DUF4549 domain-containing protein

Overview
NameDUF4549 domain-containing protein
Smed IDSMED30003073
Length (bp)7001
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DUF4549 domain-containing protein (SMED30003073) t-SNE clustered cells

Violin plots show distribution of expression levels for DUF4549 domain-containing protein (SMED30003073) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003073

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30003073h1SMcG0010310 Contig13782newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30003073h1SMcG0010310 Contig13782uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30003073h1SMcG0010310 Contig13783newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30003073h1SMcG0010310 Contig13783uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30003073h1SMcG0010310 Contig13249newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30003073h1SMcG0010310 Contig13249uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DUF4549 domain-containing protein vs. Ensembl Zebrafish
Match: si:ch73-242m19.1 (si:ch73-242m19.1 [Source:ZFIN;Acc:ZDB-GENE-131121-474])

HSP 1 Score: 309.301 bits (791), Expect = 4.763e-136
Identity = 259/885 (29.27%), Postives = 434/885 (49.04%), Query Frame = 1
Query: 1150 RWGMDSAMRALLKPANWKPFNKFTPKINLLEARYLNKLRDEEIKDEFLITASLFLKKSNAEETQMNLRHHALVIQHLPVVYNTAVVTNPKGF---DIADILKTIYTKCDVNLRTFTT----------DDKPNNDSSGDHDNYNFTEALQLLGLDESIETKDDSSTVQGAYLSYLHLRFLKIRDMQRTCLSILNYFRSVERTLVIDEYQFTKESVRPVKKSNPASSQDLDSSNFDN--LGNHGYLQATVDDFKISIEDFMKTNEIENHDDFYLHENGRIHVQDLMGNWIMYDVALKDFEKLESDLILIGSYYITFDKEMRSSTLFNRKQSQSEHTEGSEFYILEYGHREVDRFGVLYDLWCQHTDFMEQKKKLFDLNMEVYNTVCKQEDRQHLAQTLINLMHHKPRIDLHSKYFLISYRYENMILERKFQIFKMILDKEISREREYLSKVYKD------SDY--PYRHIPHLLIAPNSDECALQEVHFLEFLPSLSQVCQINKMIDYASLNIKNLSSNTPVTSMLKKELDLLDTIYKEISEYEDITRQFT--DPNLIKFLSQDSVICNPLIMEEIGRKYLKIIDSKNTRGEKKRRKIRCINEFSRLIELANIRFRLIHVLHETEYLHSIYDNQAITLGYDNFHLFMRQVPFERAVKTEGAEYYKPFLYXXXXXXXXXXXXKYRPEHPYPAIHELDNVHFGLFNLITINDIIQCLESKGLENLQVMLKVQFCHKNAVASGVLLCDYCRPSVYKSHKEKSLSHIESSLGQTVTTYNLPISAQSGPTPLALDSSRASIHALTDSYPEALFSLQLEKVPIRDKMLNNFLKKFPSPST--VSQVDMEKAKRDCITFFTNAFYDRIAHIALKAQIIAYYNSIINTLNAVPEI 3723
