Cilia-and flagella-associated protein 45

Overview
NameCilia-and flagella-associated protein 45
Smed IDSMED30003084
Length (bp)1798
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cilia-and flagella-associated protein 45 (SMED30003084) t-SNE clustered cells

Violin plots show distribution of expression levels for Cilia-and flagella-associated protein 45 (SMED30003084) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cilia-and flagella-associated protein 45 (SMED30003084) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cilia-and flagella-associated protein 45 (SMED30003084) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003084

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30003084SMESG000016410.1 SmedASXL_009411SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30003084SMESG000016410.1 dd_Smed_v4_3732_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30003084SMESG000016410.1 dd_Smed_v4_3732_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30003084SMESG000016410.1 dd_Smed_v4_3732_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30003084SMESG000016410.1 dd_Smed_v4_3732_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30003084SMESG000016410.1 dd_Smed_v4_3732_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30003084SMESG000016410.1 dd_Smed_v6_3732_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30003084SMESG000016410.1 dd_Smed_v6_3732_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30003084SMESG000016410.1 dd_Smed_v6_3732_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003084SMESG000016410.1 dd_Smed_v6_3732_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30003084SMESG000016410.1 dd_Smed_v6_3732_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003084SMESG000016410.1 dd_Smed_v4_3732_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30003084SMESG000016410.1 dd_Smed_v4_3732_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cilia-and flagella-associated protein 45 vs. Ensembl Human
Match: CFAP45 (cilia and flagella associated protein 45 [Source:HGNC Symbol;Acc:HGNC:17229])

HSP 1 Score: 209.149 bits (531), Expect = 1.621e-59
Identity = 219/528 (41.48%), Postives = 351/528 (66.48%), Query Frame = 1
Query:  139 YKTVSRISRVEENLFGEPNYLKLRKTASNVEL--NVHESEPTVSYCS-DRKVCSNNNEYKEKEETIRIITKDMVRNLRVPREDPSFKSMVLDSDSFLKLRNRARIVSHEEKLKREEAIKTQKDEEMMASHGRRQEMKRHDILRQKNDKMTDLEEEAYQKAQTLLKKAMEQRQEQEDEIKKLNELISNAKIQAIRDAQXXXXXXXXXXXXXXDHRLDQMMEIERINAIRMQEGIELRRKEDELLAASSXXXXXXXXXXXXXXXXXXKDQENKLERERVAVLMEEELVKRSKIRQNQEKLRNDLNKSNEEMLERKIREKELEQLLDLRVLEIQREKALREAEFEAEAMRVKAEKEREVARLRALQERAKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLLQARAEQAEMKEHFLAIQAARDRAEFERTIRAQRELIERDKQMEEIEKSKRSEYSKEIRNQIRKNEETKIAERNAFFXXXXXXXXXXXXXXXXXXXXXNRKLEELRNAGISEKFLKQIERK 1713
            Y+T +  S V+E+LFG+       ++ S + L  + H  + T++    DRK            ETI++IT+DMVR L VP EDPS +S+++  + F +++  + +++ EE   R++A K +K+  M A   R++ MK+ +++   N K++DLEE A ++AQ LL++A + R EQE+E+K ++++I NAK  AIRDAQILEK+ I+KE   E+ RLDQMME+ER  +I+ QE +E +R+E+ +     I++Q+E+N++ER +  E+++QE +   E +  L EE+L    + +Q + K++ ++ + N+E  ++K      E+L D  V+E  ++K  REAEFEAE  R++ EKE+E+ARLRA+QE+A+D QAE+D LRA+R  E A+REWRRKE E+  KK + E +L ++R EQ   KEH LA+Q  RDR EFER +RAQRE IE+++  EE + + R +++ E+R Q+R+N++ ++  R A F+EG +++EE + RR R++E K +KLEELR  G+ EK+  + ERK
Sbjct:   25 YRTKAVSSEVDESLFGDIKSPAQGQSDSPIVLLRDKHTLQKTLTALGLDRKP-----------ETIQLITRDMVRELIVPTEDPSGESLIISPEEFERIKWASHVLTREELEARDQAFKKEKEATMDAVMTRKKIMKQKEMVWNNNKKLSDLEEVAKERAQNLLQRANKLRMEQEEELKDMSKIILNAKCHAIRDAQILEKQQIQKELDTEEKRLDQMMEVERQKSIQRQEELERKRREERIRGRRQIVEQMEKNQEERSLLAEQREQEKEQMLEYMEQLQEEDLKDMERRQQQKLKMQAEIKRINDENQKQKAELLAQEKLADQMVMEFTKKKMAREAEFEAEQERIRREKEKEIARLRAMQEKAQDYQAEQDALRAKRNQEVADREWRRKEKENARKKMETEAELRKSRLEQVAFKEHALAVQVQRDRDEFERILRAQREQIEKERLEEEKKATGRLQHANELRRQVRENQQKEVQNRIATFEEGRRLKEEAQKRRERIDEIKRKKLEELRATGLPEKYCIEAERK 541          
BLAST of Cilia-and flagella-associated protein 45 vs. Ensembl Human
Match: CFAP45 (cilia and flagella associated protein 45 [Source:HGNC Symbol;Acc:HGNC:17229])

HSP 1 Score: 186.808 bits (473), Expect = 6.106e-52
Identity = 198/456 (43.42%), Postives = 315/456 (69.08%), Query Frame = 1
Query:  346 MVRNLRVPREDPSFKSMVLDSDSFLKLRNRARIVSHEEKLKREEAIKTQKDEEMMASHGRRQEMKRHDILRQKNDKMTDLEEEAYQKAQTLLKKAMEQRQEQEDEIKKLNELISNAKIQAIRDAQXXXXXXXXXXXXXXDHRLDQMMEIERINAIRMQEGIELRRKEDELLAASSXXXXXXXXXXXXXXXXXXKDQENKLERERVAVLMEEELVKRSKIRQNQEKLRNDLNKSNEEMLERKIREKELEQLLDLRVLEIQREKALREAEFEAEAMRVKAEKEREVARLRALQERAKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLLQARAEQAEMKEHFLAIQAARDRAEFERTIRAQRELIERDKQMEEIEKSKRSEYSKEIRNQIRKNEETKIAERNAFFXXXXXXXXXXXXXXXXXXXXXNRKLEELRNAGISEKFLKQIERK 1713
            MVR L VP EDPS +S+++  + F +++  + +++ EE   R++A K +K+  M A   R++ MK+ +++   N K++DLEE A ++AQ LL++A + R EQE+E+K ++++I NAK  AIRDAQILEK+ I+KE   E+ RLDQMME+ER  +I+ QE +E +R+E+ +     I++Q+E+N++ER +  E+++QE +   E +  L EE+L    + +Q + K++ ++ + N+E  ++K      E+L D  V+E  ++K  REAEFEAE  R++ EKE+E+ARLRA+QE+A+D QAE+D LRA+R  E A+REWRRKE E+  KK + E +L ++R EQ   KEH LA+Q  RDR EFER +RAQRE IE+++  EE + + R +++ E+R Q+R+N++ ++  R A F+EG +++EE + RR R++E K +KLEELR  G+ EK+  + ERK
Sbjct:    1 MVRELIVPTEDPSGESLIISPEEFERIKWASHVLTREELEARDQAFKKEKEATMDAVMTRKKIMKQKEMVWNNNKKLSDLEEVAKERAQNLLQRANKLRMEQEEELKDMSKIILNAKCHAIRDAQILEKQQIQKELDTEEKRLDQMMEVERQKSIQRQEELERKRREERIRGRRQIVEQMEKNQEERSLLAEQREQEKEQMLEYMEQLQEEDLKDMERRQQQKLKMQAEIKRINDENQKQKAELLAQEKLADQMVMEFTKKKMAREAEFEAEQERIRREKEKEIARLRAMQEKAQDYQAEQDALRAKRNQEVADREWRRKEKENARKKMETEAELRKSRLEQVAFKEHALAVQVQRDRDEFERILRAQREQIEKERLEEEKKATGRLQHANELRRQVRENQQKEVQNRIATFEEGRRLKEEAQKRRERIDEIKRKKLEELRATGLPEKYCIEAERK 456          
BLAST of Cilia-and flagella-associated protein 45 vs. Ensembl Human
Match: CFAP45 (cilia and flagella associated protein 45 [Source:HGNC Symbol;Acc:HGNC:17229])

HSP 1 Score: 157.918 bits (398), Expect = 8.116e-42
Identity = 142/368 (38.59%), Postives = 238/368 (64.67%), Query Frame = 1
Query:  139 YKTVSRISRVEENLFGEPNYLKLRKTASNVEL--NVHESEPTVSYCS-DRKVCSNNNEYKEKEETIRIITKDMVRNLRVPREDPSFKSMVLDSDSFLKLRNRARIVSHEEKLKREEAIKTQKDEEMMASHGRRQEMKRHDILRQKNDKMTDLEEEAYQKAQTLLKKAMEQRQEQEDEIKKLNELISNAKIQAIRDAQXXXXXXXXXXXXXXDHRLDQMMEIERINAIRMQEGIELRRKEDELLAASSXXXXXXXXXXXXXXXXXXKDQENKLERERVAVLMEEELVKRSKIRQNQEKLRNDLNKSNEEMLERKIREKELEQLLDLRVLEIQREKALREAEFEAEAMRVKAEKEREVARLRALQERAKD 1233
            Y+T +  S V+E+LFG+       ++ S + L  + H  + T++    DRK            ETI++IT+DMVR L VP EDPS +S+++  + F +++  + +++ EE   R++A K +K+  M A   R++ MK+ +++   N K++DLEE A ++AQ LL++A + R EQE+E+K ++++I NAK  AIRDAQILEK+ I+KE   E+ RLDQMME+ER  +I+ QE +E +R+E+ +     I++Q+E+N++ER +  E+++QE +   E +  L EE+L    + +Q + K++ ++ + N+E  ++K      E+L D  V+E  ++K  REAEFEAE  R++ EKE+E+ARLRA+QE+A+D
Sbjct:   25 YRTKAVSSEVDESLFGDIKSPAQGQSDSPIVLLRDKHTLQKTLTALGLDRK-----------PETIQLITRDMVRELIVPTEDPSGESLIISPEEFERIKWASHVLTREELEARDQAFKKEKEATMDAVMTRKKIMKQKEMVWNNNKKLSDLEEVAKERAQNLLQRANKLRMEQEEELKDMSKIILNAKCHAIRDAQILEKQQIQKELDTEEKRLDQMMEVERQKSIQRQEELERKRREERIRGRRQIVEQMEKNQEERSLLAEQREQEKEQMLEYMEQLQEEDLKDMERRQQQKLKMQAEIKRINDENQKQKAELLAQEKLADQMVMEFTKKKMAREAEFEAEQERIRREKEKEIARLRAMQEKAQD 381          
BLAST of Cilia-and flagella-associated protein 45 vs. Ensembl Human
Match: CFAP45 (cilia and flagella associated protein 45 [Source:HGNC Symbol;Acc:HGNC:17229])

HSP 1 Score: 93.2041 bits (230), Expect = 1.030e-21
Identity = 51/125 (40.80%), Postives = 86/125 (68.80%), Query Frame = 1
Query:  346 MVRNLRVPREDPSFKSMVLDSDSFLKLRNRARIVSHEEKLKREEAIKTQKDEEMMASHGRRQEMKRHDILRQKNDKMTDLEEEAYQKAQTLLKKAMEQRQEQEDEIKKLNELISNAKIQAIRDAQ 720
            MVR L VP EDPS +S+++  + F +++  + +++ EE   R++A K +K+  M A   R++ MK+ +++   N K++DLEE A ++AQ LL++A + R EQE+E+K ++++I NAK  AIRDAQ
Sbjct:    1 MVRELIVPTEDPSGESLIISPEEFERIKWASHVLTREELEARDQAFKKEKEATMDAVMTRKKIMKQKEMVWNNNKKLSDLEEVAKERAQNLLQRANKLRMEQEEELKDMSKIILNAKCHAIRDAQ 125          
BLAST of Cilia-and flagella-associated protein 45 vs. Ensembl Zebrafish
Match: cfap45 (cilia and flagella associated protein 45 [Source:ZFIN;Acc:ZDB-GENE-070209-143])

