKELEQCPVNQCKLTANRELATSAAVVLWMH--NIIVPFHRRPPNQIWAFYFLESPIHT-VQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWK-GYGLV-------DTNTFFW--CRLCMMA 1372
            +++LIL +N  AG +   L+ CP   C+ T  R  A  A  VL  H  N  VP     PNQ   ++  ESP ++ +Q P     P+  +N T  +RHD+   +PY  YT+  L         +   N   GK K AAWFVS+C + + R   V +LQK++++DIYGGCG + C R   + C  +L+  Y FY+ FENS C DY+TEK + +G +N IIP+V+    +      PP+S+I ++DF S+ ++ DY+ YL  N TAY EYF W+  Y +V       D     W  C++C MA
Sbjct:  116 QKRLILSWN--AGHSQDNLQGCPDWNCEFTQVRARAPDADAVLIAHMDNDFVP----KPNQYVVYFSQESPANSGIQIP----RPD-YINMTLGFRHDTPAGSPYG-YTV-KLGAKSRKTGQVVDANLVNGKAKGAAWFVSHCQTNSKREDFVKKLQKHLQIDIYGGCGPMKCARGD-SKCDTMLDTDYHFYVTFENSICEDYVTEKLWKSGYQNTIIPLVLKR--KLVEPFVPPNSFIAIDDFKSVKEMGDYLNYLMNNKTAYMEYFEWRHDYKVVFLDGSHHDVLERPWGFCQVCRMA 399          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. UniProt/SwissProt
Match: sp|P83088|FUCTC_DROME (Alpha-(1,3)-fucosyltransferase C OS=Drosophila melanogaster OX=7227 GN=FucTC PE=2 SV=4)

HSP 1 Score: 159.458 bits (402), Expect = 4.304e-42
Identity = 105/307 (34.20%), Postives = 151/307 (49.19%), Query Frame = 2
Query:  572 QCPVNQCKLTANRELATSAAV---VLWMHNIIVPFHR-----RPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKY---TLYDLANPQ---PDRYPLPKIN------FAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKG-YGLVDTNTFFWCRLCMMAHEGE--NVKSVLRDVYKWW 1423
             CPV QC+++       +  +   +++    + P  R     R P+Q++ F  +E P  T       ++     N T TYR DS +  PY +    T   +  P    P R P    N        +GK K AAWFVS+C + + R  +   LQ++ +VDIYG CG LSC R  P+ C  +L+  Y FYLAFENS C DY+TEK F + L+  +IP+V G    DY R+ PPHSY+    F S+  LA Y+K +  +   Y  YF W+  Y L  ++ F  C LC   H+    +      D+  WW
Sbjct:  116 HCPVYQCEISNQNAFLPAVELYDAIVFHAAEMFPLLRPVPSQRSPHQVYVFALMEPPGETKHR---LDDEQGFYNLTMTYRIDSDVFWPYGQLLDITADAVVAPSVKPPWRKPPVAFNDSLVWDLWSGKTKTAAWFVSHCETLSKREVLANRLQEFFEVDIYGNCGTLSCTRGDPH-CAEMLDTDYFFYLAFENSLCDDYVTEKLF-DALERTVIPVVFGG--ADYSRILPPHSYVDANRFMSVEGLAQYMKLVVADPDLYVSYFWWRSHYRLTYSSPF--CDLCARLHDPSFGHKTQFYHDIQSWW 413          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. UniProt/SwissProt
Match: sp|G3MZR2|FUT7_BOVIN (Alpha-(1,3)-fucosyltransferase 7 OS=Bos taurus OX=9913 GN=FUT7 PE=1 SV=2)

HSP 1 Score: 150.599 bits (379), Expect = 1.063e-39
Identity = 88/252 (34.92%), Postives = 128/252 (50.79%), Query Frame = 2
Query:  581 VNQCKLTANRELATSAAVVLWMHNII------VPFHRRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYG-GCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWK 1315
            V +C+LT NR L   A  V++ H  +      +P   RP  Q W +  +ESP HT            + NW  +YR DS I  PY +  L     P P   PLP       K  +AAW VSN      R+ +  +L  +++VD++G   G+  C      +C       Y+FYL+FENS  RDYITEKF+ N L    +P+V+G     Y  VAPP +++HV+DF S  +LA ++  +  N++ Y  YF+W+
Sbjct:   73 VARCRLTVNRSLLAGADAVVFHHRELQTQQARLPLAERPRGQPWVWASMESPSHTRGLGRLRG----VFNWVLSYRRDSDIFVPYGR--LEPREGPAP---PLP------AKRGLAAWVVSNFQKRQRRVQLYRQLALHLRVDVFGRAAGQPLC-----ASCLLRAVAGYRFYLSFENSEHRDYITEKFWRNALLAGAVPVVLGPPRAAYEAVAPPDAFVHVDDFGSARELAAFLTSM--NESCYRRYFAWR 302          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. UniProt/SwissProt
Match: sp|Q712G6|FUT7_RAT (Alpha-(1,3)-fucosyltransferase 7 OS=Rattus norvegicus OX=10116 GN=Fut7 PE=1 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 1.949e-38
Identity = 89/252 (35.32%), Postives = 129/252 (51.19%), Query Frame = 2
Query:  581 VNQCKLTANRELATSAAVVLWMHNII------VPFHRRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYG-GCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWK 1315
            +  C L+ANR L  SA  V++ H  +      +P  +RP  Q W +  +ESP +T     F      + NW  +YR DS I  PY +  L   + P P   PLP       K +MAAW VSN      R  +  +L  ++KVD++G   G+  CP      C       Y+FYL+FENS  RDYITEKF+ N L    +P+V+G     Y    PP ++IHV+DF S  +LA ++  +  N++ Y  +F+W+
Sbjct:  101 MASCHLSANRSLLASADAVVFHHRELQTRHSRLPLDQRPHGQPWVWATMESPSNTHGLRHFRG----IFNWVLSYRRDSDIFVPYGR--LEPFSGPTP---PLP------AKSRMAAWVVSNFQERQQRAKLYRQLAPHLKVDVFGRASGRPLCP-----NCLLPTVARYRFYLSFENSQHRDYITEKFWRNALAAGAVPVVLGPPRTTYEAFVPPDAFIHVDDFSSARELAVFL--VSMNESRYRGFFAWR 330          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. TrEMBL
Match: A0A267FVB8 (Glyco_tran_10_N domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003899g2 PE=3 SV=1)