            R+G  S    L K A+W P  +  PK +  + + + KL++  + DE L   S  L+ S+  +    L+   L+            V  P+     D +D+ + IY     N+   TT          D +P+   S   +    T++  +   DE  +  DDS  V+GA+ S + LR L+IR+++R CLS+LNY RSVERTLV+D      ESV      N   +  + +   D+  L +H ++  T  D+K+   +FM+  E+EN  D+Y  +   IH QD  G +I+YDVALKD E+LE +L+L  S++I    ++ +S              GSE  +      +VDR  VL DLW    DF+E K +L +  +E Y  V   E++  LAQ + ++MH +P++D  + YF+ SYR   + L+   Q+ K++L+ +I  +R+YL ++++D      S+Y  P  +IP  L++      AL+ V+FLE  PSL   CQ+ + ++ A   +  L      +  +K E  LL T    +  +  +T       P + + L  D  I +P ++ ++G   ++  D +  R + K R++  +  F  L+EL  +R R+     ETE+L  +Y + +  +G+D  HL+MR V FE AV+ E  +    FL  +++QD+    D++ P     A+ ELD  H   F+  +   ++Q +    +ENL+V+L  Q   +NA+   +     C    +++ K    S  +  L           SA S     A+D          + +  A  S+QLEKV +RD+MLN F+KK     +  ++  D+ + KR  I  F + F +R+    ++ Q+I+   S+++ L  VP I
Sbjct:  111 RFGRKSPNMTLRKQASWIPHIQMKPKRDPWQQKQMAKLKELRLMDELLQMHSSLLEDSDLHKVTDALKQ--LITS----------VCQPEASSLKDTSDVWRNIYNT--ANMLQVTTGQMIRLPKYADQRPSERKS---EGCGQTQSACVFEKDE--DAVDDSVMVRGAFESLIFLRHLRIRELKRVCLSLLNYLRSVERTLVMDGAGL--ESVGGDLVRNMEETGWIYAVRKDDGALNSHHFIYNTPVDYKVRCAEFMEFPEVENLHDYYSTDGRFIHTQDQRGLYIVYDVALKDLEELEQNLLLTASHFILKSTDLHTSC-------------GSEEELQRLARTDVDRIAVLLDLWTCEADFLEHKIQLLNCYLEAYQHVTDPEEQFRLAQVITDIMHRRPQMDFTAGYFVQSYRDSIVCLQSHQQLIKLVLNNQIDEQRQYLQRIWRDGQKGSPSEYGLPPNYIPKHLVSIGGSRPALKSVYFLEIHPSLGLACQLYEGLERACTELFELHRAKAPSQRVKLEQKLLKTA---LHHWHTLTSPGVTYSPQIQRDLFLDVFIEDPALVRDLGLYIVRCADEQE-RKQGKDRQMFMLETFCTLLELVTLRHRIFESAAETEHLSQLYKSLSRVIGFDEVHLYMRLVQFEFAVRKETPKQLPVFL--TALQDNRQEADRFIPNSLPLAVQELDENHICKFSFRSKEAVLQLMNEASVENLRVVLMCQVVQRNALIGALKQASVC----FRTEKLDQSSDSDLKLQHEE-------SASSTTRRRAVDDK--------NRFAGAFVSIQLEKVSLRDEMLNTFIKKKEQMGSLKMNSEDVCRIKRKLIVDFCHRFNERVCECFVRGQLISLTFSLLSLLREVPHI 936          

HSP 2 Score: 173.326 bits (438), Expect = 4.763e-136
Identity = 212/978 (21.68%), Postives = 414/978 (42.33%), Query Frame = 2
Query: 3731 FQFGKAFNPAKSTVDANCNLDKNPKKLHNRCRKVIDDDGQKLINIWYIPHFSEILFLYRQTEDAKANLILYNFLRLVMAFHDIIQYVVGFWKFGFNSTRVPEKMKMKINKIYNLPTDTNSQNIVHHLHCDEVADLSYFTDYNTTNTYQLRKEFVDLEIQIEHLPNPYDLEQVIDLLNIRRKYHFYYFEICATLLLKELFLSTDNIHCYKKLMNGIQSSIPTIRNVRYTKHISEG---LCIPSLISETDPEIDKLFPWRSMMLKSG--PVFINFDCTMNICDYLQLCFICIPQKYRFLIYNQFYNLNLSLEDMLVE-QETMTTNPSINNDNXXXXXXXXXXXXXXXXXXXXXATEHVKKDDLESTIIEEKKSLSLRENPIQTYEHLLTFLYVLRQLYVLRDIYSFKVSQIKKIDSYESFLTVSKQYKLSILFPVLRKLSYDINVPNFYFYGPLKAEDVVTYPKGIPEVSIYNLLIKALINKIEKQQINLLRSKITQKIDHVIKQRHYESETI--DMEKSPYLIFKNSLKNPNLVADLIKKFEAPFQLAXXXXXXXXXXXXXXXXXDGKENEKEIENDNLVYSKMYVNKCLQYLANTLLRIHRETYESFAMYFENLLKHQQQLLLFRNREYYGLKEEFHEKEQSLSVERQFILANKVSERILEINYLRGKV---KEDKQNIQNKENTLRRQTSLSFKFLIRNLYNLGFEQMTRIKVSRFKLHCDVYQRINATRLNAFYEMNKIKERSGAKYTTDDEIALRNLILTKKM-SDARAVNFSLFQFIARMKSLFNWIY-------NYTVCDWENMLNENMNRTDRVKGLVFLVTVNAQQKVKLIKCEFKRLKVIISDTEKELSELKNTLNKEITQQTQKRQKAKLKHLSLXXXXXXXXXXXSDLMNQLQE----MNGQIATMKMKFESHIKNNKSVTVTSHNQVEKLSTILTDERRKKLNAFNKVDDLIAQVYEFEAGFAMVNT 6595
            F  GK  +P ++ + A      +P+      R+++  DG+ L+N+W+IPH++E+L ++R  ++ +    L N L+++ A HDI+ Y+V F + G                        NS ++     C   +      D+    +  +  E  D++ QIE L      E V  LL + R   F  F+     ++++ FLS+ N+  Y+ +   +  ++P + ++     I  G   L +P  +     +  KL+PWRS +   G  P+ + +D +  I  Y+QLC   +  + R         ++L ++D+L   ++ M       +DN+                     ++    DD  +   ++ + +   E+  Q+      FL + +Q+ V ++ ++ + +  K I++   F   S+ Y++ I FP ++ L+  ++V   Y    L     V  P G  EV I    +  L+   E   I  L+++I  ++  V+ +R      I  D+ K P      SL+ P +V D I++  +                           E+   +  + +S  ++  CL  L+  ++   +  ++ ++ ++E++L+ Q+QLL  R ++   +KE   +  QS    R+  +++     +LEI  LR KV   +E+K+N+    N   R+    +  L+  L++       R+     K+  DV Q I++ R      + K+K R       DD  +L + +  K++  D    N  L   + +++    W            +  W   LNE   +T+ VK     V + ++QK  + + E   +K  +   + E   ++    K+IT Q+QK Q  + +     ++  + Q    + +  LQE       Q+ T+  + + H  + +     SH  + ++   L  ER  KL AF  VD L  Q+  +EA     +T
Sbjct:  941 FIMGKPEDP-RADLQAEGRPSPDPRTFQPCPRRLLSADGKSLLNLWFIPHYTEVLLMFRTLKEKERQQALQNSLQIMSALHDIVYYLVSFARLG------------------------NSDSL-----CSRSSTQKLTADWGGLES--IGAELWDVQRQIESLCESSSSESVGRLLQLHRDVLFLRFDTAVRYMIRDAFLSSGNLSAYQSMTENMSHALPIMSDM-----IVGGANLLSVPQPLEAASSQAQKLYPWRSFLAIHGLHPLVM-WDVS-PIEHYMQLCLCDLNDRCRMEANGAILGVSLIMDDVLSSGRDAMPLQMQTTDDNKS-------------------TSDRELLDDGMANNKKKAECVCQAEDAFQSLLKQKGFLLLWKQMEVFKESWTQRQTSFKTINTPALFKHFSQLYRVEIFFPSMQALAQQMDVEKEYQI-LLSQTQTVLPPPGAAEVDIKAWQLLRLLEMTEVDMIRALQNRINTEMTLVMSERSRHDMQIPADLWKRPSAKHSVSLERPQIVEDFIQRLMSA--------------------------EERQTDGQVTFSTAHLQDCLTELSCAVMNREKSVFQRYSQFYEHILQQQEQLLYQREQD---VKELEAKNLQSSDPYRK--VSDVCRGMMLEITALRAKVNQLEEEKRNLDQHLNLKHRE---RYDTLVHQLFSSCLLLKARLDSYNEKMDHDVRQLISSVRKEGVDRIIKLKTRLSP---ADDNQSLIHTLQQKELLEDLDGENSRLAALVCKLRIFSRWKLLTEQERIQKELLHWR--LNEASCKTEAVK-----VKLISEQKEIVSRQELDAVKEALLQCQTEYEHIQ----KQITLQSQKLQDIEHRSARDAQSRQELQTLRMESVETLQEDVLDRESQLRTLSAQLQKHTHDTQIRQQRSHRHIRQVRGQLHQERSLKLEAFQHVDKLHNQIQNYEAALQCKST 1811          