HSP 1 Score: 228.794 bits (582), Expect = 4.935e-67
Identity = 239/525 (45.52%), Postives = 342/525 (65.14%), Query Frame = 1
Query:  139 YKTVSRISRVEENLFGEPNYLKLRKTASNVELNVHESEPTVSYCSDRKVCSNNNEYKEKEETIRIITKDMVRNLRVPREDPSFKSMVLDSDSFLKLRNRARIVSHEEKLKREEAIKTQKDEEMMASHGRRQEMKRHDILRQKNDKMTDLEEEAYQKAQTLLKKAMEQRQEQEDEIKKLNELISNAKIQAIRDAQXXXXXXXXXXXXXXDHRLDQMMEIERINAIRMQEGIELRRKEDELLAASSXXXXXXXXXXXXXXXXXXKDQENKLERERVAVLMEEELVKRSKIRQNQEKLRNDLNKSNEEMLERKIREKELEQLLDLRVLEIQREKALREAEFEAEAMRVKAEKEREVARLRALQERAKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLLQARAEQAEMKEHFLAIQAARDRAEFERTIRAQRELIERDKQMEEIEKSKRSEYSKEIRNQIRKNEETKIAERNAFFXXXXXXXXXXXXXXXXXXXXXNRKLEELRNAGISEKFLKQIERK 1713
            Y+T +  S V+E+LFG P   KL  TA        E+E T S        S  +  + K ETIRIITKD++R+LR+P EDPS +S++L S+ F ++   + + S EEK  R EA +   +E M A+  R+ +M++ D+ RQKN  +++LE EA  +AQ LL++A   R EQEDE+KKLNELI   +  A+RD QI E+++   E L E+ RLD MME+ER  A+  QE IE  RK+  +     II QI+  ++E+L++ E K+QE +   E +  +  EEL    K ++ Q+KL  ++ K NEE L  K ++KE E+L DLR +E  R K  REAE+EAE +R+K +KE+EVARLRALQER +D +AE+DE+RARR  E A REWRRKE E   +K +VEE L  AR EQ   KEH L+I+A R+RAEFER +RAQ+ELIER+ + EE  + +  +++  +R Q+R+ E   + +R   F+E E++EEE R RR R++E K +KL+EL+ AG+S K+ K++ERK
Sbjct:   22 YRTRALTSHVDESLFGSP---KLHSTADMHNHPEGENERTRSLSH-----SAPSSKEPKSETIRIITKDLIRDLRIPSEDPSGQSVILSSNEFRRIMAESHVPSEEEKTARLEAQRQALEEAMDAAEQRKAQMRQADLSRQKNQNLSELEAEARDRAQYLLERANTLRMEQEDEVKKLNELIQKVQCHAVRDVQIQERKLNSAEWLAEEKRLDAMMEVERRQALEAQEQIEQLRKQQRIQGKMCIIDQIQTRQEEKLLQDEMKEQEGQQLLENMERMQMEELKGIEKKKEEQKKLLQEIQKINEENLLAKEQKKEEERLADLRAVEYTRNKLEREAEYEAEQIRIKKDKEKEVARLRALQERDRDHKAEQDEIRARRNQEAAAREWRRKEKEQAKRKLEVEERLKAARLEQVTHKEHLLSIEAGRERAEFERVLRAQQELIEREYEKEEQRQQQIQKHADAVRQQVREREMQAVTQRREMFRERERLEEEARNRRARLDEIKEKKLKELKAAGLSPKYYKEVERK 538          
BLAST of Cilia-and flagella-associated protein 45 vs. Ensembl Zebrafish
Match: cfap45 (cilia and flagella associated protein 45 [Source:ZFIN;Acc:ZDB-GENE-070209-143])

HSP 1 Score: 212.616 bits (540), Expect = 1.645e-61
Identity = 221/467 (47.32%), Postives = 317/467 (67.88%), Query Frame = 1
Query:  313 KEETIRIITKDMVRNLRVPREDPSFKSMVLDSDSFLKLRNRARIVSHEEKLKREEAIKTQKDEEMMASHGRRQEMKRHDILRQKNDKMTDLEEEAYQKAQTLLKKAMEQRQEQEDEIKKLNELISNAKIQAIRDAQXXXXXXXXXXXXXXDHRLDQMMEIERINAIRMQEGIELRRKEDELLAASSXXXXXXXXXXXXXXXXXXKDQENKLERERVAVLMEEELVKRSKIRQNQEKLRNDLNKSNEEMLERKIREKELEQLLDLRVLEIQREKALREAEFEAEAMRVKAEKEREVARLRALQERAKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLLQARAEQAEMKEHFLAIQAARDRAEFERTIRAQRELIERDKQMEEIEKSKRSEYSKEIRNQIRKNEETKIAERNAFFXXXXXXXXXXXXXXXXXXXXXNRKLEELRNAGISEKFLKQIERK 1713
            K ETIRIITKD++R+LR+P EDPS +S++L S+ F ++   + + S EEK  R EA +   +E M A+  R+ +M++ D+ RQKN  +++LE EA  +AQ LL++A   R EQEDE+KKLNELI   +  A+RD QI E+++   E L E+ RLD MME+ER  A+  QE IE  RK+  +     II QI+  ++E+L++ E K+QE +   E +  +  EEL    K ++ Q+KL  ++ K NEE L  K ++KE E+L DLR +E  R K  REAE+EAE +R+K +KE+EVARLRALQER +D +AE+DE+RARR  E A REWRRKE E   +K +VEE L  AR EQ   KEH L+I+A R+RAEFER +RAQ+ELIER+ + EE  + +  +++  +R Q+R+ E   + +R   F+E E++EEE R RR R++E K +KL+EL+ AG+S K+ K++ERK
Sbjct:   26 KSETIRIITKDLIRDLRIPSEDPSGQSVILSSNEFRRIMAESHVPSEEEKTARLEAQRQALEEAMDAAEQRKAQMRQADLSRQKNQNLSELEAEARDRAQYLLERANTLRMEQEDEVKKLNELIQKVQCHAVRDVQIQERKLNSAEWLAEEKRLDAMMEVERRQALEAQEQIEQLRKQQRIQGKMCIIDQIQTRQEEKLLQDEMKEQEGQQLLENMERMQMEELKGIEKKKEEQKKLLQEIQKINEENLLAKEQKKEEERLADLRAVEYTRNKLEREAEYEAEQIRIKKDKEKEVARLRALQERDRDHKAEQDEIRARRNQEAAAREWRRKEKEQAKRKLEVEERLKAARLEQVTHKEHLLSIEAGRERAEFERVLRAQQELIEREYEKEEQRQQQIQKHADAVRQQVREREMQAVTQRREMFRERERLEEEARNRRARLDEIKEKKLKELKAAGLSPKYYKEVERK 492          
BLAST of Cilia-and flagella-associated protein 45 vs. Ensembl Zebrafish
Match: cfap45 (cilia and flagella associated protein 45 [Source:ZFIN;Acc:ZDB-GENE-070209-143])

HSP 1 Score: 152.14 bits (383), Expect = 1.121e-40
Identity = 103/236 (43.64%), Postives = 146/236 (61.86%), Query Frame = 1
Query:  139 YKTVSRISRVEENLFGEPNYLKLRKTASNVELNVHESEPTVSYCSDRKVCSNNNEYKEKEETIRIITKDMVRNLRVPREDPSFKSMVLDSDSFLKLRNRARIVSHEEKLKREEAIKTQKDEEMMASHGRRQEMKRHDILRQKNDKMTDLEEEAYQKAQTLLKKAMEQRQEQEDEIKKLNELISNAKIQAIRDAQXXXXXXXXXXXXXXDHRLDQMMEIERINAIRMQEGIELRRKE 846
            Y+T +  S V+E+LFG P   KL  TA        E+E T S        S  +  + K ETIRIITKD++R+LR+P EDPS +S++L S+ F ++   + + S EEK  R EA +   +E M A+  R+ +M++ D+ RQKN  +++LE EA  +AQ LL++A   R EQEDE+KKLNELI   +  A+RD QI E+++   E L E+ RLD MME+ER  A+  QE IE  RK+
Sbjct:   22 YRTRALTSHVDESLFGSP---KLHSTADMHNHPEGENERTRSLSH-----SAPSSKEPKSETIRIITKDLIRDLRIPSEDPSGQSVILSSNEFRRIMAESHVPSEEEKTARLEAQRQALEEAMDAAEQRKAQMRQADLSRQKNQNLSELEAEARDRAQYLLERANTLRMEQEDEVKKLNELIQKVQCHAVRDVQIQERKLNSAEWLAEEKRLDAMMEVERRQALEAQEQIEQLRKQ 249          
BLAST of Cilia-and flagella-associated protein 45 vs. Ensembl Xenopus
Match: cfap45 (cilia and flagella associated protein 45 [Source:NCBI gene;Acc:394876])

HSP 1 Score: 252.292 bits (643), Expect = 9.632e-76
Identity = 227/525 (43.24%), Postives = 355/525 (67.62%), Query Frame = 1
Query:  139 YKTVSRISRVEENLFGEPNYLKLRKTASNVELNVHESEPTVSYCSDRKVCSNNNEYKEKEETIRIITKDMVRNLRVPREDPSFKSMVLDSDSFLKLRNRARIVSHEEKLKREEAIKTQKDEEMMASHGRRQEMKRHDILRQKNDKMTDLEEEAYQKAQTLLKKAMEQRQEQEDEIKKLNELISNAKIQAIRDAQXXXXXXXXXXXXXXDHRLDQMMEIERINAIRMQEGIELRRKEDELLAASSXXXXXXXXXXXXXXXXXXKDQENKLERERVAVLMEEELVKRSKIRQNQEKLRNDLNKSNEEMLERKIREKELEQLLDLRVLEIQREKALREAEFEAEAMRVKAEKEREVARLRALQERAKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLLQARAEQAEMKEHFLAIQAARDRAEFERTIRAQRELIERDKQMEEIEKSKRSEYSKEIRNQIRKNEETKIAERNAFFXXXXXXXXXXXXXXXXXXXXXNRKLEELRNAGISEKFLKQIERK 1713
            Y+T +  S V+E+LFG      +++ A + +  V +  P       RK  S       K ETI+IIT D++R+L VP EDPS  S+++    F+++++ AR+++ EE+L   +++K  K+E + A + R+  MK+ ++LR+KN+K+++LEEEA Q+AQ LL++A   R EQEDEIK+LNE+I + K  AIRDAQ+LEK+ I KE   E+ RLDQMME+ER  AIRMQE +E +RK++++     II+Q+E+N++ R++  E+K+QE +   + +  L  ++  +  + RQ Q +++ ++ + N E  ++KI  KE E+L DLRVLE  ++K  REAE+EAE  R+K EKE EVARLRALQERA+D +AE+D LRA+R  E  ER WR+KE E   K+ ++   + Q R EQ   KEH LA+QA RDR+EF R +R QR +IE++++  E + S+  +++ E+R Q+R+NE+ ++  R  +F+EG++++EE R RR R++E K +KL+ELR AG+ +K+L  + RK
Sbjct:   23 YRTKALNSEVDESLFG------VKQPAKD-DSPVAQKNPN----GRRKATSAPTRVY-KPETIQIITSDLIRDLVVPSEDPSGMSLIMTPQDFVRVKSAARVLTKEEELMATQSLKKAKEEAIEAVNERKNHMKQKEMLRKKNEKLSELEEEAQQRAQYLLQRANTLRMEQEDEIKRLNEVILHTKCHAIRDAQVLEKKQIIKELDTEERRLDQMMEVERQKAIRMQEEVEEKRKQEKIRGKFHIIKQMEENQETRILAEEQKEQEAQQMLQYLDELQMQDYEEMKRRRQEQLQVQGEIQQINAENAKKKIERKEQEKLADLRVLEYNKQKMAREAEYEAEQQRIKKEKELEVARLRALQERARDYRAEQDALRAKRNQEAMERAWRQKEKEVAQKQAEMNSMMKQTRMEQIAQKEHCLAVQAQRDRSEFNRVLREQRMMIEKERKELEEKNSQLMKHAAELRRQVRENEQKQVLARVDYFEEGKRLDEEARQRRARLDELKQKKLKELRTAGLPDKYLSMVTRK 535          
BLAST of Cilia-and flagella-associated protein 45 vs. Ensembl Xenopus
Match: cfap45 (cilia and flagella associated protein 45 [Source:NCBI gene;Acc:394876])

HSP 1 Score: 228.024 bits (580), Expect = 2.100e-67
Identity = 204/451 (45.23%), Postives = 318/451 (70.51%), Query Frame = 1
Query:  361 RVPREDPSFKSMVLDSDSFLKLRNRARIVSHEEKLKREEAIKTQKDEEMMASHGRRQEMKRHDILRQKNDKMTDLEEEAYQKAQTLLKKAMEQRQEQEDEIKKLNELISNAKIQAIRDAQXXXXXXXXXXXXXXDHRLDQMMEIERINAIRMQEGIELRRKEDELLAASSXXXXXXXXXXXXXXXXXXKDQENKLERERVAVLMEEELVKRSKIRQNQEKLRNDLNKSNEEMLERKIREKELEQLLDLRVLEIQREKALREAEFEAEAMRVKAEKEREVARLRALQERAKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLLQARAEQAEMKEHFLAIQAARDRAEFERTIRAQRELIERDKQMEEIEKSKRSEYSKEIRNQIRKNEETKIAERNAFFXXXXXXXXXXXXXXXXXXXXXNRKLEELRNAGISEKFLKQIERK 1713
            RVP EDPS  S+++    F+++++ AR+++ EE+L   +++K  K+E + A + R+  MK+ ++LR+KN+K+++LEEEA Q+AQ LL++A   R EQEDEIK+LNE+I + K  AIRDAQ+LEK+ I KE   E+ RLDQMME+ER  AIRMQE +E +RK++++     II+Q+E+N++ R++  E+K+QE +   + +  L  ++  +  + RQ Q +++ ++ + N E  ++KI  KE E+L DLRVLE  ++K  REAE+EAE  R+K EKE EVARLRALQERA+D +AE+D LRA+R  E  ER WR+KE E   K+ ++   + Q R EQ   KEH LA+QA RDR+EF R +R QR +IE++++  E + S+  +++ E+R Q+R+NE+ ++  R  +F+EG++++EE R RR R++E K +KL+ELR AG+ +K+L  + RK
Sbjct:    7 RVPSEDPSGMSLIMTPQDFVRVKSAARVLTKEEELMATQSLKKAKEEAIEAVNERKNHMKQKEMLRKKNEKLSELEEEAQQRAQYLLQRANTLRMEQEDEIKRLNEVILHTKCHAIRDAQVLEKKQIIKELDTEERRLDQMMEVERQKAIRMQEEVEEKRKQEKIRGKFHIIKQMEENQETRILAEEQKEQEAQQMLQYLDELQMQDYEEMKRRRQEQLQVQGEIQQINAENAKKKIERKEQEKLADLRVLEYNKQKMAREAEYEAEQQRIKKEKELEVARLRALQERARDYRAEQDALRAKRNQEAMERAWRQKEKEVAQKQAEMNSMMKQTRMEQIAQKEHCLAVQAQRDRSEFNRVLREQRMMIEKERKELEEKNSQLMKHAAELRRQVRENEQKQVLARVDYFEEGKRLDEEARQRRARLDELKQKKLKELRTAGLPDKYLSMVTRK 457          
BLAST of Cilia-and flagella-associated protein 45 vs. Ensembl Xenopus
Match: cfap45 (cilia and flagella associated protein 45 [Source:NCBI gene;Acc:394876])