HSP 1 Score: 362.459 bits (929), Expect = 1.546e-116
Identity = 190/406 (46.80%), Postives = 245/406 (60.34%), Query Frame = 2
Query:  293 TQTPITNIQLQSQIDNSLFMRQGNFVIPDSSQMLQGKIKFALFPHLTNDS----NDDRIWNQMRYRPNQFINGSLNIKEKLILLFNGMAGVTNK----ELEQCPVNQCKLTANRELATSAAVVLWMHNIIVPFHRRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYD---LANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTFFWCRLCMMAHEGENVKSVLRDVYKWWSGGEQKICIKAEMWKNQK 1477
            +++    ++   ++ ++LF  QGNF  P+ ++        A++P+    S      DRIWNQMRY P     G    + K ILL+NG+ G  N     + + CPV+ C +T +R  A +A V++W H++  PFH+RP  QIWA YFLESP HT     F       VNWTATYR DS IVAPY K+T Y        Q         N+A+GK K  AWFVSNC + N R+    EL K+I+VDIYGGCG   C R +   CF LL K YKFYLAFENSNC +YITEKFFLNGL ++I+PIVMGA  +DY  VAP +S++HV++F S   LADY+  LDK+D+ YN YF WKG GLVDTN FFWCRLCMMAHE E       D+ +WW    +  C++   W   K
Sbjct:   87 SRSAYPTVRGGGRLLDNLFRVQGNFKFPEFNET----TTLAIYPNEVPASYPVRARDRIWNQMRYVPVNAATG--KSRTKTILLYNGLGGEGNGRERFQRDNCPVSDCIMTGDRSQAATADVIMWQHSVFNPFHKRPAKQIWAVYFLESPHHTPSLNGFAGK----VNWTATYRSDSVIVAPYYKFTPYVHNVFVKTQTK-------NYASGKTKKVAWFVSNCGAQNGRLEYARELGKHIQVDIYGGCGTHQCSRSRSGECFRLLEKEYKFYLAFENSNCWNYITEKFFLNGLSHDILPIVMGARMQDYIDVAPLNSFLHVDNFTSPKHLADYLHELDKDDSKYNTYFQWKGTGLVDTNAFFWCRLCMMAHEAELSSFNYGDIEQWW---RKDTCVRG-AWPGSK 471          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. TrEMBL
Match: A0A1I8HQ21 (Glyco_tran_10_N domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 362.459 bits (929), Expect = 1.704e-116
Identity = 190/406 (46.80%), Postives = 245/406 (60.34%), Query Frame = 2
Query:  293 TQTPITNIQLQSQIDNSLFMRQGNFVIPDSSQMLQGKIKFALFPHLTNDS----NDDRIWNQMRYRPNQFINGSLNIKEKLILLFNGMAGVTNK----ELEQCPVNQCKLTANRELATSAAVVLWMHNIIVPFHRRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYD---LANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTFFWCRLCMMAHEGENVKSVLRDVYKWWSGGEQKICIKAEMWKNQK 1477
            +++    ++   ++ ++LF  QGNF  P+ ++        A++P+    S      DRIWNQMRY P     G    + K ILL+NG+ G  N     + + CPV+ C +T +R  A +A V++W H++  PFH+RP  QIWA YFLESP HT     F       VNWTATYR DS IVAPY K+T Y        Q         N+A+GK K  AWFVSNC + N R+    EL K+I+VDIYGGCG   C R +   CF LL K YKFYLAFENSNC +YITEKFFLNGL ++I+PIVMGA  +DY  VAP +S++HV++F S   LADY+  LDK+D+ YN YF WKG GLVDTN FFWCRLCMMAHE E       D+ +WW    +  C++   W   K
Sbjct:   87 SRSAYPTVRGGGRLLDNLFRVQGNFKFPEFNETTM----LAIYPNEVPASYPVRARDRIWNQMRYVPVNAATG--KSRTKTILLYNGLGGEGNGRERFQRDNCPVSDCIMTGDRSQAATADVIMWQHSVFNPFHKRPAKQIWAVYFLESPHHTPSLNGFAGK----VNWTATYRSDSVIVAPYYKFTPYVHNVFVKTQTK-------NYASGKTKKVAWFVSNCGAQNGRLEYARELGKHIQVDIYGGCGTHQCSRSRSGECFRLLEKEYKFYLAFENSNCWNYITEKFFLNGLSHDILPIVMGARMQDYIDVAPLNSFLHVDNFTSPKHLADYLHELDKDDSKYNTYFQWKGTGLVDTNAFFWCRLCMMAHEAELSSFNYGDIEQWW---RKDTCVRG-AWPGSK 471          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. TrEMBL
Match: A0A1I8HEQ3 (Glyco_tran_10_N domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026419g1 PE=3 SV=1)

HSP 1 Score: 362.073 bits (928), Expect = 2.004e-116
Identity = 190/399 (47.62%), Postives = 242/399 (60.65%), Query Frame = 2
Query:  314 IQLQSQIDNSLFMRQGNFVIPDSSQMLQGKIKFALFPHLTNDS----NDDRIWNQMRYRPNQFINGSLNIKEKLILLFNGMAGVTNK----ELEQCPVNQCKLTANRELATSAAVVLWMHNIIVPFHRRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYD---LANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTFFWCRLCMMAHEGENVKSVLRDVYKWWSGGEQKICIKAEMWKNQK 1477
            ++   ++ ++LF  QGNF  P+ ++        A++P+    S      DRIWNQMRY P     G    + K ILL+NG+ G  N     + + CPV+ C +T +R  A +A V++W H++  PFH+RP  QIWA YFLESP HT     F       VNWTATYR DS IVAPY K+T Y        Q         N+A+GK K  AWFVSNC + N R+    EL K+I+VDIYGGCG   C R +   CF LL K YKFYLAFENSNC +YITEKFFLNGL ++I+PIVMGA  +DY  VAP +S++HV++F S   LADY+  LDK+D+ YN YF WKG GLVDTN FFWCRLCMMAHE E       D+ +WW    +  C++   W   K
Sbjct:   94 VRGGGRLLDNLFRVQGNFKFPEFNETTM----LAIYPNEVPASYPVRARDRIWNQMRYVPVNAATG--KSRTKTILLYNGLGGEGNGRERFQRDNCPVSDCIMTGDRSQAATADVIMWQHSVFNPFHKRPAKQIWAVYFLESPHHTPSLNGFAGK----VNWTATYRSDSVIVAPYYKFTPYVHNVFVKTQTK-------NYASGKTKKVAWFVSNCGAQNGRLEYARELGKHIQVDIYGGCGTHQCSRSRSGECFRLLEKEYKFYLAFENSNCWNYITEKFFLNGLSHDILPIVMGARMQDYIDVAPLNSFLHVDNFTSPKHLADYLHELDKDDSKYNTYFQWKGTGLVDTNAFFWCRLCMMAHEAELSSFNYGDIEQWW---RKDTCVRG-AWPGSK 471          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. TrEMBL
Match: V4AKD2 (Glyco_tran_10_N domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_152652 PE=3 SV=1)

HSP 1 Score: 353.599 bits (906), Expect = 1.271e-114
Identity = 180/359 (50.14%), Postives = 229/359 (63.79%), Query Frame = 2
Query:  428 LTNDSNDDRIWNQMRYRPNQFINGSLN--IKEKLILLFNGMAGVTNKELEQ------CPVNQCKLTANRELATSAAVVLWMHNIIVPFHRRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLY---DLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTFFWCRLCMMAHEGENVKSVLRDVYKWWSGGEQKICIKAEMWKN 1471
             ++D + DRI NQM + P        N  +  K ILL+NG  G   K  +Q      CPVN+C L+++R+ A  A  VL+  +   P   RP NQIW  + LESP HT     ++N    + NWTATYRHDST+VAPY ++  +   +L  PQ         N+AAGK K  AWFVSNC + N R     +L ++IKVDIYGGCG L CPRHQ   CF++LNK YKFYLAFENSNCRDYITEKFF+NGL++++IPIVMG  PEDYRR AP HSYIHV+DF+S  +LA+Y+  LD ND  YNEYF WKG G    NT+FWCR+C + H+    +SV  ++ KWW G    ICI  E W++
Sbjct:   16 FSSDHSQDRIVNQMEFIPENVKQFKTNEEMPMKTILLYNGFGGWQVKRGQQTFIEQKCPVNRCILSSDRQKAADADAVLFSQSPSRPRFNRPLNQIWVLFMLESPYHTPGLSAYKN----VFNWTATYRHDSTLVAPYERFQPFNESELTKPQ-------NKNYAAGKTKTVAWFVSNCGARNGRRQYADKLAEHIKVDIYGGCGPLKCPRHQSGKCFDMLNKDYKFYLAFENSNCRDYITEKFFVNGLQHDVIPIVMGGSPEDYRRAAPVHSYIHVDDFNSPKELAEYLHKLDTNDKLYNEYFLWKGTGSF-INTYFWCRMCALIHDENRPQSVFENIDKWWRG--PGICIGQETWRS 360          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. TrEMBL
Match: A0A1I8IJW0 (Glyco_tran_10_N domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 362.073 bits (928), Expect = 7.312e-113
Identity = 190/406 (46.80%), Postives = 245/406 (60.34%), Query Frame = 2
Query:  293 TQTPITNIQLQSQIDNSLFMRQGNFVIPDSSQMLQGKIKFALFPHLTNDS----NDDRIWNQMRYRPNQFINGSLNIKEKLILLFNGMAGVTNK----ELEQCPVNQCKLTANRELATSAAVVLWMHNIIVPFHRRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYD---LANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTFFWCRLCMMAHEGENVKSVLRDVYKWWSGGEQKICIKAEMWKNQK 1477
            +++    ++   ++ ++LF  QGNF  P+ ++        A++P+    S      DRIWNQMRY P     G    + K ILL+NG+ G  N     + + CPV+ C +T +R  A +A V++W H++  PFH+RP  QIWA YFLESP HT     F       VNWTATYR DS IVAPY K+T Y        Q         N+A+GK K  AWFVSNC + N R+    EL K+I+VDIYGGCG   C R +   CF LL K YKFYLAFENSNC +YITEKFFLNGL ++I+PIVMGA  +DY  VAP +S++HV++F S   LADY+  LDK+D+ YN YF WKG GLVDTN FFWCRLCMMAHE E       D+ +WW    +  C++   W   K
Sbjct:  138 SRSAYPTVRGGGRLLDNLFRVQGNFKFPEFNETTM----LAIYPNEVPASYPVRARDRIWNQMRYVPVNAATG--KSRTKTILLYNGLGGEGNGRERFQRDNCPVSDCIMTGDRSQAATADVIMWQHSVFNPFHKRPAKQIWAVYFLESPHHTPSLNGFAGK----VNWTATYRSDSVIVAPYYKFTPYVHNVFVKTQTK-------NYASGKTKKVAWFVSNCGAQNGRLEYARELGKHIQVDIYGGCGTHQCSRSRSGECFRLLEKEYKFYLAFENSNCWNYITEKFFLNGLSHDILPIVMGARMQDYIDVAPLNSFLHVDNFTSPKHLADYLHELDKDDSKYNTYFQWKGTGLVDTNAFFWCRLCMMAHEAELSSFNYGDIEQWW---RKDTCVRG-AWPGSK 522          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Cavefish
Match: FUT4 (fucosyltransferase 4 [Source:HGNC Symbol;Acc:HGNC:4015])