HSP 1 Score: 214.157 bits (544), Expect = 4.041e-62
Identity = 183/408 (44.85%), Postives = 284/408 (69.61%), Query Frame = 1
Query:  358 LRVPREDPSFKSMVLDSDSFLKLRNRARIVSHEEKLKREEAIKTQKDEEMMASHGRRQEMKRHDILRQKNDKMTDLEEEAYQKAQTLLKKAMEQRQEQEDEIKKLNELISNAKIQAIRDAQXXXXXXXXXXXXXXDHRLDQMMEIERINAIRMQEGIELRRKEDELLAASSXXXXXXXXXXXXXXXXXXKDQENKLERERVAVLMEEELVKRSKIRQNQEKLRNDLNKSNEEMLERKIREKELEQLLDLRVLEIQREKALREAEFEAEAMRVKAEKEREVARLRALQERAKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLLQARAEQAEMKEHFLAIQAARDRAEFERTIRAQRELIERDKQMEEIEKSKRSEYSKEIRNQIRKNEETKIAERNAFF 1581
             RVP EDPS  S+++    F+++++ AR+++ EE+L   +++K  K+E + A + R+  MK+ ++LR+KN+K+++LEEEA Q+AQ LL++A   R EQEDEIK+LNE+I + K  AIRDAQ+LEK+ I KE   E+ RLDQMME+ER  AIRMQE +E +RK++++     II+Q+E+N++ R++  E+K+QE +   + +  L  ++  +  + RQ Q +++ ++ + N E  ++KI  KE E+L DLRVLE  ++K  REAE+EAE  R+K EKE EVARLRALQERA+D +AE+D LRA+R  E  ER WR+KE E   K+ ++   + Q R EQ   KEH LA+QA RDR+EF R +R QR +IE++++  E + S+  +++ E+R Q+R+NE+ ++  R  +F
Sbjct:    6 CRVPSEDPSGMSLIMTPQDFVRVKSAARVLTKEEELMATQSLKKAKEEAIEAVNERKNHMKQKEMLRKKNEKLSELEEEAQQRAQYLLQRANTLRMEQEDEIKRLNEVILHTKCHAIRDAQVLEKKQIIKELDTEERRLDQMMEVERQKAIRMQEEVEEKRKQEKIRGKFHIIKQMEENQETRILAEEQKEQEAQQMLQYLDELQMQDYEEMKRRRQEQLQVQGEIQQINAENAKKKIERKEQEKLADLRVLEYNKQKMAREAEYEAEQQRIKKEKELEVARLRALQERARDYRAEQDALRAKRNQEAMERAWRQKEKEVAQKQAEMNSMMKQTRMEQIAQKEHCLAVQAQRDRSEFNRVLREQRMMIEKERKELEEKNSQLMKHAAELRRQVRENEQKQVLARVDYF 413          
BLAST of Cilia-and flagella-associated protein 45 vs. Ensembl Xenopus
Match: cfap45 (cilia and flagella associated protein 45 [Source:NCBI gene;Acc:394876])

HSP 1 Score: 191.045 bits (484), Expect = 4.142e-54
Identity = 187/401 (46.63%), Postives = 284/401 (70.82%), Query Frame = 1
Query:  511 ASHGRRQEMKRHDILRQKNDKMTDLEEEAYQKAQTLLKKAMEQRQEQEDEIKKLNELISNAKIQAIRDAQXXXXXXXXXXXXXXDHRLDQMMEIERINAIRMQEGIELRRKEDELLAASSXXXXXXXXXXXXXXXXXXKDQENKLERERVAVLMEEELVKRSKIRQNQEKLRNDLNKSNEEMLERKIREKELEQLLDLRVLEIQREKALREAEFEAEAMRVKAEKEREVARLRALQERAKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLLQARAEQAEMKEHFLAIQAARDRAEFERTIRAQRELIERDKQMEEIEKSKRSEYSKEIRNQIRKNEETKIAERNAFFXXXXXXXXXXXXXXXXXXXXXNRKLEELRNAGISEKFLKQIERK 1713
            A + R+  MK+ ++LR+KN+K+++LEEEA Q+AQ LL++A   R EQEDEIK+LNE+I + K  AIRDAQ+LEK+ I KE   E+ RLDQMME+ER  AIRMQE +E +RK++++     II+Q+E+N++ R++  E+K+QE +   + +  L  ++  +  + RQ Q +++ ++ + N E  ++KI  KE E+L DLRVLE  ++K  REAE+EAE  R+K EKE EVARLRALQERA+D +AE+D LRA+R  E  ER WR+KE E   K+ ++   + Q R EQ   KEH LA+QA RDR+EF R +R QR +IE++++  E + S+  +++ E+R Q+R+NE+ ++  R  +F+EG++++EE R RR R++E K +KL+ELR AG+ +K+L  + RK
Sbjct:    9 AVNERKNHMKQKEMLRKKNEKLSELEEEAQQRAQYLLQRANTLRMEQEDEIKRLNEVILHTKCHAIRDAQVLEKKQIIKELDTEERRLDQMMEVERQKAIRMQEEVEEKRKQEKIRGKFHIIKQMEENQETRILAEEQKEQEAQQMLQYLDELQMQDYEEMKRRRQEQLQVQGEIQQINAENAKKKIERKEQEKLADLRVLEYNKQKMAREAEYEAEQQRIKKEKELEVARLRALQERARDYRAEQDALRAKRNQEAMERAWRQKEKEVAQKQAEMNSMMKQTRMEQIAQKEHCLAVQAQRDRSEFNRVLREQRMMIEKERKELEEKNSQLMKHAAELRRQVRENEQKQVLARVDYFEEGKRLDEEARQRRARLDELKQKKLKELRTAGLPDKYLSMVTRK 409          
BLAST of Cilia-and flagella-associated protein 45 vs. Ensembl Mouse
Match: Cfap45 (cilia and flagella associated protein 45 [Source:MGI Symbol;Acc:MGI:1919120])

HSP 1 Score: 200.29 bits (508), Expect = 2.641e-56
Identity = 217/518 (41.89%), Postives = 340/518 (65.64%), Query Frame = 1
Query:  160 SRVEENLFGEPNYLKLRKTASNVELNVHESEPTVSYCSDRKVCSNNNEYKEKEETIRIITKDMVRNLRVPREDPSFKSMVLDSDSFLKLRNRARIVSHEEKLKREEAIKTQKDEEMMASHGRRQEMKRHDILRQKNDKMTDLEEEAYQKAQTLLKKAMEQRQEQEDEIKKLNELISNAKIQAIRDAQXXXXXXXXXXXXXXDHRLDQMMEIERINAIRMQEGIELRRKEDELLAASSXXXXXXXXXXXXXXXXXXKDQENKLERERVAVLMEEELVKRSKIRQNQEKLRNDLNKSNEEMLERKIREKELEQLLDLRVLEIQREKALREAEFEAEAMRVKAEKEREVARLRALQERAKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLLQARAEQAEMKEHFLAIQAARDRAEFERTIRAQRELIERDKQMEEIEKSKRSEYSKEIRNQIRKNEETKIAERNAFFXXXXXXXXXXXXXXXXXXXXXNRKLEELRNAGISEKFLKQIERK 1713
            S V+E+LFG        K+ S + + +H+          RK  S     + K ETI++IT+DMVR L VP EDPS +S+++  + F +++  +++++ EE   RE+A+K +K+  + A   R++ MK+ ++    N K++DLEE A ++AQ LL++A + R EQE+E+K ++++I NAK  AIRDAQILEK+ I+KE  EE+ RLD MMEI+R  +++ QE  E +R+E+ +     I++QI++NE+ER ++ E ++QE +     +  L EE+L    +  Q + K++ ++ + N+E   +K      E+L D  V+E  ++K  REAE+EAE  +++ EKE+E+ARLRALQE+A+D QAE+D LRA+R  E A+REWRRKE E+  KK + EE L ++R EQ   KEH LA+Q  RDR EFER +RAQRE IER+KQ +E +     +++ E+R Q+R+N++  +  R A F+EG +++EE   RR R+E+ K +KLEELR  G+ EK+  ++ERK
Sbjct:   32 SEVDESLFGGVKPSSQGKSDSPI-VVIHDKHAI------RKTLSALG-LEHKTETIQLITRDMVRELIVPTEDPSGESLIISPEEFERIKWASQVLTKEELNAREQALKKEKEGILEAVTIRKKIMKQKEMTWNNNKKLSDLEEVARERAQNLLQRADKLRMEQEEELKDMSKIILNAKCHAIRDAQILEKQQIQKELDEEERRLDHMMEIDRRESLQRQEDRERKRREERVRGKRHIVEQIKKNEEERSLQAEHREQEKEQMLAYLDRLQEEDLQDLERRHQEKLKMQAEIKRINDENQRQKAEMLAQERLADQMVMEFTKKKMAREAEYEAEQEKIRREKEKEIARLRALQEKAQDYQAEQDALRAKRNQEVADREWRRKEKENAQKKIETEEKLRKSRLEQVAFKEHTLAVQVQRDRDEFERILRAQREQIEREKQEQEKKAKGCLQHANELRRQVRENQQKHVQNRLATFEEGRRLKEEAEKRRERIEDIKKQKLEELRATGLPEKYCIEVERK 541          
BLAST of Cilia-and flagella-associated protein 45 vs. Ensembl Mouse
Match: Cfap45 (cilia and flagella associated protein 45 [Source:MGI Symbol;Acc:MGI:1919120])

HSP 1 Score: 85.1149 bits (209), Expect = 6.613e-19
Identity = 59/167 (35.33%), Postives = 102/167 (61.08%), Query Frame = 1
Query:  160 SRVEENLFGEPNYLKLRKTASNVELNVHESEPTVSYCSDRKVCSNNNEYKEKEETIRIITKDMVRNLRVPREDPSFKSMVLDSDSFLKLRNRARIVSHEEKLKREEAIKTQKDEEMMASHGRRQEMKRHDILRQKNDKMTDLEEEAYQKAQTLLKKAMEQRQEQEDE 660
            S V+E+LFG        K+ S + + +H+        + RK  S     + K ETI++IT+DMVR L VP EDPS +S+++  + F +++  +++++ EE   RE+A+K +K+  + A   R++ MK+ ++    N K++DLEE A ++AQ LL++A + R EQE+E
Sbjct:    3 SEVDESLFGGVKPSSQGKSDSPI-VVIHDKH------AIRKTLSALG-LEHKTETIQLITRDMVRELIVPTEDPSGESLIISPEEFERIKWASQVLTKEELNAREQALKKEKEGILEAVTIRKKIMKQKEMTWNNNKKLSDLEEVARERAQNLLQRADKLRMEQEEE 161          
BLAST of Cilia-and flagella-associated protein 45 vs. Ensembl Mouse
Match: Cfap45 (cilia and flagella associated protein 45 [Source:MGI Symbol;Acc:MGI:1919120])

HSP 1 Score: 85.1149 bits (209), Expect = 6.613e-19
Identity = 59/167 (35.33%), Postives = 102/167 (61.08%), Query Frame = 1
Query:  160 SRVEENLFGEPNYLKLRKTASNVELNVHESEPTVSYCSDRKVCSNNNEYKEKEETIRIITKDMVRNLRVPREDPSFKSMVLDSDSFLKLRNRARIVSHEEKLKREEAIKTQKDEEMMASHGRRQEMKRHDILRQKNDKMTDLEEEAYQKAQTLLKKAMEQRQEQEDE 660
            S V+E+LFG        K+ S + + +H+        + RK  S     + K ETI++IT+DMVR L VP EDPS +S+++  + F +++  +++++ EE   RE+A+K +K+  + A   R++ MK+ ++    N K++DLEE A ++AQ LL++A + R EQE+E
Sbjct:    3 SEVDESLFGGVKPSSQGKSDSPI-VVIHDKH------AIRKTLSALG-LEHKTETIQLITRDMVRELIVPTEDPSGESLIISPEEFERIKWASQVLTKEELNAREQALKKEKEGILEAVTIRKKIMKQKEMTWNNNKKLSDLEEVARERAQNLLQRADKLRMEQEEE 161          
BLAST of Cilia-and flagella-associated protein 45 vs. Ensembl Mouse
Match: Cfap45 (cilia and flagella associated protein 45 [Source:MGI Symbol;Acc:MGI:1919120])

HSP 1 Score: 68.1662 bits (165), Expect = 2.230e-13
Identity = 37/95 (38.95%), Postives = 65/95 (68.42%), Query Frame = 1
Query:  313 KEETIRIITKDMVRNLRVPREDPSFKSMVLDSDSFLKLRNRARIVSHEEKLKREEAIKTQKDEEMMASHGRRQEMKRHDILRQKNDKMTDLEEEA 597
            K ETI++IT+DMVR L VP EDPS +S+++  + F +++  +++++ EE   RE+A+K +K+  + A   R++ MK+ ++    N K++DLEE A
Sbjct:   33 KTETIQLITRDMVRELIVPTEDPSGESLIISPEEFERIKWASQVLTKEELNAREQALKKEKEGILEAVTIRKKIMKQKEMTWNNNKKLSDLEEVA 127          
BLAST of Cilia-and flagella-associated protein 45 vs. Ensembl Mouse
Match: Cfap45 (cilia and flagella associated protein 45 [Source:MGI Symbol;Acc:MGI:1919120])

HSP 1 Score: 61.6178 bits (148), Expect = 4.906e-11
Identity = 44/140 (31.43%), Postives = 81/140 (57.86%), Query Frame = 1
Query:  160 SRVEENLFGEPNYLKLRKTASNVELNVHESEPTVSYCSDRKVCSNNNEYKEKEETIRIITKDMVRNLRVPREDPSFKSMVLDSDSFLKLRNRARIVSHEEKLKREEAIKTQKDEEMMASHGRRQEMKRHDILRQKNDKMT 579
            S V+E+LFG        K+ S + + +H+        + RK  S     + K ETI++IT+DMVR L VP EDPS +S+++  + F +++  +++++ EE   RE+A+K +K+  + A   R++ MK+ ++    N K++
Sbjct:    3 SEVDESLFGGVKPSSQGKSDSPI-VVIHDKH------AIRKTLSALG-LEHKTETIQLITRDMVRELIVPTEDPSGESLIISPEEFERIKWASQVLTKEELNAREQALKKEKEGILEAVTIRKKIMKQKEMTWNNNKKLS 134          
BLAST of Cilia-and flagella-associated protein 45 vs. UniProt/SwissProt
Match: sp|Q9UL16|CFA45_HUMAN (Cilia- and flagella-associated protein 45 OS=Homo sapiens OX=9606 GN=CFAP45 PE=1 SV=2)

HSP 1 Score: 209.149 bits (531), Expect = 7.786e-59
Identity = 219/528 (41.48%), Postives = 351/528 (66.48%), Query Frame = 1
Query:  139 YKTVSRISRVEENLFGEPNYLKLRKTASNVEL--NVHESEPTVSYCS-DRKVCSNNNEYKEKEETIRIITKDMVRNLRVPREDPSFKSMVLDSDSFLKLRNRARIVSHEEKLKREEAIKTQKDEEMMASHGRRQEMKRHDILRQKNDKMTDLEEEAYQKAQTLLKKAMEQRQEQEDEIKKLNELISNAKIQAIRDAQXXXXXXXXXXXXXXDHRLDQMMEIERINAIRMQEGIELRRKEDELLAASSXXXXXXXXXXXXXXXXXXKDQENKLERERVAVLMEEELVKRSKIRQNQEKLRNDLNKSNEEMLERKIREKELEQLLDLRVLEIQREKALREAEFEAEAMRVKAEKEREVARLRALQERAKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLLQARAEQAEMKEHFLAIQAARDRAEFERTIRAQRELIERDKQMEEIEKSKRSEYSKEIRNQIRKNEETKIAERNAFFXXXXXXXXXXXXXXXXXXXXXNRKLEELRNAGISEKFLKQIERK 1713
            Y+T +  S V+E+LFG+       ++ S + L  + H  + T++    DRK            ETI++IT+DMVR L VP EDPS +S+++  + F +++  + +++ EE   R++A K +K+  M A   R++ MK+ +++   N K++DLEE A ++AQ LL++A + R EQE+E+K ++++I NAK  AIRDAQILEK+ I+KE   E+ RLDQMME+ER  +I+ QE +E +R+E+ +     I++Q+E+N++ER +  E+++QE +   E +  L EE+L    + +Q + K++ ++ + N+E  ++K      E+L D  V+E  ++K  REAEFEAE  R++ EKE+E+ARLRA+QE+A+D QAE+D LRA+R  E A+REWRRKE E+  KK + E +L ++R EQ   KEH LA+Q  RDR EFER +RAQRE IE+++  EE + + R +++ E+R Q+R+N++ ++  R A F+EG +++EE + RR R++E K +KLEELR  G+ EK+  + ERK
Sbjct:   25 YRTKAVSSEVDESLFGDIKSPAQGQSDSPIVLLRDKHTLQKTLTALGLDRKP-----------ETIQLITRDMVRELIVPTEDPSGESLIISPEEFERIKWASHVLTREELEARDQAFKKEKEATMDAVMTRKKIMKQKEMVWNNNKKLSDLEEVAKERAQNLLQRANKLRMEQEEELKDMSKIILNAKCHAIRDAQILEKQQIQKELDTEEKRLDQMMEVERQKSIQRQEELERKRREERIRGRRQIVEQMEKNQEERSLLAEQREQEKEQMLEYMEQLQEEDLKDMERRQQQKLKMQAEIKRINDENQKQKAELLAQEKLADQMVMEFTKKKMAREAEFEAEQERIRREKEKEIARLRAMQEKAQDYQAEQDALRAKRNQEVADREWRRKEKENARKKMETEAELRKSRLEQVAFKEHALAVQVQRDRDEFERILRAQREQIEKERLEEEKKATGRLQHANELRRQVRENQQKEVQNRIATFEEGRRLKEEAQKRRERIDEIKRKKLEELRATGLPEKYCIEAERK 541          
BLAST of Cilia-and flagella-associated protein 45 vs. UniProt/SwissProt
Match: sp|A8I9E8|CFA45_CHLRE (Cilia- and flagella-associated protein 45 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP45 PE=1 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 3.911e-10
Identity = 142/410 (34.63%), Postives = 229/410 (55.85%), Query Frame = 1
Query:  550 ILRQKNDKMTDLEEEAYQKAQTLLKKAMEQRQ--------------EQEDEIKKLNELISNAKIQAIRDAQXXXXXXXXXXXXXXDHRLDQMMEIERINAIRMQEGIELRRKEDELLAASSXXXXXXXXXXXXXXXXXXKDQENKLERERVAVLMEEELVKRSKIRQNQEKLRNDLNKSNEEMLERK----IREKELEQLLDLRVLEIQREKALREAEFEAEAMRVKAEKEREVARLRALQERAKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLLQARAEQAEMKEHFLAIQAARDRAEFERTIRAQRELIERDKQMEEIEKSK-----RSEYSKEIRNQIRKNEETKIAERNAFFXXXXXXXXXXXXXXXXXXXXXNRKLEELRNAGISEKFLKQIER 1710
            + + + +KM  LEEEA ++A     + + QRQ              EQ+D +K +N+++  +K   IRDAQI EK+ +  E  EE  RLD MMEIER+ A+   E  E +R E+    A+ + +QI++ E+ER+ + E +DQE       +  L EEE+  + + +   ++L  ++  +N E ++RK    +REKE     DLR+ +   +K +RE    AE  R+  EKE E ARLRA+QERA D+Q+E DELRARR  E  EREWR+KE  +  ++  ++++L  AR  Q   K    A  A  +  EF R +      + R K+ +E++++       S+Y +E+  QI+ NEE +  ER+ + +EG ++ E     R  + + K+RKL EL +AG+  K+  ++E+
Sbjct:   97 VSKARKEKMLKLEEEAKKQAPPTETEIL-QRQLNDATRSRATHMMLEQKDPVKHMNQMMLYSKCVTIRDAQIEEKKQMLAEEEEEQRRLDLMMEIERVKALEQYEARERQRVEERRKGAAVLSEQIKERERERIRQEELRDQERLQMLREIERLKEEEMQAQIEKKIQAKQLMEEVAAANSEQIKRKEGMKVREKEE----DLRIADYILQKEMREQSLAAEKERIAKEKEMETARLRAMQERAADKQSELDELRARRYQEAKEREWRQKERAYAERQASMQQELANARTAQQASKLKQKAEMARLEHDEFMRVLD-----VNRAKEYDELQQTVNAMTLNSKYKEELLAQIQANEERRKRERSHYLEEGARLREAAEKERQLLLQIKDRKLGELESAGVPGKYRAELEK 496          
BLAST of Cilia-and flagella-associated protein 45 vs. TrEMBL
Match: A0A2I6SFG9 (Cilia-and flagella-associated protein 45 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=CFAP45 PE=2 SV=1)

HSP 1 Score: 793.882 bits (2049), Expect = 0.000e+0
Identity = 516/519 (99.42%), Postives = 519/519 (100.00%), Query Frame = 1
Query:  148 VSRISRVEENLFGEPNYLKLRKTASNVELNVHESEPTVSYCSDRKVCSNNNEYKEKEETIRIITKDMVRNLRVPREDPSFKSMVLDSDSFLKLRNRARIVSHEEKLKREEAIKTQKDEEMMASHGRRQEMKRHDILRQKNDKMTDLEEEAYQKAQTLLKKAMEQRQEQEDEIKKLNELISNAKIQAIRDAQXXXXXXXXXXXXXXDHRLDQMMEIERINAIRMQEGIELRRKEDELLAASSXXXXXXXXXXXXXXXXXXKDQENKLERERVAVLMEEELVKRSKIRQNQEKLRNDLNKSNEEMLERKIREKELEQLLDLRVLEIQREKALREAEFEAEAMRVKAEKEREVARLRALQERAKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLLQARAEQAEMKEHFLAIQAARDRAEFERTIRAQRELIERDKQMEEIEKSKRSEYSKEIRNQIRKNEETKIAERNAFFXXXXXXXXXXXXXXXXXXXXXNRKLEELRNAGISEKFLKQI 1704
            VSRISRVEENLFGEPNYLKLRKTASNVELNVHESEPTV+YCSDRKVCSNNNEYKEKEETIRIITKDMVRNLRVPREDPSFKSMVLDSDSFLKLRNRARIVSH+EKLKREEAIKTQKDEEMMASHGRRQEMKRHDILRQKNDKMTDLEEEAYQKAQTLLKKAMEQRQEQEDEIKKLNELISNAKIQAIRDAQILEKEIIKKENLEEDHRLDQMMEIERINAIRMQEGIELRRKEDELLAASSIIQQIEQNEQERLIELERKDQENKLERERVAVLMEEELVKRSKIRQNQEKLRNDLNKSNEEMLERKIREKELEQLLDLRVLEIQREKALREAEFEAEAMRVKAEKEREVARLRALQERAKDEQAERDELRARRAMEEAEREWRRKEIEHEIKKKQVEEDLLQARAEQAEMKEHFLAIQAARDRAEFERTIRAQRELIERDKQMEEIEKSKRSEYSKEIRNQIRKNEETKIAERNAFFKEGEKIEEEKRLRR+RMEEAKNRKLEELRNAGISEKFLKQI
Sbjct:    1 VSRISRVEENLFGEPNYLKLRKTASNVELNVHESEPTVNYCSDRKVCSNNNEYKEKEETIRIITKDMVRNLRVPREDPSFKSMVLDSDSFLKLRNRARIVSHDEKLKREEAIKTQKDEEMMASHGRRQEMKRHDILRQKNDKMTDLEEEAYQKAQTLLKKAMEQRQEQEDEIKKLNELISNAKIQAIRDAQILEKEIIKKENLEEDHRLDQMMEIERINAIRMQEGIELRRKEDELLAASSIIQQIEQNEQERLIELERKDQENKLERERVAVLMEEELVKRSKIRQNQEKLRNDLNKSNEEMLERKIREKELEQLLDLRVLEIQREKALREAEFEAEAMRVKAEKEREVARLRALQERAKDEQAERDELRARRAMEEAEREWRRKEIEHEIKKKQVEEDLLQARAEQAEMKEHFLAIQAARDRAEFERTIRAQRELIERDKQMEEIEKSKRSEYSKEIRNQIRKNEETKIAERNAFFKEGEKIEEEKRLRRMRMEEAKNRKLEELRNAGISEKFLKQI 519          
BLAST of Cilia-and flagella-associated protein 45 vs. TrEMBL
Match: A0A1S3JPL4 (cilia- and flagella-associated protein 45-like OS=Lingula unguis OX=7574 GN=LOC106175047 PE=4 SV=1)