HSP 1 Score: 144.821 bits (364), Expect = 1.742e-38
Identity = 104/327 (31.80%), Postives = 150/327 (45.87%), Query Frame = 2
Query:  476 RPNQFINGSLNIKEKLILLFNGMAGVTNKELEQCP---VNQCKLTANRELATSAAVVLWMHNIIV------PFHRRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTFF---WCRLCMMAHEGENVKSVLRDVYKW 1420
            R   +  G+L+    L+LL+    G T K    C    V  C LT +RE    A  V+  H  +V      P   RP  Q W +   ESP H+   P  E   + + N T +YR  S I  PY              R     +N    +  + AW +SN +    R+     L++YI+VDIYG    LS      ++ F  ++  YKFYLAFENS   DYITEK + N L++  +P+V+G   E+Y R  PP ++IHV DF S   LA Y+ YLD+N   Y  Y +W+    V   +F+   +C  C         +  ++ +  W
Sbjct:   24 RSVGYQRGNLDTHVTLLLLWWAPFGSTQKLPGSCTSYGVRGCVLTLDREEYGHADAVIMHHRDLVNEPDALPKPPRPEGQKWIWMNFESPSHS---PWLEG-LDGVFNLTMSYRLGSDIFLPYGYLQ---------RRLDEENVNDVRRRRTLVAWVISNWSEEQERVQFYWRLRRYIRVDIYGRRA-LSLIN---DSVFQTISG-YKFYLAFENSIHTDYITEKLWRNALESGAVPVVLGPPRENYERFLPPDAFIHVHDFKSPRALAAYLLYLDRNPAQYRRYLAWRHDYTVHVTSFWAEHYCAACRAVQASRKQRKTIKHLGFW 332          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Cavefish
Match: FUT4 (fucosyltransferase 4 [Source:HGNC Symbol;Acc:HGNC:4015])

HSP 1 Score: 139.428 bits (350), Expect = 1.507e-36
Identity = 101/318 (31.76%), Postives = 145/318 (45.60%), Query Frame = 2
Query:  503 LNIKEKLILLFNGMAGVTNKELEQCP---VNQCKLTANRELATSAAVVLWMHNIIV------PFHRRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTFF---WCRLCMMAHEGENVKSVLRDVYKW 1420
            L+    L+LL+    G T K    C    V  C LT +RE    A  V+  H  +V      P   RP  Q W +   ESP H+   P  E   + + N T +YR  S I  PY     +                F   +  + AW +SN +    R+     L++YI+VDIYG    LS      ++ F  ++  YKFYLAFENS   DYITEK + N L++  +P+V+G   E+Y R  PP ++IHV DF S   LA Y+ YLD+N   Y  Y +W+    V   +F+   +C  C         +  ++ +  W
Sbjct:   49 LDTHVTLLLLWWAPFGSTQKLPGSCTSYGVRGCVLTLDREEYGHADAVIMHHRDLVNEPDALPKPPRPEGQKWIWMNFESPSHS---PWLEGL-DGVFNLTMSYRLGSDIFLPYGYLHPF----------------FVRRRRTLVAWVISNWSEEQERVQFYWRLRRYIRVDIYGRRA-LSLIN---DSVFQTISG-YKFYLAFENSIHTDYITEKLWRNALESGAVPVVLGPPRENYERFLPPDAFIHVHDFKSPRALAAYLLYLDRNPAQYRRYLAWRHDYTVHVTSFWAEHYCAACRAVQASRKQRKTIKHLGFW 341          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000038030.1 (pep primary_assembly:Astyanax_mexicanus-2.0:25:41276986:41294098:1 gene:ENSAMXG00000035987.1 transcript:ENSAMXT00000038030.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 139.813 bits (351), Expect = 2.825e-36
Identity = 111/331 (33.53%), Postives = 159/331 (48.04%), Query Frame = 2
Query:  509 IKEKLILLFNGMAGVTNKELEQCP----VNQCKLTANRELATSAAVVLWMHNII------VPFHRRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNC---ASPNNRMGIVVELQKYIKVDIYGGCGK--LSCPRHQP--NTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNG-LKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTFFW--------CRLCMMAHEGENVKSVLRDVYKWW 1423
            +KEK ILL          +L  C     ++ C++  +R L   A  VL  H  I      +P   RPP Q W ++ +ESP +T + P  EN    L N T +YR D+ I     +Y L     P  + + +PK      KDK+  WFVSN         RM    E +K+I +DI+G      L    + P  ++C        KFYL+FENS  +DYITEKF  NG +    +P+V+G   E+Y + AP +S+IHV DF S  +LA+Y+  LDK+D AY+ YF W+ +     +   W        C  C      +  K    D+YKW+
Sbjct:   73 LKEKPILLVWVWPENFRFDLSDCQTYYNIDGCRIIDDRNLYNQADAVLIFHKAISWDLSNLPPSPRPPFQRWIWFHVESPTNTHRIPGLEN----LFNLTLSYRRDADISV---RYPLTVSKTPI-EGFQIPK------KDKLLCWFVSNTNPSTGTGTRMKFYEEFKKHINIDIFGNMAGNGLKDEEYFPTMSSC--------KFYLSFENSIHKDYITEKF--NGPVSVGTVPVVLGPPRENYEQFAPHNSFIHVNDFASPLELANYLLQLDKDDEAYSRYFEWRKHVTATRHLTTWNQEFVTYICHACEYIGVHKEYKEA-HDIYKWY 378          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000025885.2 (alpha-(1,3)-fucosyltransferase 9-like [Source:NCBI gene;Acc:103039268])

HSP 1 Score: 138.658 bits (348), Expect = 4.768e-36
Identity = 101/295 (34.24%), Postives = 142/295 (48.14%), Query Frame = 2
Query:  581 VNQCKLTANRELATSAAVVLWMHNII------VPFHRRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTFF---WCRLCMMAHEGENVKSVLRDVYKW-WSGGE 1435
            V  C LTA+R L   A  VL  H  I      +P   RPP++ W +   ESP +T   P  +     L N + +YR D  I  PY +  +  L     + Y  P+      KDK+  W VSN    + R     ELQKYI+V+IYG   +    RH     +  +    KFYL+FENS  +DYITEK F N L    +P+V G   ++Y    P  ++IHVEDF S+  LA ++  ++ N+  Y+ YF W+      T +F     CR C         + VL D+++W W G E
Sbjct:   75 VEGCLLTADRNLYDKADAVLVHHRDIALDLSNLPKSPRPPHKKWIWMNSESPSNTEWIPGLDK----LFNVSLSYRKDGDISLPYGR--VIPLEKELVEDYKPPE------KDKIVCWIVSNYNPDHKRTHYYQELQKYIQVNIYGDYFE----RHVSEEEYREIVASCKFYLSFENSVHKDYITEKLF-NALALGAVPVVFGPSRKNYEHFVPSDAFIHVEDFTSMRALAKHLYRVNDNEVLYHSYFRWRRQFEAVTTSFPEENACRSCEYVQRNREYQ-VLTDLHQWFWDGNE 351          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Cavefish
Match: FUT4 (fucosyltransferase 4 [Source:HGNC Symbol;Acc:HGNC:4015])