HSP 1 Score: 311.227 bits (796), Expect = 6.150e-95
Identity = 273/538 (50.74%), Postives = 376/538 (69.89%), Query Frame = 1
Query:  127 KGNNYKTVSRISRVEENLFGEPNYLKLRKTASNVELN---VHESEPTVSYCSDRKVCSNNNEYKEKEETIRIITKDMVRNLRVPREDPSFKSMVLDSDSFLKLRNRARIVSHEEKLKREEAIKTQKDEEMMASHGRRQEMKRHDILRQKNDKMTDLEEEAYQKAQTLLKKAMEQRQEQEDEIKKLNELISNAKIQAIRDAQXXXXXXXXXXXXXXDHRLDQMMEIERINAIRMQEGIELRRKEDELLAASSXXXXXXXXXXXXXXXXXXKDQENKLERERVAVLMEEELVKRSKIRQNQEKLRNDLNKSNEEMLERKIREKELEQLLDLRVLEIQREKALREAEFEAEAMRVKAEKEREVARLRALQERAKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLLQARAEQAEMKEHFLAIQAARDRAEFERTIRAQRELIERDKQMEEIEKSKRSEYSKEIRNQIRKNEETKIAERNAFFXXXXXXXXXXXXXXXXXXXXXNRKLEELRNAGISEKFLKQIERKIQQVQN 1731
            K  NY+ VS  S+V+E+LFG PN    R      + N     ESEP        +     +  K K+ET+++ITKD++RNL VP+EDPS  S++L+   F +++N + +++ E+K+   E IK +K+     +  R+Q MK  DI RQKN K+ DLE+EA +KA+ LL+KA  QRQEQEDEIK LNELI NAK  AIRDAQ+LEK  IK E  EE+ RLD MME+ER+NAI MQE IE RRKE++LL A+ +++QI+ N+QERL ELERKDQEN   ++ +  LMEE+  K  K       LR +LN++N +ML+RK  + E E+L +L+V+E Q++KA REA FE E  R++ EKE+E AR+RALQERA+DEQAERD LRA+RA E+AEREWR KE   + KK + E  L  ARA+Q + KEHFLA+QA R+RAEFER +RAQ+EL+E++K++E     KR  ++ ++R QIR+ EE KI  RNAFF+EG K++EE R RR +++E K +KL++LR+ GI +K++  +ERKI Q Q+
Sbjct:   22 KTKNYRVVSYTSQVDESLFGTPNKAAQRDLKGYSDGNDYLFQESEP--------RSAKKKSSGKNKKETVQVITKDLIRNLIVPKEDPSGVSIILEGYDFNRIKNASIVMTQEQKMAELERIKREKEMAQEEATARKQMMKTMDINRQKNGKLNDLEQEAKEKAEHLLEKANLQRQEQEDEIKHLNELILNAKCHAIRDAQVLEKGHIKTEMEEEEKRLDMMMEVERVNAIAMQEEIEKRRKEEKLLGAAKVLEQIQDNDQERLFELERKDQENIQMQKYLRKLMEEDEQKLEKKHAEAAALREELNRANADMLQRKELQAEQEKLAELKVVEYQKQKAEREAAFEREQERIRIEKEKETARMRALQERARDEQAERDALRAKRAQEQAEREWRAKEAMEQRKKVETETMLKVARAKQMDQKEHFLAVQAQRERAEFERVLRAQKELVEKEKRLEVEGMKKRYRHADDVRLQIREKEEEKINARNAFFEEGVKLDEEARQRRQKLDEIKKKKLDDLRSLGIHDKYIAGVERKINQPQH 551          
BLAST of Cilia-and flagella-associated protein 45 vs. TrEMBL
Match: A0A210PHL1 (Coiled-coil domain-containing protein 19, mitochondrial OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT22385 PE=4 SV=1)

HSP 1 Score: 311.227 bits (796), Expect = 6.905e-95
Identity = 264/534 (49.44%), Postives = 369/534 (69.10%), Query Frame = 1
Query:  118 RRSKGNNYKTVSRISRVEENLFGEPNYLKLRKTASNVELNVHESEPTVSYCSDRKVCSNNNEYKEKEETIRIITKDMVRNLRVPREDPSFKSMVLDSDSFLKLRNRARIVSHEEKLKREEAIKTQKDEEMMASHGRRQEMKRHDILRQKNDKMTDLEEEAYQKAQTLLKKAMEQRQEQEDEIKKLNELISNAKIQAIRDAQXXXXXXXXXXXXXXDHRLDQMMEIERINAIRMQEGIELRRKEDELLAASSXXXXXXXXXXXXXXXXXXKDQENKLERERVAVLMEEELVKRSKIRQNQEKLRNDLNKSNEEMLERKIREKELEQLLDLRVLEIQREKALREAEFEAEAMRVKAEKEREVARLRALQERAKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLLQARAEQAEMKEHFLAIQAARDRAEFERTIRAQRELIERDKQMEEIEKS-KRSEYSKEIRNQIRKNEETKIAERNAFFXXXXXXXXXXXXXXXXXXXXXNRKLEELRNAGISEKFLKQIERKI 1716
            RR K  NY+TVS  S+++E+LFG PN++  R+     + N ++         +R     ++  K+ +ET+++ITKD++RNL VP EDPS ++M+L    F ++   A +++ E+KL     IK +K  E      R+ EMK +D+ R+KN+K+ DLEEEA + A+ LL KA E RQEQEDEIK LNELI NAK  AIRDAQILEK  IK E + E+ RLD MME++R NAI++QE IE +RK +  L A+ ++ QI++NEQERL ELERKD EN   ++ +  +MEE+     K +  Q  LR +LNK+N+EM+ RK    E E+  + +V+E  ++KA REA FE E  R++ EKE+E +RLRALQERA+DEQAERD LRA+RA E+ EREWR+KE E + KK + E  L++AR  Q   KEHFLA+QA R+R EFER +RAQ+EL+E++++ EE E + KR  ++ ++R QIR+ E  ++ ERNAFF+EG K++EE R RR ++EE K +KL ELRNAGI EK+L Q+ERKI
Sbjct:   19 RRGKTKNYRTVSNHSQIDESLFGAPNHVGKRQEMLQDKWNNNQEVTIEQMARERSAKRKHSNGKKGKETVQVITKDLIRNLIVPTEDPSGQTMILQRYDFYRILKSAEVLTKEQKLSELIRIKEEKLREQEECQRRKNEMKEYDMDRRKNEKLNDLEEEAKENAEHLLSKANEMRQEQEDEIKHLNELILNAKCHAIRDAQILEKHQIKGEMISEEKRLDSMMEVDRQNAIKIQEEIENQRKGERYLGAAKLLDQIQENEQERLFELERKDMENVQMQKCIEKMMEEDKTSLEKHKIKQTDLREELNKANDEMIIRKTLRAEQERAEEEKVVEYMKKKAEREAAFEKEQERIRIEKEKETSRLRALQERARDEQAERDMLRAKRAQEQTEREWRKKEAEEQRKKAETEAMLIEARGIQMHQKEHFLAVQAQRERVEFERVLRAQKELVEKERR-EEFESTKKRHAHADDVRYQIRQKETQRVMERNAFFEEGVKLDEEARARRNKLEEVKRKKLGELRNAGIPEKYLSQVERKI 551          
BLAST of Cilia-and flagella-associated protein 45 vs. TrEMBL
Match: A0A3S1BAS1 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_008329 PE=4 SV=1)

HSP 1 Score: 298.901 bits (764), Expect = 5.627e-90
Identity = 269/552 (48.73%), Postives = 380/552 (68.84%), Query Frame = 1
Query:  127 KGNNYKTVSRISRVEENLFGEPNYLKLRKTASNVELNVHESEPTVSYC--------------SDRKVCSNNNEYKEKEETIRIITKDMVRNLRVPREDPSFKSMVLDSDSFLKLRNRARIVSHEEKLKREEAIKTQKDEEMMASHGRRQEMKRHDILRQKNDKMTDLEEEAYQKAQTLLKKAMEQRQEQEDEIKKLNELISNAKIQAIRDAQXXXXXXXXXXXXXXDHRLDQMMEIERINAIRMQEGIELRRKEDELLAASSXXXXXXXXXXXXXXXXXXKDQENKLERERVAVLMEE--ELVKRSKIRQNQEKLRNDLNKSNEEMLERKIREKELEQLLDLRVLEIQREKALREAEFEAEAMRVKAEKEREVARLRALQERAKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLLQARAEQAEMKEHFLAIQAARDRAEFERTIRAQRELIERDKQMEEIEKSKRSEYSKEIRNQIRKNEETKIAERNAFFXXXXXXXXXXXXXXXXXXXXXNRKLEELRNAGISEKFLKQIERKIQQVQNS 1734
            K   Y+ +S  S+V+E+LFGEP   ++R+       N  +    ++ C              S RK+       K ++E + +ITKD++RNL VP EDPS +S+VL  D F ++   +R++S E++    E IK +K+  M  +  R+  MK+ D+ RQKN K+ DLEEEA ++A+ LL  A E RQEQEDEIK LNE+I NAK  AIRDAQILEK+ I KE + E+ RLD MME++R NAI++ E IE +RKE++LL A+ +++QI++NEQERL ELERKDQEN   +  +  LMEE  E ++R KI   Q  LR +LNK+N E+L+RK  +   E+  +L+VLE Q++KA REA FE E  +++ EKEREVA+LR LQERA+DEQAERD LRA+RA E+AER+WRRKE E   KK ++E  L QAR+ Q E KEHFLA+QA R+RAEFER +RAQ+EL+E+ K+ E+  KSKR +++  +R+QIR+ E  +IAERNAFF+EG K++EE R RR ++E  K +KL EL +AGI +++++ ++R++Q +  S
Sbjct:   20 KTYGYRVISHQSQVDESLFGEPQAQQMRQAMLK---NKFQEPQDITNCDSAVSLERLAHERNSRRKIGQG----KAQKERVTVITKDLIRNLIVPSEDPSGESLVLPRDQFFRILQASRVLSKEDREAEAEKIKREKERAMDEAQERKNRMKQLDVTRQKNAKLNDLEEEAKEQAEHLLSHANEMRQEQEDEIKHLNEVILNAKCHAIRDAQILEKDQIAKEMIHEERRLDTMMEVDRQNAIKIHEEIEKKRKEEQLLGAAKLMEQIDENEQERLFELERKDQENIQMQRYIEKLMEEDQESLERKKI--EQLALREELNKANAEILKRKELKTMQEKAEELKVLEFQKQKAEREAIFEKEQEKIRIEKEREVAKLRGLQERARDEQAERDALRAKRAQEQAERDWRRKEAEEMRKKAELEASLKQARSVQMEQKEHFLAVQAQRERAEFERVLRAQKELVEKQKREEDQAKSKRHQHADSVRSQIREKELVRIAERNAFFEEGVKLDEEARARRAKLEAIKRKKLTELSDAGIPDQYVRFVDRRVQFMATS 562          
BLAST of Cilia-and flagella-associated protein 45 vs. TrEMBL
Match: A0A0X3PKC7 (Protein CFAP45 OS=Schistocephalus solidus OX=70667 GN=CFA45 PE=4 SV=1)

HSP 1 Score: 294.278 bits (752), Expect = 1.959e-88
Identity = 268/543 (49.36%), Postives = 389/543 (71.64%), Query Frame = 1
Query:  118 RRSKGNNYKTVSRISRVEENLFGEPNYLK-LRKT---------ASNVELNVHESEPTVSYCSDRKVCSNNNEYKEKEETIRIITKDMVRNLRVPREDPSFKSMVLDSDSFLKLRNRARIVSHEEKLKREEAIKTQKDEEMMASHGRRQEMKRHDILRQKNDKMTDLEEEAYQKAQTLLKKAMEQRQEQEDEIKKLNELISNAKIQAIRDAQXXXXXXXXXXXXXXDHRLDQMMEIERINAIRMQEGIELRRKEDELLAASSXXXXXXXXXXXXXXXXXXKDQENKLERERVAVLMEEELVKRSKIRQNQEKLRNDLNKSNEEMLERKIREKELEQLLDLRVLEIQREKALREAEFEAEAMRVKAEKEREVARLRALQERAKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLLQARAEQAEMKEHFLAIQAARDRAEFERTIRAQRELIERDKQMEEIEKSKRSEYSKEIRNQIRKNEETKIAERNAFFXXXXXXXXXXXXXXXXXXXXXNRKLEELRNAGISEKFLKQIERKI 1716
            +RSK + Y+ ++  SRV+ENLFGEP  LK L KT           +V++N++     +S C  + V         K E +++   D VR L VP +    K+++L ++ F +++++A+ ++ E+  + E+  K  K+++MM S  R+ EMK+ DI R+ N+++ DLEEEA QKAQ LL KAMEQRQE+EDEIK LNE I NAKIQAIRDAQ+LEK  I+KE  EE+ RLD MME+ER   I+MQE I+ R++E+E+L A  I++QI QNEQ+RL++LER +QEN   R ++A  M EEL +R+K R  Q++LR +LN+SN++M+E +++EKE ++L DL++L+ Q+EKA REA +EAE  R++ EKE E+ARLR+LQE+A DE AERD LRA+RA EEAER++RRKE+E   K    +E++ + R  QAE K+  LA++ +R+RAEFER +RAQ+E+I++DK+  E+ K  +  +  EI+ QI + E+ +IAERNAFF+EG ++EEE RLRRLR+++AKNRK++ELR AGI EK+L Q+ERK 
Sbjct:   19 KRSKCSTYRKLNDCSRVDENLFGEPEKLKMLLKTDHYPRVDGKGEDVQINIYRHGGLLS-CPPKFVHG-------KPEKLKVYANDYVRELVVPEDKIKEKTILLPANEFKRIKDKAKFLTPEQIKEAEKEEKALKEKQMMESADRKFEMKKLDIARRVNERLNDLEEEAKQKAQYLLTKAMEQRQEEEDEIKMLNEQIMNAKIQAIRDAQVLEKIQIEKEINEENQRLDNMMEMERQKGIKMQEEIDRRKREEEMLGACEIMKQINQNEQDRLLQLERMEQENAEARRKMAADMLEELDRRAKKRAEQDRLREELNRSNQQMIEMRLKEKEQDRLFDLKILKEQQEKAAREAAYEAEQERIRLEKEMEIARLRSLQEKASDEAAERDALRAKRAQEEAERQFRRKELEAARKLAAEKEEMNRERLTQAENKKRLLAMEVSRERAEFERILRAQKEMIKKDKREAELRKQNQINFCNEIKRQICEMEQQRIAERNAFFEEGVRMEEEARLRRLRLQDAKNRKMDELRKAGIPEKYLLQVERKC 553          
BLAST of Cilia-and flagella-associated protein 45 vs. Ensembl Cavefish
Match: cfap45 (cilia and flagella associated protein 45 [Source:NCBI gene;Acc:103029291])

HSP 1 Score: 228.024 bits (580), Expect = 7.609e-67
Identity = 230/538 (42.75%), Postives = 343/538 (63.75%), Query Frame = 1
Query:  139 YKTVSRISRVEENLFGEPNYLKLRKTASNVELNVHESEPTVSYCSDRKVCSNNNEYKEK-EETIRIITKDMVRNLRVPREDPSFKSMVLDSDSFLKLRNRARIVSHEEKLKREEAIKTQKDEEMMASHGRRQEMKRHDILRQKNDKMTDLEEEAYQKAQTLLKKAMEQRQEQEDEIKKLNELISNAKIQAIRDAQXXXXXXXXXXXXXXDHRLDQMMEIERINAIRMQEGIELRRKEDELLAASSXXXXXXXXXXXXXXXXXXKDQENKLERERVAVLMEEELVKRSKIRQNQEKLRNDLNKSNEEMLERKIREKELEQLLDLRVLEIQREKALREAEFEAEAMRVKAEKEREVARLRALQERAKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLLQARAEQAEMKEHFLAIQAARDRAEFERTIRAQRELIERDKQMEEIEKSKRSEYSKEIRNQIRKNEETKIAERNAFFXXXXXXXXXXXXXXXXXXXXXNRKLEELRNAGISEKFLKQIERKIQQVQNS*PEMI 1749
            Y+T +  S+V+E LFG P     R+T +      H+ E   S    R +  +    K + +ET+RIITKD++R+L +   DPS +S++L +    ++ + +R+ + EE+    E+++  ++E M+A+  R+  M++ D+ RQKN  +TDLE EA ++AQ LL++A   R EQEDE+KKLNE I  A+  A++DAQILEK+ I  E  EE+ RLD MMEI+R  A+  QE I+  RK+  +L  + I++QIE   +ER +E E K+QE +   E +  +  EEL    K ++ Q++L  ++ K NE  +  K R KE E+L DLR LE  R+K  R+AE+EAE +RVK EKE++VARLRALQER +D +AE+DELRARR  + AEREWRRKE E   +K++  E L  AR EQ   KEH L+I+A R+RAE ER +R Q+E I R+K+ E   + +   +++ +R Q+R+ E   I  R   F EGEK+E+E R RR R+EE K +KL+ELR AG+ EK+  ++E+K+  +    P ++
Sbjct:   20 YRTRALTSQVDETLFGAP-----RQTQTQSAYG-HQDEAKGSTPGSRTLSRSAPASKTRNKETVRIITKDLIRDLSISNADPSGQSIILCTAEIERISSESRVPTKEEQEAALESLRRSREEAMIAADERKTLMRQADLSRQKNQGLTDLEAEACERAQYLLQRANTLRMEQEDEVKKLNEWILGAQCHAVQDAQILEKKQILSELQEEERRLDAMMEIDRRRALEAQEHIDQLRKDQRILGKACILKQIEDRLEERTLEEEVKEQEGQQMLENMERMQMEELETLEKKKEEQKRLLLEIKKINEVNILAKERRKEEERLADLRALEYTRKKLERDAEYEAEQIRVKKEKEKDVARLRALQERDRDHKAEQDELRARRNQQAAEREWRRKESEQARRKQEENERLKAARLEQVIHKEHMLSIEAGRERAELERVLRTQQEQIAREKEKELHHRQQVLRHAEGVRQQVRERETMAITRRRELFLEGEKLEDEARSRRARLEEIKEKKLKELRAAGLPEKYCSEVEQKVHTL----PTLV 547          
BLAST of Cilia-and flagella-associated protein 45 vs. Ensembl Nematostella
Match: EDO38378 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD44])

HSP 1 Score: 273.092 bits (697), Expect = 3.770e-84
Identity = 240/542 (44.28%), Postives = 366/542 (67.53%), Query Frame = 1
Query:  139 YKTVSRISRVEENLFGEPN-YLKLRKTASNVELNVHESEPTVSYCSDRKVCSNNNEYKEKEETIRIITKDMVRNLRVPREDPSFKSMVLDSDSFLKLRNRARIVSHEEKLKREEAIKTQKDEEMMASHGRRQEMKRHDILRQKNDKMTDLEEEAYQKAQTLLKKAMEQRQEQEDEIKKLNELISNAKIQAIRDAQXXXXXXXXXXXXXXDHRLDQMMEIERINAIRMQEGIELRRKEDELLAASSXXXXXXXXXXXXXXXXXXKDQENKLERERVAVLMEEELVKRSKIRQNQEKLRNDLNKSNEEMLERKIREKELEQLLDLRVLEIQREKALREAEFEAEAMRVKAEKEREVARLRALQERAKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLLQARAEQAEMKEHFLAIQAARDRAEFERTIRAQRELIERDKQMEEIEKSKRSEYSKEIRNQIRKNEETKIAERNAFFXXXXXXXXXXXXXXXXXXXXXNRKLEELRNAGISEKFLKQIERKIQQVQNS*PEMINNIY 1761
            Y+TV++ S V+ENLFG P    K RK     EL V     +    + R   +      ++ ETI++ITKD++R LR+P EDPS +SM+LD   F ++++ +R++S EE+      +K +K+E   AS  R+  M+  D+ R++N+K+TDLE EA QK+Q LL+ A +Q +EQEDEIKKLNELI NAK  AIRDAQ++EK  +KKE L E+ RLD+MME+ER+  ++ +E  E  R  + L  A+ +  QIE N+Q+RL+E E+KDQE +   + +  L +E++    K  + Q+ L  ++ K+NEE+  +   +K+ E++ +L+V+E  ++KA RE  ++ E  +++ EKE+E+ARLRALQERAKD QAE+D LRA+R  EEAEREWRRKE E   K+KQ EE L QAR  Q + KEHFLA+QA RDRAEFER +R Q+E + +D++ E + + +R +Y+ E+R QIR+ E+ ++  RNAFF+EG K+++E + RR +++E K RKL EL++AG+ +K+  ++ R+I+    + P  ++ +Y
Sbjct:   25 YRTVNKTSTVDENLFGSPQRTTKPRKQMGGEELLVERRSRSAPNATGRTPKT------QEPETIQVITKDLIRRLRIPEEDPSGRSMILDWSEFSRIKSASRVISKEEREAAHNEMKRKKEELQNASEERKIFMQMMDLKRKENEKLTDLEIEAQQKSQHLLENANKQMEEQEDEIKKLNELILNAKCHAIRDAQLIEKVEVKKEQLVEEKRLDEMMEVERLKKLQEEEEREKERHIERLKGAAVLNIQIEDNKQQRLLEEEKKDQETQAMLQYLERLKDEDMEALVKKHETQKNLMKEVAKANEEIKRQSEVKKQQEKMEELKVMEYLKQKAEREEAYQREQEKIRIEKEKEIARLRALQERAKDVQAEKDALRAKRNQEEAEREWRRKEREEAEKQKQTEEMLRQARENQVKNKEHFLAVQAKRDRAEFERVLRVQKEQMHKDEEAEHVSQVRRHQYADEVRQQIREKEKERVKNRNAFFEEGIKLDQEAKARRQKLDEIKRRKLHELKDAGVPDKYCNEVARRIE----APPPSLSRLY 556          
BLAST of Cilia-and flagella-associated protein 45 vs. Ensembl Nematostella
Match: EDO26548 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TBQ7])

HSP 1 Score: 81.2629 bits (199), Expect = 3.835e-18
Identity = 39/78 (50.00%), Postives = 57/78 (73.08%), Query Frame = 1
Query: 1348 LLQARAEQAEMKEHFLAIQAARDRAEFERTIRAQRELIERDKQMEEIEKSKRSEYSKEIRNQIRKNEETKIAERNAFF 1581
            L QAR  Q + KEHFLA+QA RDRAEFER +R Q+E + +D++ E + + +R +Y+ E+R QIR+ E+ ++  RNAFF
Sbjct:   44 LRQARENQVKNKEHFLAVQAKRDRAEFERVLRVQKEQMHKDEEAEHVSQVRRHQYADEVRQQIREKEKERVKNRNAFF 121          
BLAST of Cilia-and flagella-associated protein 45 vs. Ensembl Medaka
Match: cfap45 (cilia- and flagella-associated protein 45 [Source:NCBI gene;Acc:101157797])

HSP 1 Score: 169.088 bits (427), Expect = 2.890e-45
Identity = 200/528 (37.88%), Postives = 301/528 (57.01%), Query Frame = 1
Query:  220 SNVELNVHESEPTVSYCSDRKVCSNNNEYKEKEETIRIITKDMVRNLRVPREDPSFKSMVLDSDSFLKLRNRARIVSHEEKLKREEAIKTQKDEEMMASHGRRQEMKRHDILRQKNDKMTDLEEEAYQKAQTLLKKAMEQRQEQEDEIKKLNELISNAKIQAIRDAQXXXXXXXXXXXXXXDHRLDQMMEIERINAIRMQEGIELRRKE----------DELLAASSXXXXXXXXXXXXXXXXXXKDQENKLERERVAVLMEEELVKRSKIRQNQEKLRNDLN----------------KSNEEMLERKIREKELEQLLDLRVLEIQREKALREAEFEAEAMRVKAEKEREVARLRALQERAKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLLQARAEQAEMKEHFLAIQAARDRAEFERTIRAQRELIERDKQMEEIEKSKRSEYSKEIRNQIRKNEETKIAERNAFFXXXXXXXXXXXXXXXXXXXXXNRKLEELRNAGISEKFLKQIERKIQQV 1725
            S+  LN+ E+  T           + +  K KEETI II+KD++R LR+PR+DP  KS+ L S  F ++ + +R ++ EE   RE   KT + E       R QE     + + KN +++DLE EA ++AQ L+++A   + EQE+EIK+LN+LI   + QA  DAQI EKE IK E  EE+ RLD +ME ER  A+   E +E  RK+          D++L                          N  ER+     ++EE+ ++ K++  Q++ R +L                 + N E+ + K R  E E+L D R +E  ++K  REAE+EAE  R+K EKE E+ARLRA Q+RAKD +AE+DE+RA+R  E  ER WR+KE E  IKK + E  L  AR EQ + KEH L+I+A R++A FER +  Q+E + + K+ EE ++ K  +++  IR Q+++ E +  A R   FKE ++  EE R R++++ E K +KL++LRN G+SEK+  Q+ERK Q++
Sbjct:   47 SDSHLNMQENSTTGGM--------DPSHEKHKEETILIISKDLIRTLRIPRKDPPKKSITLPSAEFEQITSASRFLTQEE---REALRKTYQKEREERLKSRIQEAA---LSQSKNRELSDLELEAQKRAQRLVERAEALKMEQEEEIKQLNQLILGTQCQATCDAQIEEKEQIKVELAEEEKRLDTLMEKERRKALESLEKMEELRKQQLIRGRQEICDQILL-------------------------NLEERQ-----LQEEIKEQEKLQLCQDQDRKNLEDLKKMLEKKLLQEEIIRINAEVAKAKERRAEEERLADTRAMEYLQKKLEREAEYEAEQKRIKKEKEMEIARLRAQQQRAKDHKAEQDEIRAKRNQEAEERRWRQKEKELAIKKAREEAKLRAARLEQVQNKEHCLSIEAGREKAAFERVLEVQQEEMAKQKENEERKREKAQQHALAIRQQVKERERSAAARRKETFKEADRQMEEARHRQMKLAEIKEKKLQQLRNVGLSEKYCAQVERKAQKL 530          
BLAST of Cilia-and flagella-associated protein 45 vs. Ensembl Medaka
Match: cfap45 (cilia- and flagella-associated protein 45 [Source:NCBI gene;Acc:101157797])

HSP 1 Score: 120.553 bits (301), Expect = 3.857e-29
Identity = 134/339 (39.53%), Postives = 195/339 (57.52%), Query Frame = 1
Query:  220 SNVELNVHESEPTVSYCSDRKVCSNNNEYKEKEETIRIITKDMVRNLRVPREDPSFKSMVLDSDSFLKLRNRARIVSHEEKLKREEAIKTQKDEEMMASHGRRQEMKRHDILRQKNDKMTDLEEEAYQKAQTLLKKAMEQRQEQEDEIKKLNELISNAKIQAIRDAQXXXXXXXXXXXXXXDHRLDQMMEIERINAIRMQEGIELRRKEDELLAASSXXXXXXXXXXXXXXXXXXKDQEN-KLERERVAVLMEEELVKRSKIRQNQEKLRNDLNKSNEEMLERKIREKELEQLLDLRVLEIQREKALREAEFEAEAMRVKAEKEREVARLRALQERAKD 1233
            S+  LN+ E+  T           + +  K KEETI II+KD++R LR+PR+DP  KS+ L S  F ++ + +R ++ EE   RE   KT + E       R QE     + + KN +++DLE EA ++AQ L+++A   + EQE+EIK+LN+LI   + QA  DAQI EKE IK E  EE+ RLD +ME ER  A+   E +E  RK+  +     I  QI  N +ER ++ E K+QE  +L +++    +E+      K    +E +R      N E+ + K R  E E+L D R +E  ++K  REAE+EAE  R+K EKE E+ARLRA Q+RAKD
Sbjct:   47 SDSHLNMQENSTTGGM--------DPSHEKHKEETILIISKDLIRTLRIPRKDPPKKSITLPSAEFEQITSASRFLTQEE---REALRKTYQKEREERLKSRIQEAA---LSQSKNRELSDLELEAQKRAQRLVERAEALKMEQEEEIKQLNQLILGTQCQATCDAQIEEKEQIKVELAEEEKRLDTLMEKERRKALESLEKMEELRKQQLIRGRQEICDQILLNLEERQLQEEIKEQEKLQLCQDQDRKNLEDLKKMLEKKLLQEEIIR-----INAEVAKAKERRAEEERLADTRAMEYLQKKLEREAEYEAEQKRIKKEKEMEIARLRAQQQRAKD 366          
BLAST of Cilia-and flagella-associated protein 45 vs. Planmine SMEST
Match: SMESG000016410.1 (SMESG000016410.1)