HSP 1 Score: 136.732 bits (343), Expect = 6.221e-36
Identity = 96/291 (32.99%), Postives = 141/291 (48.45%), Query Frame = 2
Query:  581 VNQCKLTANRELATSAAVVLWMHNIIV------PFHRRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLP--KINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTFF---WCRLCMMAHEGENVKSVLRDVYKW 1420
            V  C LT +RE    A  V+  H  +V      P   RP  Q W +   ESP H+   P  E   + + N T +YR  S I  PY   ++      + + YP+P   I     +  + AW +SN +    R+     L++YI+VDIYG    LS      ++ F  ++  YKFYLAFENS   DYITEK + N L++  +P+V+G   E+Y R  PP ++IHV DF S   LA Y+ YLD+N   Y  Y +W+    V   +F+   +C  C         +  ++ +  W
Sbjct:   20 VRGCVLTLDREEYGHADAVIMHHRDLVNEPDALPKPPRPEGQKWIWMNFESPSHS---PWLEGL-DGVFNLTMSYRLGSDIFLPYVHSSV-----ARNNGYPVPWRNIRSVRRRRTLVAWVISNWSEEQERVQFYWRLRRYIRVDIYGRRA-LSLIN---DSVFQTISG-YKFYLAFENSIHTDYITEKLWRNALESGAVPVVLGPPRENYERFLPPDAFIHVHDFKSPRALAAYLLYLDRNPAQYRRYLAWRHDYTVHVTSFWAEHYCAACRAVQASRKQRKTIKHLGFW 296          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Sea Lamprey
Match: fut11 (fucosyltransferase 11 (alpha (1,3) fucosyltransferase) [Source:NCBI gene;Acc:568888])

HSP 1 Score: 93.9745 bits (232), Expect = 8.046e-21
Identity = 86/275 (31.27%), Postives = 127/275 (46.18%), Query Frame = 2
Query:  557 NKELEQCPVNQCKLTANR--ELATSAAVVLWMHNIIVPFHR---RPPNQIWAFYFLESPIHT---VQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAA--WFVSNCASPNNRMGIVVELQKYIKVDIYGGC---GKLSCPR--------HQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPE-DYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWK 1315
            + E   CP+  C +T N+  +L      +L+       +     R P+Q WA +  ESP++       P        L N+TAT+R  S    P S   L  LA  +    PL + N    ++  AA  +  S+C   ++R   V EL K+I++D YG C    +L   R         +   C  LL   YKF+LAFEN+ C DY+TEK +   L    +P+  GA    D+   +P  S + V+DF S   LA ++  LD NDT Y +Y  +K
Sbjct:   60 DSERIDCPLGSCMVTKNKKVQLYKRTKAILFYGTDFRAYEAPLPRLPHQTWALFHEESPMNNYLLSHLPAMR-----LFNYTATFRRTSDY--PLSTQWLPSLAYLRRPAIPLAEKNRLRREEGRAAVLYLQSHCEVASDRDRYVDELMKHIQIDSYGKCLNNRELPSERLSDTQTAITEDKECLALLAG-YKFHLAFENALCGDYMTEKLW-RPLHLGSVPVYWGAEDAGDWLPASP--SAVLVDDFASPHDLAQFLLRLDANDTEYLQYLKFK 323          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Sea Lamprey
Match: fut10 (fucosyltransferase 10 [Source:NCBI gene;Acc:497615])

HSP 1 Score: 91.6633 bits (226), Expect = 3.892e-20
Identity = 76/231 (32.90%), Postives = 101/231 (43.72%), Query Frame = 2
Query:  692 WAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDS----------TIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFV-SNCASPNNRMGIVVELQKYIKVDIYGGC-------GKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLV 1330
            WA +  ESP +   +  F     +L N TAT+   S          +  A  S   L   A     R P P     AG+   A  +V S+C  P++R   V EL  YI VD YG C       G L+ P       F  L   YKF LA EN+ C DY+TEK +   L    +P+  G+         P  S + V DF S  +LA ++  LD +DT Y++Y  WK  G V
Sbjct:   88 WALFHEESPKNN--YVLFWPQTAALFNHTATFSRRSDLPLTLQFVESTKALMSHRLLVGAAKKSRLRRPAP-----AGRGLAAVAYVQSDCEPPSDRDAFVRELSAYIDVDSYGRCLHNRDLPGPLTDPSAMEAEGFLSLLASYKFVLALENALCDDYVTEKLW-RPLAVGAVPVYRGSPSARDWLPDPERSAVIVSDFPSPKELASFLLSLDADDTLYDDYRRWKLEGRV 310          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Nematostella
Match: EDO40397 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7A4])

HSP 1 Score: 183.726 bits (465), Expect = 3.995e-54
Identity = 119/275 (43.27%), Postives = 157/275 (57.09%), Query Frame = 2
Query:  587 QCKLTANR-ELATSAAVVLWMHNIIVPFH------RRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNT--------CFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSW-KGYGLVDTNTFFWCRLC 1363
             C+LT N+ EL  S AVV    ++    H      ++PP+Q W F+ LE+P HT + P   +  N + NWT TYR DS I APY  Y      +P   R      N+A GKDK+  W VSNC  P  R  + ++L K I V ++GGC +   P+H   T        C NL+ + YKF L+FEN NC+DYITEK++   L+ +I+PIV+G    D   VA P SYI+V DF S+  LADY+ YLDKNDTAYNEYF+W K Y      + + C LC
Sbjct:    1 HCRLTYNKSELTISDAVVFHGRDLPSVKHMKELIKQKPPSQRWVFFILENPHHTWK-PL--DKLNGMFNWTMTYRRDSDIFAPYGMY----YEDPSNKR--TSNRNYAMGKDKLIVWPVSNCGYP--REKLALKLSKLIPVHVFGGC-RSRFPKHSEGTSCRRFTKECDNLM-RRYKFRLSFENRNCKDYITEKYW-GPLEQDIVPIVLGGSNYD-SNVAVPGSYINVMDFPSLKALADYLNYLDKNDTAYNEYFAWKKKYSARHFESSYTCLLC 260          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Nematostella
Match: EDO46847 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP41])

HSP 1 Score: 180.644 bits (457), Expect = 5.581e-53
Identity = 106/274 (38.69%), Postives = 155/274 (56.57%), Query Frame = 2
Query:  575 CPVNQCKLTANR-ELATSAAVV------LWMHNIIVPFHRRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQ----PNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTFFWCRLC 1363
            CPV+ C+++ N+ +L  + AV+      L M  +      R P Q W ++  E+P +T   P   N    L NWT TYR DS    PY+ Y+       +P+     + N+A GK K  +W VS+C     R  +V EL KYI+VD+YG CG+     H        C+ + N+ YKFYLAFEN NC DY+TEK++   L++  +PIV+G    D  +VA P S+I++ DF S+  LA+Y+ YLD+NDTAYNEYF W+ +  V  +  + C++C
Sbjct:   15 CPVSNCRISYNKSDLPQANAVIFHGRDMLTMAQMKQILPSRTPTQRWVYFMHENPHYTYYDPAIYN---GLFNWTMTYRRDSDFFVPYNYYS-----RLKPEDMSKSERNYAEGKHKPVSWMVSHCGEL--RETVVRELLKYIQVDVYGPCGRKFNQSHHCDKASGNCWRIKNQ-YKFYLAFENKNCVDYVTEKYWYTLLESTAVPIVLGGSNYD-SKVAIPGSFINILDFSSVQALAEYLDYLDRNDTAYNEYFRWRRHFKVKVSEPWTCQMC 276          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Nematostella
Match: EDO42695 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0L8])