HSP 1 Score: 843.188 bits (2177), Expect = 0.000e+0
Identity = 561/561 (100.00%), Postives = 561/561 (100.00%), Query Frame = 1
Query:   52 MSVGXXXXXXXXXXXXXXXXXXRRSKGNNYKTVSRISRVEENLFGEPNYLKLRKTASNVELNVHESEPTVSYCSDRKVCSNNNEYKEKEETIRIITKDMVRNLRVPREDPSFKSMVLDSDSFLKLRNRARIVSHEEKLKREEAIKTQKDEEMMASHGRRQEMKRHDILRQKNDKMTDLEEEAYQKAQTLLKKAMEQRQEQEDEIKKLNELISNAKIQAIRDAQXXXXXXXXXXXXXXDHRLDQMMEIERINAIRMQEGIELRRKEDELLAASSXXXXXXXXXXXXXXXXXXKDQENKLERERVAVLMEEELVKRSKIRQNQEKLRNDLNKSNEEMLERKIREKELEQLLDLRVLEIQREKALREAEFEAEAMRVKAEKEREVARLRALQERAKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLLQARAEQAEMKEHFLAIQAARDRAEFERTIRAQRELIERDKQMEEIEKSKRSEYSKEIRNQIRKNEETKIAERNAFFXXXXXXXXXXXXXXXXXXXXXNRKLEELRNAGISEKFLKQIERKIQQVQNS 1734
            MSVGSICSSQSHGIQSHSSTGSRRSKGNNYKTVSRISRVEENLFGEPNYLKLRKTASNVELNVHESEPTVSYCSDRKVCSNNNEYKEKEETIRIITKDMVRNLRVPREDPSFKSMVLDSDSFLKLRNRARIVSHEEKLKREEAIKTQKDEEMMASHGRRQEMKRHDILRQKNDKMTDLEEEAYQKAQTLLKKAMEQRQEQEDEIKKLNELISNAKIQAIRDAQILEKEIIKKENLEEDHRLDQMMEIERINAIRMQEGIELRRKEDELLAASSIIQQIEQNEQERLIELERKDQENKLERERVAVLMEEELVKRSKIRQNQEKLRNDLNKSNEEMLERKIREKELEQLLDLRVLEIQREKALREAEFEAEAMRVKAEKEREVARLRALQERAKDEQAERDELRARRAMEEAEREWRRKEIEHEIKKKQVEEDLLQARAEQAEMKEHFLAIQAARDRAEFERTIRAQRELIERDKQMEEIEKSKRSEYSKEIRNQIRKNEETKIAERNAFFKEGEKIEEEKRLRRLRMEEAKNRKLEELRNAGISEKFLKQIERKIQQVQNS
Sbjct:    1 MSVGSICSSQSHGIQSHSSTGSRRSKGNNYKTVSRISRVEENLFGEPNYLKLRKTASNVELNVHESEPTVSYCSDRKVCSNNNEYKEKEETIRIITKDMVRNLRVPREDPSFKSMVLDSDSFLKLRNRARIVSHEEKLKREEAIKTQKDEEMMASHGRRQEMKRHDILRQKNDKMTDLEEEAYQKAQTLLKKAMEQRQEQEDEIKKLNELISNAKIQAIRDAQILEKEIIKKENLEEDHRLDQMMEIERINAIRMQEGIELRRKEDELLAASSIIQQIEQNEQERLIELERKDQENKLERERVAVLMEEELVKRSKIRQNQEKLRNDLNKSNEEMLERKIREKELEQLLDLRVLEIQREKALREAEFEAEAMRVKAEKEREVARLRALQERAKDEQAERDELRARRAMEEAEREWRRKEIEHEIKKKQVEEDLLQARAEQAEMKEHFLAIQAARDRAEFERTIRAQRELIERDKQMEEIEKSKRSEYSKEIRNQIRKNEETKIAERNAFFKEGEKIEEEKRLRRLRMEEAKNRKLEELRNAGISEKFLKQIERKIQQVQNS 561          
BLAST of Cilia-and flagella-associated protein 45 vs. Planmine SMEST
Match: SMESG000052114.1 (SMESG000052114.1)

HSP 1 Score: 229.18 bits (583), Expect = 1.032e-67
Identity = 234/467 (50.11%), Postives = 333/467 (71.31%), Query Frame = 1
Query:  316 EETIRIITKDMVRNLRVPREDPSFKSMVLDSDSFLKLRNRARIVSHEEKLKREEAIKTQKDEEMMASHGRRQEMKRHDILRQKNDKMTDLEEEAYQKAQTLLKKAMEQRQEQEDEIKKLNELISNAKIQAIRDAQXXXXXXXXXXXXXXDHRLDQMMEIERINAIRMQEGIELRRKEDELLAASSXXXXXXXXXXXXXXXXXXKDQENKLERERVAVLMEEELVKRSKIRQNQEKLRNDLNKSNEEMLERKIREKELEQLLDLRVLEIQREKALREAEFEAEAMRVKAEKEREVARLRALQERAKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLLQARAEQAEMKEHFLAIQAARDRAEFERTIRAQRELIERDKQMEEIEKSKRSEYSKEIRNQIRKNEETKIAERNAFFXXXXXXXXXXXXXXXXXXXXXNRKLEELRNAGISEKFLKQIERKI 1716
            EE++RI+T+DM RNLRVP+E    KS++L    F++L+ +A ++S EE  + EE  K  KD+EMM S  RR  M+  D+ R +N+K++DLEEEAY+K+Q LL+KAM+QR+EQE EIK +N L  NA+IQAIRDAQILEK  I +E L+E  RLD MMEIER N I++QE I+L++  +E L A  I++QIE NE+E+L+ELE KD+EN+  ++    +MEEE  KR +    +EKLR +L+K+N E+ +R+  + E +  L  RVL+IQ+EKA +E  ++ E  R+K EKE E+ARLRALQE+ +DE+AERD L+A+RAME++EREWRRKE     KK + E  L  AR EQ   K   +AIQAA D+ +F+R ++AQ + IE++K   + +  K ++Y+++I+ QI + E   I ER+ FF EG +I+EE RLR+LR+E AKNRK  EL+ AGI E +L Q++RK+
Sbjct:   30 EESVRILTQDMYRNLRVPKEKLKTKSLLLKPHEFIRLKTKANVLSEEELQRLEEEEKKLKDKEMMDSMDRRTFMQNMDLKRHRNEKLSDLEEEAYRKSQYLLEKAMQQREEQEPEIKAMNNLAKNAEIQAIRDAQILEKRQIAQEMLDEQRRLDTMMEIERQNQIKIQEEIDLKKFTEEKLGAYEILKQIEANEEEKLLELEMKDRENQQYQQLFITMMEEEHRKRIENETVKEKLRKELDKANAEVKDRRRYDIERDIALTKRVLQIQQEKAAKEEAYDNEQKRIKKEKEYEIARLRALQEKFQDEKAERDALKAKRAMEDSEREWRRKEKAEAFKKAETERILKDARNEQMMYKAKQVAIQAAIDKVDFDRMVKAQLQAIEKEKLEHDKKFGKIAQYTQDIKKQIHEKERQLILERHEFFLEGVRIQEESRLRKLRLEAAKNRKFNELKKAGIPEIYLTQLDRKL 496          
BLAST of Cilia-and flagella-associated protein 45 vs. Planmine SMEST
Match: SMESG000052114.1 (SMESG000052114.1)

HSP 1 Score: 229.18 bits (583), Expect = 1.530e-67
Identity = 234/468 (50.00%), Postives = 334/468 (71.37%), Query Frame = 1
Query:  316 EETIRIITKDMVRNLRVPREDPSFKSMVLDSDSFLKLRNRARIVSHEEKLKREEAIKTQKDEEMMASHGRRQEMKRHDILRQKNDKMTDLEEEAYQKAQTLLKKAMEQRQEQEDEIKKLNELISNAKIQAIRDAQXXXXXXXXXXXXXXDHRLDQMMEIERINAIRMQEGIELRRKEDELLAASSXXXXXXXXXXXXXXXXXXKDQENKLERERVAVLMEEELVKRSKIRQNQEKLRNDLNKSNEEMLERKIREKELEQLLDLRVLEIQREKALREAEFEAEAMRVKAEKEREVARLRALQERAKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLLQARAEQAEMKEHFLAIQAARDRAEFERTIRAQRELIERDKQMEEIEKSKRSEYSKEIRNQIRKNEETKIAERNAFFXXXXXXXXXXXXXXXXXXXXXNRKLEELRNAGISEKFLKQIERKIQ 1719
            EE++RI+T+DM RNLRVP+E    KS++L    F++L+ +A ++S EE  + EE  K  KD+EMM S  RR  M+  D+ R +N+K++DLEEEAY+K+Q LL+KAM+QR+EQE EIK +N L  NA+IQAIRDAQILEK  I +E L+E  RLD MMEIER N I++QE I+L++  +E L A  I++QIE NE+E+L+ELE KD+EN+  ++    +MEEE  KR +    +EKLR +L+K+N E+ +R+  + E +  L  RVL+IQ+EKA +E  ++ E  R+K EKE E+ARLRALQE+ +DE+AERD L+A+RAME++EREWRRKE     KK + E  L  AR EQ   K   +AIQAA D+ +F+R ++AQ + IE++K   + +  K ++Y+++I+ QI + E   I ER+ FF EG +I+EE RLR+LR+E AKNRK  EL+ AGI E +L Q++RK++
Sbjct:   50 EESVRILTQDMYRNLRVPKEKLKTKSLLLKPHEFIRLKTKANVLSEEELQRLEEEEKKLKDKEMMDSMDRRTFMQNMDLKRHRNEKLSDLEEEAYRKSQYLLEKAMQQREEQEPEIKAMNNLAKNAEIQAIRDAQILEKRQIAQEMLDEQRRLDTMMEIERQNQIKIQEEIDLKKFTEEKLGAYEILKQIEANEEEKLLELEMKDRENQQYQQLFITMMEEEHRKRIENETVKEKLRKELDKANAEVKDRRRYDIERDIALTKRVLQIQQEKAAKEEAYDNEQKRIKKEKEYEIARLRALQEKFQDEKAERDALKAKRAMEDSEREWRRKEKAEAFKKAETERILKDARNEQMMYKAKQVAIQAAIDKVDFDRMVKAQLQAIEKEKLEHDKKFGKIAQYTQDIKKQIHEKERQLILERHEFFLEGVRIQEESRLRKLRLEAAKNRKFNELKKAGIPEIYLTQLDRKLK 517          
BLAST of Cilia-and flagella-associated protein 45 vs. Planmine SMEST
Match: SMESG000002444.1 (SMESG000002444.1)

HSP 1 Score: 113.235 bits (282), Expect = 4.092e-26
Identity = 185/541 (34.20%), Postives = 319/541 (58.96%), Query Frame = 1
Query:  133 NNYKTVS----RISRVEENLFGEPNYLKLRKTA----SNVELNVHESEPTVSY-CSDRKVCSNNNEYKEKEETIRIITKDMVRNLRV--PREDPSFKSMVLDSDSFLKLRNRARIVSHEEKLKREEAIKTQKDEEMMASHGRRQEMKRHDILRQKNDKMTDLEEEAYQKAQTLLKKAMEQRQEQEDEIKKLNELISNAKIQAIRDAQXXXXXXXXXXXXXXDHRLDQMMEIERINAIRMQEGIELRRKEDELLAASSXXXXXXXXXXXXXXXXXXKDQENKLERERVAVLMEEELVKRSKIRQNQEKLRNDLNKSNEEMLERKIREKELEQLLDLRVLEIQREKALREAEFEAEAMRVKAE--KEREVARLRALQERAKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLLQARAEQAEMKEHFLAIQAARDRAEFERTIRAQRELIERDKQMEEIEKSKRSEYSKEIRNQIRKNEETKIAERNAFFXXXXXXXXXXXXXXXXXXXXXNRKLEELRNAGISEKFLKQIERKI 1716
            N YK  S    R S ++E LF  P  + L++++    SN   NV +     SY C   KV S           IR+IT++ VR+LRV  P +D +  +++L+ + F +L +      + ++  RE  +++ K         R+ EMK +D LR++ + + DLE+E  +K++TL K+A E R + + E++K+NE+I NAK+Q+IR  QI EK +I+KE +EED RL++++E +R+ A+  Q+  + +R E+E LAA S+++Q    +  ++IE E++ +EN    +    L+E E        Q Q+KL+ +L  + ++  ERK  E   ++LL+ +V+EIQ+ K   E E   E +R++    +E+E +++R +QER  D Q++RDEL  RRA+E  +R+WR KE++  IK+++VE++LL  R  Q ++      ++A  D  EF + ++  + +IE++++    +++KR +++ +IR+QI +N+  KI +      E E + +EK  +  R+EE K RKLEEL+  GI EKFL  I+  I
Sbjct:   62 NTYKRFSIKSNRSSEIDELLFATPVPINLKRSSFSEQSN-NSNVSQIGKINSYKCG--KVSS----------PIRVITQENVRHLRVINPSDDRA--ALILNRNQFQRLLDYQMFKKNPKENNREVELQSMK---------RKAEMKYYDRLRKEKESLNDLEKEDLEKSKTLNKRAWEARLDDDCEVRKVNEMIKNAKVQSIRAHQIAEKNLIEKEKIEEDFRLNKIIEEKRLQAVNEQQERDRKRLENEYLAAISMVEQNFNLQNLKIIEKEKEAEENFQSNQAFVDLIENENAAEQLRIQKQQKLKTELELALKQSQERKQMEILEDKLLNEKVMEIQKAKG--EKEKIDEELRIQKANLREKEYSKMRQMQERIIDMQSKRDELLERRAVEAHQRKWREKELQEIIKQRKVEQELLATRQMQQKIALRDKVVEAKYDEIEFLKNLKVSKMIIEQEQRDILNKQTKRDKFAADIRHQIEQNKRQKIVDEYRKAAEEEAVRKEKMFQEARLEEIKLRKLEELKTLGIDEKFLIPIKNYI 576          
BLAST of Cilia-and flagella-associated protein 45 vs. Planmine SMEST
Match: SMESG000002444.1 (SMESG000002444.1)

HSP 1 Score: 105.145 bits (261), Expect = 1.608e-23
Identity = 163/491 (33.20%), Postives = 291/491 (59.27%), Query Frame = 1
Query:  133 NNYKTVS----RISRVEENLFGEPNYLKLRKTA----SNVELNVHESEPTVSY-CSDRKVCSNNNEYKEKEETIRIITKDMVRNLRV--PREDPSFKSMVLDSDSFLKLRNRARIVSHEEKLKREEAIKTQKDEEMMASHGRRQEMKRHDILRQKNDKMTDLEEEAYQKAQTLLKKAMEQRQEQEDEIKKLNELISNAKIQAIRDAQXXXXXXXXXXXXXXDHRLDQMMEIERINAIRMQEGIELRRKEDELLAASSXXXXXXXXXXXXXXXXXXKDQENKLERERVAVLMEEELVKRSKIRQNQEKLRNDLNKSNEEMLERKIREKELEQLLDLRVLEIQREKALREAEFEAEAMRVKAE--KEREVARLRALQERAKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLLQARAEQAEMKEHFLAIQAARDRAEFERTIRAQRELIERDKQMEEIEKSKRSEYSKEIRNQIRKNEETKIAE 1566
            N YK  S    R S ++E LF  P  + L++++    SN   NV +     SY C   KV S           IR+IT++ VR+LRV  P +D +  +++L+ + F +L +      + ++  RE  +++ K         R+ EMK +D LR++ + + DLE+E  +K++TL K+A E R + + E++K+NE+I NAK+Q+IR  QI EK +I+KE +EED RL++++E +R+ A+  Q+  + +R E+E LAA S+++Q    +  ++IE E++ +EN    +    L+E E        Q Q+KL+ +L  + ++  ERK  E   ++LL+ +V+EIQ+ K   E E   E +R++    +E+E +++R +QER  D Q++RDEL  RRA+E  +R+WR KE++  IK+++VE++LL  R  Q ++      ++A  D  EF + ++  + +IE++++    +++KR +++ +IR+QI +N+  KI +
Sbjct:   62 NTYKRFSIKSNRSSEIDELLFATPVPINLKRSSFSEQSN-NSNVSQIGKINSYKCG--KVSS----------PIRVITQENVRHLRVINPSDDRA--ALILNRNQFQRLLDYQMFKKNPKENNREVELQSMK---------RKAEMKYYDRLRKEKESLNDLEKEDLEKSKTLNKRAWEARLDDDCEVRKVNEMIKNAKVQSIRAHQIAEKNLIEKEKIEEDFRLNKIIEEKRLQAVNEQQERDRKRLENEYLAAISMVEQNFNLQNLKIIEKEKEAEENFQSNQAFVDLIENENAAEQLRIQKQQKLKTELELALKQSQERKQMEILEDKLLNEKVMEIQKAKG--EKEKIDEELRIQKANLREKEYSKMRQMQERIIDMQSKRDELLERRAVEAHQRKWREKELQEIIKQRKVEQELLATRQMQQKIALRDKVVEAKYDEIEFLKNLKVSKMIIEQEQRDILNKQTKRDKFAADIRHQIEQNKRQKIVD 526          
The following BLAST results are available for this feature:
BLAST of Cilia-and flagella-associated protein 45 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CFAP451.621e-5941.48cilia and flagella associated protein 45 [Source:H... [more]
CFAP456.106e-5243.42cilia and flagella associated protein 45 [Source:H... [more]
CFAP458.116e-4238.59cilia and flagella associated protein 45 [Source:H... [more]
CFAP451.030e-2140.80cilia and flagella associated protein 45 [Source:H... [more]
back to top
BLAST of Cilia-and flagella-associated protein 45 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cilia-and flagella-associated protein 45 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cilia-and flagella-associated protein 45 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cfap454.935e-6745.52cilia and flagella associated protein 45 [Source:Z... [more]
cfap451.645e-6147.32cilia and flagella associated protein 45 [Source:Z... [more]
cfap451.121e-4043.64cilia and flagella associated protein 45 [Source:Z... [more]
back to top
BLAST of Cilia-and flagella-associated protein 45 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cfap459.632e-7643.24cilia and flagella associated protein 45 [Source:N... [more]
cfap452.100e-6745.23cilia and flagella associated protein 45 [Source:N... [more]
cfap454.041e-6244.85cilia and flagella associated protein 45 [Source:N... [more]
cfap454.142e-5446.63cilia and flagella associated protein 45 [Source:N... [more]
back to top
BLAST of Cilia-and flagella-associated protein 45 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cfap452.641e-5641.89cilia and flagella associated protein 45 [Source:M... [more]
Cfap456.613e-1935.33cilia and flagella associated protein 45 [Source:M... [more]
Cfap456.613e-1935.33cilia and flagella associated protein 45 [Source:M... [more]
Cfap452.230e-1338.95cilia and flagella associated protein 45 [Source:M... [more]
Cfap454.906e-1131.43cilia and flagella associated protein 45 [Source:M... [more]
back to top
BLAST of Cilia-and flagella-associated protein 45 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q9UL16|CFA45_HUMAN7.786e-5941.48Cilia- and flagella-associated protein 45 OS=Homo ... [more]
sp|A8I9E8|CFA45_CHLRE3.911e-1034.63Cilia- and flagella-associated protein 45 OS=Chlam... [more]
back to top
BLAST of Cilia-and flagella-associated protein 45 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2I6SFG90.000e+099.42Cilia-and flagella-associated protein 45 (Fragment... [more]
A0A1S3JPL46.150e-9550.74cilia- and flagella-associated protein 45-like OS=... [more]
A0A210PHL16.905e-9549.44Coiled-coil domain-containing protein 19, mitochon... [more]
A0A3S1BAS15.627e-9048.73Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A0X3PKC71.959e-8849.36Protein CFAP45 OS=Schistocephalus solidus OX=70667... [more]
back to top
BLAST of Cilia-and flagella-associated protein 45 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cfap457.609e-6742.75cilia and flagella associated protein 45 [Source:N... [more]
back to top
BLAST of Cilia-and flagella-associated protein 45 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cilia-and flagella-associated protein 45 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cilia-and flagella-associated protein 45 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO383783.770e-8444.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO265483.835e-1850.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cilia-and flagella-associated protein 45 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cfap452.890e-4537.88cilia- and flagella-associated protein 45 [Source:... [more]
cfap453.857e-2939.53cilia- and flagella-associated protein 45 [Source:... [more]
back to top
BLAST of Cilia-and flagella-associated protein 45 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016410.10.000e+0100.00SMESG000016410.1[more]
SMESG000052114.11.032e-6750.11SMESG000052114.1[more]
SMESG000052114.11.530e-6750.00SMESG000052114.1[more]
SMESG000002444.14.092e-2634.20SMESG000002444.1[more]
SMESG000002444.11.608e-2333.20SMESG000002444.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003084 ID=SMED30003084|Name=Cilia-and flagella-associated protein 45|organism=Schmidtea mediterranea sexual|type=transcript|length=1798bp
ATTCTATTCAACATTTTTTGACAGTTATTTACTAAATTTAAATACTTATT
AATGTCTGTTGGAAGTATTTGTAGTTCACAAAGCCATGGAATTCAAAGCC
ACAGTTCCACTGGTTCTCGTCGTTCGAAAGGTAATAATTATAAAACTGTA
AGTCGAATTTCTCGTGTCGAAGAAAACTTGTTTGGTGAACCGAACTATTT
GAAATTAAGAAAAACTGCATCAAATGTTGAATTGAATGTTCATGAATCGG
AACCCACAGTTAGTTACTGCTCGGATAGAAAGGTTTGCAGTAATAATAAT
GAATACAAAGAAAAAGAAGAAACAATTCGAATTATCACTAAAGATATGGT
TCGAAATTTGAGAGTTCCGAGAGAAGATCCATCATTTAAATCGATGGTGC
TTGACAGTGATTCATTTCTCAAACTGAGGAATCGGGCTAGGATTGTTTCT
CACGAAGAAAAGTTAAAGAGAGAAGAAGCAATTAAAACTCAGAAAGATGA
GGAAATGATGGCTTCACATGGACGACGACAAGAAATGAAACGACATGACA
TCCTGCGTCAGAAAAATGATAAAATGACAGATCTAGAAGAGGAAGCCTAC
CAGAAAGCCCAAACACTTCTCAAAAAAGCTATGGAACAAAGACAAGAACA
AGAAGACGAAATTAAGAAATTAAACGAATTAATCTCGAATGCAAAAATAC
AAGCTATTCGAGACGCTCAAATTCTTGAGAAAGAAATCATCAAGAAAGAA
AATCTCGAGGAAGACCATCGATTAGATCAAATGATGGAGATCGAGAGAAT
TAATGCTATTAGAATGCAAGAAGGAATTGAACTCAGACGTAAAGAAGATG
AACTTCTGGCTGCTTCGTCAATTATCCAACAGATTGAACAAAATGAACAA
GAAAGATTGATTGAATTAGAACGCAAAGATCAAGAAAATAAGTTAGAAAG
AGAAAGAGTAGCAGTGTTAATGGAAGAAGAGCTGGTAAAACGCTCGAAAA
TCAGACAAAACCAAGAAAAATTAAGAAACGATTTGAATAAATCTAATGAA
GAAATGCTTGAGAGAAAGATTAGAGAAAAAGAATTAGAACAATTGTTGGA
TTTACGAGTTCTTGAAATACAAAGGGAAAAAGCACTAAGAGAAGCTGAAT
TCGAAGCCGAGGCAATGCGAGTCAAAGCTGAAAAGGAACGCGAAGTTGCA
CGTTTAAGAGCACTTCAAGAGCGAGCTAAGGACGAGCAGGCTGAAAGAGA
TGAACTCCGAGCTCGTAGAGCTATGGAAGAAGCCGAAAGAGAATGGCGAA
GGAAAGAAATCGAACATGAAATAAAGAAAAAGCAAGTTGAGGAAGACCTA
TTACAAGCTCGCGCTGAACAAGCAGAAATGAAAGAACACTTTTTGGCAAT
TCAAGCAGCCAGAGATCGTGCGGAGTTTGAAAGGACAATAAGAGCACAGA
GAGAATTAATTGAAAGAGACAAACAAATGGAAGAAATTGAAAAATCCAAA
AGATCGGAATATTCCAAAGAAATTAGAAATCAAATCAGAAAGAATGAAGA
GACGAAAATAGCTGAAAGAAACGCTTTCTTCAAAGAAGGTGAAAAGATCG
AAGAAGAAAAAAGACTTCGAAGATTGAGAATGGAAGAAGCTAAAAACAGA
AAATTAGAAGAACTGAGGAATGCGGGAATATCGGAAAAATTTCTCAAGCA
AATCGAGAGGAAAATTCAACAAGTTCAAAATTCATAACCAGAAATGATCA
ATAATATTTATAGATTGTCACTAGTGATGATTGAGATTTCGAAATTAA
back to top

protein sequence of SMED30003084-orf-1

>SMED30003084-orf-1 ID=SMED30003084-orf-1|Name=SMED30003084-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=562bp
MSVGSICSSQSHGIQSHSSTGSRRSKGNNYKTVSRISRVEENLFGEPNYL
KLRKTASNVELNVHESEPTVSYCSDRKVCSNNNEYKEKEETIRIITKDMV
RNLRVPREDPSFKSMVLDSDSFLKLRNRARIVSHEEKLKREEAIKTQKDE
EMMASHGRRQEMKRHDILRQKNDKMTDLEEEAYQKAQTLLKKAMEQRQEQ
EDEIKKLNELISNAKIQAIRDAQILEKEIIKKENLEEDHRLDQMMEIERI
NAIRMQEGIELRRKEDELLAASSIIQQIEQNEQERLIELERKDQENKLER
ERVAVLMEEELVKRSKIRQNQEKLRNDLNKSNEEMLERKIREKELEQLLD
LRVLEIQREKALREAEFEAEAMRVKAEKEREVARLRALQERAKDEQAERD
ELRARRAMEEAEREWRRKEIEHEIKKKQVEEDLLQARAEQAEMKEHFLAI
QAARDRAEFERTIRAQRELIERDKQMEEIEKSKRSEYSKEIRNQIRKNEE
TKIAERNAFFKEGEKIEEEKRLRRLRMEEAKNRKLEELRNAGISEKFLKQ
IERKIQQVQNS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0031514motile cilium
GO:0005622intracellular
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0000464GABAergic neuron
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR033253CFAP45
Vocabulary: biological process
TermDefinition
GO:0006886intracellular protein transport
Vocabulary: molecular function
TermDefinition
GO:0017137Rab GTPase binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 271..319
NoneNo IPR availableCOILSCoilCoilcoord: 361..456
NoneNo IPR availableCOILSCoilCoilcoord: 193..227
NoneNo IPR availableCOILSCoilCoilcoord: 324..348
NoneNo IPR availablePFAMPF13868TPHcoord: 207..553
e-value: 3.6E-73
score: 246.1
IPR033253Cilia- and flagella-associated protein 45PANTHERPTHR15504NASOPHARYNGEAL EPITHELIUM SPECIFIC PROTEIN 1coord: 20..570