HSP 1 Score: 171.4 bits (433), Expect = 3.364e-49
Identity = 100/240 (41.67%), Postives = 135/240 (56.25%), Query Frame = 2
Query:  671 RRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYT---LYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWK-GYGLVDTNTFFWCRLCMMAHE 1378
            R   +QIW +Y +E+P+H +  P       ++ NWT +YR DS I  PY +Y      D+  P    Y          KD + AW VSNC S + R   V EL+KY+ V+IYG CG  +CP+ +  +C   L + YKFYLA EN NC+DYITEK++ N L N ++PIVMG        +A P+SYI V DF+S   LA+Y+ YLD N  AY +YF W+  Y LV T      R C+M  +
Sbjct:   13 RSNGDQIWFYYIMETPLHLLIKPL-----KNIFNWTMSYRRDSEIFVPYGRYAPLEAGDMVTPVDISY----------KDMLVAWMVSNCHS-SERNNYVFELRKYVTVNIYGYCGTYTCPKSR--SCGEQL-RRYKFYLALENKNCKDYITEKYWENALANGVVPIVMGGAEYWDPHLAVPNSYIDVRDFESPKALAEYLVYLDNNLQAYMKYFQWRNNYKLVATR-----RACIMCQQ 228          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Nematostella
Match: EDO30231 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1D3])

HSP 1 Score: 168.703 bits (426), Expect = 4.782e-48
Identity = 108/292 (36.99%), Postives = 160/292 (54.79%), Query Frame = 2
Query:  548 GVTNKELEQCPVNQCKLTAN-RELATSAAVVL--------WMHNIIVP--FHRRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNT--CFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTFFW-CRLCMMAHEG 1381
            G+ +++   C   +C+++    +   S AVV         W+ N +     HR+P NQ W +Y  E+P H + +       N +++   TY+ DS I +PY  Y+  + ++ Q +       N+   K+K+A W VSNC S   R+ IV +L+++I +D+YGGC      R +     C  ++ K YKFY A EN +C+DYITEK++ N ++NN++PIV  A  E  RRV  P SYI + DF S   LADY+ YLD+N TAYNEYFSWK     +     W C LC + H G
Sbjct:   23 GLHSEKGVLCSEKRCRISYRASDFLRSDAVVFHGCQLSRKWIKNEVTTSLIHRKPKNQKWVWYEHENP-HNIGYDA--RVLNGMIDIAVTYKMDSGIWSPYGSYS--NTSSKQTE------TNYTENKNKLALWVVSNCKSVL-RIQIVRKLREFIPIDVYGGCSSYFYWRTRSCKPDCTEIIKK-YKFYFALENRHCKDYITEKYWHNAIENNVVPIV--AAGEFGRRVLIPGSYIDLLDFPSPKALADYLTYLDRNSTAYNEYFSWKKSYKYNLQHHMWICELCGLLHSG 299          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Nematostella
Match: EDO42002 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2X1])

HSP 1 Score: 165.622 bits (418), Expect = 3.067e-47
Identity = 105/280 (37.50%), Postives = 144/280 (51.43%), Query Frame = 2
Query:  569 EQCPVNQCKLTANR-ELATSAAVVLWMHNIIVP--------FHRRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGK-----LSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMG-AHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTFFWCRLC 1363
            EQCP+ + +LT N+   A S  V+       +P           RP  Q W ++ +ESP  T          N   N T TYR DS   A Y+ Y           +  + K +++ GK  + AW VSNC S   R   V EL KYI V +YG C         C R + + C     K YKFYL+FEN+ C+DYITEK++    + +++P+V+G A   DY RVA P SYI+V DF S+ +LA+Y+KYLDK   AYN+YF W+ Y   +T  +  C  C
Sbjct:    5 EQCPLWKIELTYNKSRFAESDLVIFHALGGNMPNTNELRRLSKNRPLLQRWVYHSMESPKVTPMVSPL----NGFFNATWTYRSDSDFSAAYATYVPLSPTEMSYKKVTISKRDYSKGKTSLVAWVVSNC-SARLRNEFVAELMKYIDVHVYGSCSSNYNQTRVCNRGKMSKCL----KKYKFYLSFENALCKDYITEKYWDRLGEEDVVPVVLGGADASDYSRVAIPGSYINVWDFKSVKELAEYLKYLDKKPAAYNKYFQWRSYYKRNTQHYPICNFC 275          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Medaka
Match: fut7 (alpha3-fucosyltransferase [Source:NCBI gene;Acc:100049474])

HSP 1 Score: 146.747 bits (369), Expect = 4.341e-39
Identity = 96/293 (32.76%), Postives = 145/293 (49.49%), Query Frame = 2
Query:  581 VNQCKLTANRELATSAAVVLWMHNIIVPFHR-------RPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYG-GCGK-LSCPRHQP--NTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTFFWCRLCMMAHEGENV--KSVLRDVYKW 1420
            +  CKL  +R   +SA +V++ +  ++   +       RP  Q WA+  LESP H      F N    + N T +YR D+ +  PY +        P+ +  PLP+ +    K  +  W VSN    + R  +  EL   + V +YG   GK LS     P  + CF        FYLAFENS  +DYITEK + N  +   +P+V+G   +DY+ VAPPHS+IHV +F S+ +L +Y++ L K+   Y EYF+WK +  V     +  RLC +  +   +  K    D+  W
Sbjct:   80 IPHCKLVDDRSYFSSADIVVFHNRELIQGRQKLPTDLLRPEGQRWAWMSLESPAHNGNLKPFAN----IFNMTISYRRDADVTIPYGELL------PKEEETPLPE-DITVNKSSLVCWVVSNYMRHHKRTQVYKELSAVVPVQVYGRWTGKPLSSSDLLPTISRCF--------FYLAFENSLAKDYITEKLWKNSYEAGAVPVVLGPSIQDYKAVAPPHSFIHVNEFASVRELGEYLQELAKDKKRYAEYFNWKQWWKVKLYVDWRERLCNICSQNSTLQYKKTYSDLEAW 353          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Medaka
Match: fut7 (alpha3-fucosyltransferase [Source:NCBI gene;Acc:100049474])

HSP 1 Score: 146.747 bits (369), Expect = 4.341e-39
Identity = 96/293 (32.76%), Postives = 145/293 (49.49%), Query Frame = 2
Query:  581 VNQCKLTANRELATSAAVVLWMHNIIVPFHR-------RPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYG-GCGK-LSCPRHQP--NTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTFFWCRLCMMAHEGENV--KSVLRDVYKW 1420
            +  CKL  +R   +SA +V++ +  ++   +       RP  Q WA+  LESP H      F N    + N T +YR D+ +  PY +        P+ +  PLP+ +    K  +  W VSN    + R  +  EL   + V +YG   GK LS     P  + CF        FYLAFENS  +DYITEK + N  +   +P+V+G   +DY+ VAPPHS+IHV +F S+ +L +Y++ L K+   Y EYF+WK +  V     +  RLC +  +   +  K    D+  W
Sbjct:   80 IPHCKLVDDRSYFSSADIVVFHNRELIQGRQKLPTDLLRPEGQRWAWMSLESPAHNGNLKPFAN----IFNMTISYRRDADVTIPYGELL------PKEEETPLPE-DITVNKSSLVCWVVSNYMRHHKRTQVYKELSAVVPVQVYGRWTGKPLSSSDLLPTISRCF--------FYLAFENSLAKDYITEKLWKNSYEAGAVPVVLGPSIQDYKAVAPPHSFIHVNEFASVRELGEYLQELAKDKKRYAEYFNWKQWWKVKLYVDWRERLCNICSQNSTLQYKKTYSDLEAW 353          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Medaka
Match: fut7 (alpha3-fucosyltransferase [Source:NCBI gene;Acc:100049474])

HSP 1 Score: 146.747 bits (369), Expect = 4.341e-39
Identity = 96/293 (32.76%), Postives = 145/293 (49.49%), Query Frame = 2
Query:  581 VNQCKLTANRELATSAAVVLWMHNIIVPFHR-------RPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYG-GCGK-LSCPRHQP--NTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTFFWCRLCMMAHEGENV--KSVLRDVYKW 1420
            +  CKL  +R   +SA +V++ +  ++   +       RP  Q WA+  LESP H      F N    + N T +YR D+ +  PY +        P+ +  PLP+ +    K  +  W VSN    + R  +  EL   + V +YG   GK LS     P  + CF        FYLAFENS  +DYITEK + N  +   +P+V+G   +DY+ VAPPHS+IHV +F S+ +L +Y++ L K+   Y EYF+WK +  V     +  RLC +  +   +  K    D+  W
Sbjct:   80 IPHCKLVDDRSYFSSADIVVFHNRELIQGRQKLPTDLLRPEGQRWAWMSLESPAHNGNLKPFAN----IFNMTISYRRDADVTIPYGELL------PKEEETPLPE-DITVNKSSLVCWVVSNYMRHHKRTQVYKELSAVVPVQVYGRWTGKPLSSSDLLPTISRCF--------FYLAFENSLAKDYITEKLWKNSYEAGAVPVVLGPSIQDYKAVAPPHSFIHVNEFASVRELGEYLQELAKDKKRYAEYFNWKQWWKVKLYVDWRERLCNICSQNSTLQYKKTYSDLEAW 353          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Medaka
Match: fut4 (alpha3-fucosyltransferase [Source:NCBI gene;Acc:100049384])

HSP 1 Score: 135.961 bits (341), Expect = 6.437e-35
Identity = 97/319 (30.41%), Postives = 146/319 (45.77%), Query Frame = 2
Query:  506 NIKEKLILLFNGMAGVTNKE---LEQCPVNQCKLTANRELATSAAVVLWMHNII------VPFHRRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANP--QPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTFF---WCRLCMMAHEGENVKSVLRDVYKW 1420
             + E  +L++N   G   +    LE   +  C LT +      A  VL  H  +      +P   RPP Q W +   ESP HT      E     + N T +YR DS I  PY       L  P  QP    L       G   + +W +SN +  + R+    +L++YI +D++G  G+   P+   N+   LL + Y FYLA ENS   DYITEK + N +    +P+V+G   ++Y R  PPH++IHVEDF +   LA Y+  L +N      + SW+G   +   TF+   +C  C    +       + D+ +W
Sbjct:   75 EVSEVTLLIWNHPFGEYRQLPDCLELLHIKGCTLTDDARAYPYADAVLVHHREVATGETDLPAAPRPPQQKWIWMNYESPTHTYGLWQLEG----VFNLTMSYRTDSDIFLPYGYLAPRGLQVPNAQPLSRSLRTTRSGRG---LVSWVISNWSETHARVAFYYKLRRYIPIDVFGSAGR-PLPKGS-NSVVQLL-RGYMFYLAMENSQHTDYITEKLW-NAVAAGTVPVVLGPSRKNYERFLPPHAFIHVEDFPTARHLARYLLMLSRNPLQMKRHLSWRGDYSLHQPTFWEEHYCTACRAVRKRRGRTDEVADLTEW 382          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Medaka
Match: fut7 (fucosyltransferase 7 [Source:NCBI gene;Acc:100049385])

HSP 1 Score: 134.42 bits (337), Expect = 1.188e-34
Identity = 91/290 (31.38%), Postives = 135/290 (46.55%), Query Frame = 2
Query:  581 VNQCKLTANRELATSAAVVLWMHNII------VPFHRRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQ--PNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTFFWCRLCMMAHEGENVKS--VLRDVYKW 1420
            ++ C LT + +   SA VV++ H  +      +P HR    Q W +  LE P++           N + NWT +YR D+ I  PY       +  P   R     +  A  +   A W VS       R G+   L++ I ++++G   K   P H   P     L      FYLAFENS  RDYI+EK + N  ++  IP+V+G     Y  VAPPHS+IHV DF S A+LA Y+K++  +   Y  Y  W     + T T +  RLC +     ++ +  V +D+  W
Sbjct:   71 ISHCFLTDDTDALPSADVVVFHHQELSRGASALPRHRSA-WQRWVWMSLEPPVNNANLRQL----NGVFNWTMSYRRDADIPVPYG------VTVPGVQRL---NVQAATNRSYFACWLVSKYRPSQARAGVYQSLKREIPIEVFGRWKKNPLPDHMLLPTISKCL------FYLAFENSEARDYISEKLWRNAFQSGAIPVVLGPSRATYEAVAPPHSFIHVSDFRSTAELATYLKHVAADRQVYEGYLQWHHTHSIKTLTDWRERLCQICARYPSLPASKVYQDLEGW 340          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Planmine SMEST
Match: SMESG000054535.1 (SMESG000054535.1)

HSP 1 Score: 909.057 bits (2348), Expect = 0.000e+0
Identity = 434/437 (99.31%), Postives = 434/437 (99.31%), Query Frame = 2
Query:  170 CVSFYNIFNLLHLENFKLESLFIPLANEETVNNFKLKNKVKTQTPITNIQLQSQIDNSLFMRQGNFVIPDSSQMLQGKIKFALFPHLTNDSNDDRIWNQMRYRPNQFINGSLNIKEKLILLFNGMAGVTNKELEQCPVNQCKLTANRELATSAAVVLWMHNIIVPFHRRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTFFWCRLCMMAHEGENVKSVLRDVYKWWSGGEQKICIKAEMWKNQKS 1480
            CVSFYNIFNLLHLEN KLESLFIPLANEETVNN KLKNKVKTQTPITNIQLQSQIDNSLFMRQGNFVIPDSSQMLQGKIKFALFPHLTNDSNDDRIWNQMRYRPNQFINGSLNIKEKLILLFNGMAGVTNKELEQCPVNQCKLTANRELATSAAVVLWMHNIIVPFHRRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYT YDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTFFWCRLCMMAHEGENVKSVLRDVYKWWSGGEQKICIKAEMWKNQKS
Sbjct:   20 CVSFYNIFNLLHLENLKLESLFIPLANEETVNNIKLKNKVKTQTPITNIQLQSQIDNSLFMRQGNFVIPDSSQMLQGKIKFALFPHLTNDSNDDRIWNQMRYRPNQFINGSLNIKEKLILLFNGMAGVTNKELEQCPVNQCKLTANRELATSAAVVLWMHNIIVPFHRRPPNQIWAFYFLESPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTPYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTFFWCRLCMMAHEGENVKSVLRDVYKWWSGGEQKICIKAEMWKNQKS 456          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Planmine SMEST
Match: SMESG000005277.1 (SMESG000005277.1)

HSP 1 Score: 448.743 bits (1153), Expect = 1.803e-154
Identity = 227/442 (51.36%), Postives = 297/442 (67.19%), Query Frame = 2
Query:  182 YNIFNLLHL---ENFKLESLFIPLANEETVNNFKLKNKVKTQTPITNIQLQSQIDNSLFMRQGNFVIPDSSQMLQGKIK-------FALFPHLTNDSNDDRIWNQMRYRPNQF-INGSLNIKEKLILLFNGMAGVTNKELEQCPVNQCKLTANRELATSAAVVLWMHNIIVPFHRRPPNQIWAFYFLESPIHTVQFPTFEN-NPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTFFWCRLCMMAHEGENVKSVLRDVYKWWSGGEQKICIKAEMWKN 1471
            +NIFN  H+   ++  LES F P     +V++ KL ++  T++ ++NI         LF RQGNF +P   ++ +             +FPH +    DDRIWNQMRY P     +GS   K K ILL+ G+  V+N+   QCPV +C +T + +LA +A V+LWMH++ VP HRRP  QIWA Y LESP HT +FP F     N  +NWTATYRH+ST+V PY KYT YD  N   ++   PK NF+ GK K+ AWFVSNC S N+R+ +V ELQKYI+VDIYG CG L C R    +CF +L++ YKFYLAFENSNCRDYITEKFFLNGL N+++P+VMGA  EDY+RVAPPHS+IH++ F+S+  LA Y+ YLDK D+AYN+YFSWKG+GLVDTN+FFWCRLCM++HE + VKS   +VY WW   ++  C  +  W N
Sbjct:    2 HNIFNSRHISVDDHSFLESAFRP-----SVDDLKLFDRRLTESQLSNI---------LFKRQGNFTLPSLYEIYRETFDRPSNFSALPIFPHESQSEYDDRIWNQMRYVPEHIHKDGS---KFKHILLYYGLNEVSNESFSQCPVKKCFVTGDPDLAPNADVILWMHSLSVPKHRRPFGQIWALYLLESPFHTAKFPDFRKLGANYSINWTATYRHESTLVTPYFKYTPYDFKNKLSNQ--KPKKNFSKGKTKLIAWFVSNCGSLNSRLQVVEELQKYIQVDIYGLCGPLKCSRDDYKSCFEMLSRDYKFYLAFENSNCRDYITEKFFLNGLSNDVLPVVMGAPVEDYQRVAPPHSFIHIDKFESLKDLAKYLHYLDKEDSAYNDYFSWKGHGLVDTNSFFWCRLCMLSHESDLVKSDFSNVYDWW--FDKTKCTYSSTWTN 422          
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Planmine SMEST
Match: SMESG000005277.1 (SMESG000005277.1)

HSP 1 Score: 448.358 bits (1152), Expect = 2.726e-154
Identity = 227/442 (51.36%), Postives = 297/442 (67.19%), Query Frame = 2
Query:  182 YNIFNLLHL---ENFKLESLFIPLANEETVNNFKLKNKVKTQTPITNIQLQSQIDNSLFMRQGNFVIPDSSQMLQGKIK-------FALFPHLTNDSNDDRIWNQMRYRPNQF-INGSLNIKEKLILLFNGMAGVTNKELEQCPVNQCKLTANRELATSAAVVLWMHNIIVPFHRRPPNQIWAFYFLESPIHTVQFPTFEN-NPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDRYPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGKLSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPIVMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSWKGYGLVDTNTFFWCRLCMMAHEGENVKSVLRDVYKWWSGGEQKICIKAEMWKN 1471
            +NIFN  H+   ++  LES F P     +V++ KL ++  T++ ++NI         LF RQGNF +P   ++ +             +FPH +    DDRIWNQMRY P     +GS   K K ILL+ G+  V+N+   QCPV +C +T + +LA +A V+LWMH++ VP HRRP  QIWA Y LESP HT +FP F     N  +NWTATYRH+ST+V PY KYT YD  N   ++   PK NF+ GK K+ AWFVSNC S N+R+ +V ELQKYI+VDIYG CG L C R    +CF +L++ YKFYLAFENSNCRDYITEKFFLNGL N+++P+VMGA  EDY+RVAPPHS+IH++ F+S+  LA Y+ YLDK D+AYN+YFSWKG+GLVDTN+FFWCRLCM++HE + VKS   +VY WW   ++  C  +  W N
Sbjct:    9 HNIFNSRHISVDDHSFLESAFRP-----SVDDLKLFDRRLTESQLSNI---------LFKRQGNFTLPSLYEIYRETFDRPSNFSALPIFPHESQSEYDDRIWNQMRYVPEHIHKDGS---KFKHILLYYGLNEVSNESFSQCPVKKCFVTGDPDLAPNADVILWMHSLSVPKHRRPFGQIWALYLLESPFHTAKFPDFRKLGANYSINWTATYRHESTLVTPYFKYTPYDFKNKLSNQ--KPKKNFSKGKTKLIAWFVSNCGSLNSRLQVVEELQKYIQVDIYGLCGPLKCSRDDYKSCFEMLSRDYKFYLAFENSNCRDYITEKFFLNGLSNDVLPVVMGAPVEDYQRVAPPHSFIHIDKFESLKDLAKYLHYLDKEDSAYNDYFSWKGHGLVDTNSFFWCRLCMLSHESDLVKSDFSNVYDWW--FDKTKCTYSSTWTN 429          
The following BLAST results are available for this feature:
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FUT43.316e-3834.51fucosyltransferase 4 [Source:HGNC Symbol;Acc:HGNC:... [more]
FUT76.576e-3732.59fucosyltransferase 7 [Source:HGNC Symbol;Acc:HGNC:... [more]
FUT64.487e-3533.33fucosyltransferase 6 [Source:HGNC Symbol;Acc:HGNC:... [more]
FUT64.487e-3533.33fucosyltransferase 6 [Source:HGNC Symbol;Acc:HGNC:... [more]
FUT64.487e-3533.33fucosyltransferase 6 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fut-12.295e-4737.33Alpha-(1,3)-fucosyltransferase fut-1 [Source:UniP... [more]
fut-12.295e-4737.33Alpha-(1,3)-fucosyltransferase fut-1 [Source:UniP... [more]
fut-48.188e-3635.06Alpha-1->3-fucosyltransferase homologue; FUcosyl T... [more]
fut-61.920e-2931.19Alpha-(1,3)-fucosyltransferase fut-6 [Source:UniP... [more]
fut-34.397e-2727.81Alpha-(1,3)-fucosyltransferase fut-3 [Source:UniP... [more]
back to top
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FucTA1.437e-9845.50gene:FBgn0036485 transcript:FBtr0331831[more]
FucTA1.437e-9845.50gene:FBgn0036485 transcript:FBtr0075641[more]
FucTC4.294e-4334.20gene:FBgn0044872 transcript:FBtr0299926[more]
FucTD1.719e-1124.44gene:FBgn0035217 transcript:FBtr0072693[more]
FucTB2.182e-1129.21gene:FBgn0032117 transcript:FBtr0079811[more]
back to top
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ft11.933e-3433.11alpha(1,3)fucosyltransferase gene 1 [Source:ZFIN;A... [more]
fut73.326e-3433.46fucosyltransferase 7 (alpha (1,3) fucosyltransfera... [more]
fut9b3.582e-3333.66fucosyltransferase 9b [Source:ZFIN;Acc:ZDB-GENE-03... [more]
fut9b3.595e-3333.66fucosyltransferase 9b [Source:ZFIN;Acc:ZDB-GENE-03... [more]
si:ch1073-440p11.21.126e-3129.47si:ch1073-440p11.2 [Source:ZFIN;Acc:ZDB-GENE-14010... [more]
back to top
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k199.250e-4436.48mitogen-activated protein kinase kinase kinase 19 ... [more]
pdx13.408e-4336.11pancreatic and duodenal homeobox 1 [Source:Xenbase... [more]
ENSXETT00000024642.16.838e-4332.72pep primary_assembly:Xenopus_tropicalis_v9.1:4:147... [more]
acmsd2.147e-4235.58aminocarboxymuconate semialdehyde decarboxylase [S... [more]
clca3p4.470e-4235.78chloride channel accessory 3, pseudogene [Source:X... [more]
back to top
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fut41.612e-3836.14fucosyltransferase 4 [Source:MGI Symbol;Acc:MGI:95... [more]
Fut76.164e-3833.73fucosyltransferase 7 [Source:MGI Symbol;Acc:MGI:10... [more]
Fut76.164e-3833.73fucosyltransferase 7 [Source:MGI Symbol;Acc:MGI:10... [more]
Fut72.281e-3733.73fucosyltransferase 7 [Source:MGI Symbol;Acc:MGI:10... [more]
Fut94.780e-3435.29fucosyltransferase 9 [Source:MGI Symbol;Acc:MGI:13... [more]
back to top
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VUL9|FUCTA_DROME1.441e-9745.50Glycoprotein 3-alpha-L-fucosyltransferase A OS=Dro... [more]
sp|G5EDR5|FUTA_CAEEL2.919e-4637.33Alpha-(1,3)-fucosyltransferase fut-1 OS=Caenorhabd... [more]
sp|P83088|FUCTC_DROME4.304e-4234.20Alpha-(1,3)-fucosyltransferase C OS=Drosophila mel... [more]
sp|G3MZR2|FUT7_BOVIN1.063e-3934.92Alpha-(1,3)-fucosyltransferase 7 OS=Bos taurus OX=... [more]
sp|Q712G6|FUT7_RAT1.949e-3835.32Alpha-(1,3)-fucosyltransferase 7 OS=Rattus norvegi... [more]
back to top
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FVB81.546e-11646.80Glyco_tran_10_N domain-containing protein OS=Macro... [more]
A0A1I8HQ211.704e-11646.80Glyco_tran_10_N domain-containing protein OS=Macro... [more]
A0A1I8HEQ32.004e-11647.62Glyco_tran_10_N domain-containing protein OS=Macro... [more]
V4AKD21.271e-11450.14Glyco_tran_10_N domain-containing protein OS=Lotti... [more]
A0A1I8IJW07.312e-11346.80Glyco_tran_10_N domain-containing protein OS=Macro... [more]
back to top
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FUT41.742e-3831.80fucosyltransferase 4 [Source:HGNC Symbol;Acc:HGNC:... [more]
FUT41.507e-3631.76fucosyltransferase 4 [Source:HGNC Symbol;Acc:HGNC:... [more]
ENSAMXT00000038030.12.825e-3633.53pep primary_assembly:Astyanax_mexicanus-2.0:25:412... [more]
ENSAMXT00000025885.24.768e-3634.24alpha-(1,3)-fucosyltransferase 9-like [Source:NCBI... [more]
FUT46.221e-3632.99fucosyltransferase 4 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fut118.046e-2131.27fucosyltransferase 11 (alpha (1,3) fucosyltransfer... [more]
fut103.892e-2032.90fucosyltransferase 10 [Source:NCBI gene;Acc:497615... [more]
back to top
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO403973.995e-5443.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468475.581e-5338.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426953.364e-4941.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302314.782e-4836.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420023.067e-4737.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fut74.341e-3932.76alpha3-fucosyltransferase [Source:NCBI gene;Acc:10... [more]
fut74.341e-3932.76alpha3-fucosyltransferase [Source:NCBI gene;Acc:10... [more]
fut74.341e-3932.76alpha3-fucosyltransferase [Source:NCBI gene;Acc:10... [more]
fut46.437e-3530.41alpha3-fucosyltransferase [Source:NCBI gene;Acc:10... [more]
fut71.188e-3431.38fucosyltransferase 7 [Source:NCBI gene;Acc:1000493... [more]
back to top
BLAST of Glycoprotein 3-alpha-L-fucosyltransferase A-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000054535.10.000e+099.31SMESG000054535.1[more]
SMESG000005277.11.803e-15451.36SMESG000005277.1[more]
SMESG000005277.12.726e-15451.36SMESG000005277.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003087 ID=SMED30003087|Name=Glycoprotein 3-alpha-L-fucosyltransferase A-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1617bp
TTTTGAATCAATTTTTATAAATATAACTTTACATATAATGAATTTGTTAT
TCATAGTAAACATGACCAGAACGCTGGAAATAATTTTTCTCTGTTGATAA
ATTACTTATGAAATGGTATTTAGAAAATTACGCATTCATTTTTTGAAGAT
TCTCATTCTACTCTTAATCTGCGTGTCTTTTTATAACATATTCAATTTAT
TGCATTTGGAAAATTTTAAATTGGAGTCCCTCTTCATTCCATTAGCCAAT
GAGGAGACAGTAAATAATTTTAAACTGAAAAACAAGGTGAAAACGCAGAC
CCCTATAACCAATATCCAACTGCAATCTCAAATCGATAACAGTTTATTTA
TGCGTCAAGGAAACTTTGTAATTCCTGATTCAAGTCAAATGCTTCAAGGG
AAAATAAAGTTTGCTCTCTTTCCTCATCTGACAAATGATTCAAATGACGA
TAGGATTTGGAATCAAATGCGTTATCGCCCAAACCAATTTATCAATGGCT
CATTAAACATAAAAGAAAAACTCATTTTATTATTTAATGGAATGGCAGGA
GTCACTAACAAGGAACTCGAACAATGTCCAGTGAATCAATGTAAACTGAC
TGCTAATAGAGAATTAGCAACAAGTGCAGCTGTAGTTTTGTGGATGCATA
ATATCATTGTACCGTTTCATAGAAGACCTCCAAATCAGATTTGGGCTTTT
TATTTTTTAGAATCTCCTATTCACACGGTTCAGTTTCCGACATTTGAAAA
TAATCCTAACTCATTGGTAAACTGGACTGCTACATATCGACACGATTCAA
CTATTGTTGCTCCGTATTCAAAGTATACTCTGTATGATCTCGCAAATCCT
CAACCAGACCGCTATCCTTTGCCAAAAATAAATTTTGCTGCCGGTAAAGA
TAAAATGGCAGCTTGGTTTGTCAGTAATTGTGCATCACCGAACAATAGAA
TGGGAATAGTTGTAGAATTGCAAAAATATATAAAAGTGGATATTTACGGT
GGTTGCGGCAAATTGAGTTGCCCTCGACATCAACCCAATACGTGTTTTAA
TTTGCTCAATAAACACTATAAATTCTACTTGGCGTTTGAAAACTCTAATT
GTAGAGATTATATCACTGAAAAATTTTTCCTCAACGGTTTAAAAAACAAT
ATTATTCCTATTGTAATGGGAGCTCACCCAGAAGATTACAGAAGAGTGGC
TCCGCCTCACTCATATATTCACGTAGAAGATTTCGATTCAATAGCAAAAT
TAGCAGACTATATCAAATACCTTGACAAAAACGACACTGCTTACAATGAA
TATTTCAGTTGGAAAGGATACGGCTTAGTTGACACAAATACATTTTTTTG
GTGTCGTCTTTGTATGATGGCTCACGAAGGTGAGAATGTGAAAAGCGTGC
TAAGAGATGTTTATAAATGGTGGAGTGGTGGGGAGCAGAAAATTTGCATC
AAAGCTGAAATGTGGAAAAATCAAAAATCTTAAGACCTATCAATACATTC
CATTCTTCAGATTTATCATTACAATTAAAAAATATCGAGAGTTTTCATTC
CAAACAGAATTCCAAAATATTCTGTATAATTTTTATTAGGGTTAATTTAA
CTATTCAATACAGGCAC
back to top

protein sequence of SMED30003087-orf-1

>SMED30003087-orf-1 ID=SMED30003087-orf-1|Name=SMED30003087-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=457bp
MVFRKLRIHFLKILILLLICVSFYNIFNLLHLENFKLESLFIPLANEETV
NNFKLKNKVKTQTPITNIQLQSQIDNSLFMRQGNFVIPDSSQMLQGKIKF
ALFPHLTNDSNDDRIWNQMRYRPNQFINGSLNIKEKLILLFNGMAGVTNK
ELEQCPVNQCKLTANRELATSAAVVLWMHNIIVPFHRRPPNQIWAFYFLE
SPIHTVQFPTFENNPNSLVNWTATYRHDSTIVAPYSKYTLYDLANPQPDR
YPLPKINFAAGKDKMAAWFVSNCASPNNRMGIVVELQKYIKVDIYGGCGK
LSCPRHQPNTCFNLLNKHYKFYLAFENSNCRDYITEKFFLNGLKNNIIPI
VMGAHPEDYRRVAPPHSYIHVEDFDSIAKLADYIKYLDKNDTAYNEYFSW
KGYGLVDTNTFFWCRLCMMAHEGENVKSVLRDVYKWWSGGEQKICIKAEM
WKNQKS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0036065fucosylation
GO:0006486protein glycosylation
GO:0007399nervous system development
GO:0036071N-glycan fucosylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR038577GT10-like_sf
IPR031481Glyco_tran_10_N
IPR001503Glyco_trans_10
Vocabulary: molecular function
TermDefinition
GO:0008417fucosyltransferase activity
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
GO:0018392glycoprotein 3-alpha-L-fucosyltransferase activity
GO:00339321,3-alpha-L-fucosidase activity
GO:0046920alpha-(1->3)-fucosyltransferase activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0000139Golgi membrane
GO:0005794Golgi apparatus
GO:0005797Golgi medial cisterna
GO:0016021integral component of membrane
GO:0032580Golgi cisterna membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR038577GT10-like superfamilyGENE3DG3DSA:3.40.50.11660coord: 197..416
e-value: 8.2E-48
score: 165.2
IPR031481Fucosyltransferase, N-terminalPFAMPF17039Glyco_tran_10_Ncoord: 134..235
e-value: 5.4E-18
score: 65.5
IPR001503Glycosyl transferase family 10PFAMPF00852Glyco_transf_10coord: 262..437
e-value: 2.1E-62
score: 210.0
IPR001503Glycosyl transferase family 10PANTHERPTHR11929ALPHA- 1,3 -FUCOSYLTRANSFERASEcoord: 149..447
NoneNo IPR availablePANTHERPTHR11929:SF192coord: 149..447
NoneNo IPR availableSUPERFAMILYSSF53756UDP-Glycosyltransferase/glycogen phosphorylasecoord: 132..438
NoneNo IPR availableTMHMMTMhelixcoord: 13..32