HSP 3 Score: 47.7506 bits (112), Expect = 4.763e-136
Identity = 24/75 (32.00%), Postives = 40/75 (53.33%), Query Frame = 3
Query:  939 FPLHTNDMHYLEHLLIYFCEVYGINMDVHKIRNAADEMELYSVVSRRFKTVFNMQEQMRTFKVYDKIDSRTMGYG 1163
             PL + ++   +  L +    Y +  + + I+  ADEMEL S+V   F+TVF  QE+M+ F  YD  ++    +G
Sbjct:   39 LPLLSTNLEDFKVQLDFLLSHYDVEYNTNSIKTTADEMELISLVLYVFRTVFKQQEEMKIFLQYDSTEATDRRFG 113          
BLAST of DUF4549 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000038343.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:5:74887814:74921018:-1 gene:ENSXETG00000013821.1 transcript:ENSXETT00000038343.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.3294 bits (181), Expect = 2.257e-12
Identity = 118/593 (19.90%), Postives = 253/593 (42.66%), Query Frame = 2
Query: 4841 NPIQTYEHLLTFLYVLRQLYVLRDIYSFKVSQIKKIDSYESFLTVSKQYKLSILFPVLRKLSYDINVPNFYFYGPLKAEDVVTYPKGIPEVSIYNLLIKALINKIEKQQINLLRSKITQKIDHVIKQRHYESETIDMEKSPYLIFKNSLKNPNLVADLIKKFEAPFQLAXXXXXXXXXXXXXXXXXDGKENEKEIEN--DNLVYSKMYVNKCLQYLANTLLRIHRETYESFAMYFENLLKHQQQLLLFRNREYYGLKEEFHEKEQSLSVERQFILANKVSERILEINYLRGKVKEDKQNIQNKENTLRRQTSLSFKFLIRNLYNLGFEQMTRIKVSRFKLHCDVYQRINATRLNAFYEMNKIKERSGAKYTTDDEIALRNLILTKKMSDARAVNFSLFQFIARMKSLFNWIYNYTVCDWENMLNENMNRTDRVKGLVFLVTVNAQQKVKLIKCEFKRLKVIISDTEKELS----ELKNTLNKEITQQTQKRQKAKLKHLSLXXXXXXXXXXXSDLMNQLQEMNGQIATMKMKFESHIKNNKSVTVTSHNQVEKLSTILTDERRKKLNAFNKVDDLIAQVYEFEAGFAMVNTQS 6601
            +PI  ++ L +FL + +QL + ++ +     Q++KI++   +   S+ Y+  I +P ++ ++  +      F G      VV  PKG  E  I    +  ++  IE   I+ ++ K  +++  V  +R  E+        P  ++K          +++K+  +P +                        EK ++N    + + K ++  CL+ LA  ++   R  +E+++M++ENLL  + QLL              ++KEQ   + +  + A    E +LE+  LR K+ + ++   +   T+R++     + L+R+L    F Q   +K    + + ++ Q ++                SG +    D+I    ++L KK                         Y +T  D+ ++  +N     ++K       ++  Q+V L++ +    +  ++ T+ E S    +L N L    +Q+ + RQ+A+           +K   +  L+  +Q+   ++ T+  + E   +  +        +V+++ + L  ER  KL+AF++VD+L  QVY+ E  F++ N+ +
Sbjct:  231 DPIGVFQLLKSFLILWKQLEMFKERWGKLKLQVEKINTVPLYKQFSELYRDDIFYPTMKVIARQMGKEE-EFEGITLRTQVVLPPKGASEAKIRICQLHKILEDIEIHMIHEVKKKTAKELTLVKTERSREASL------PTELWKQ---------NVMKEHYSPVRPQIV--------------------EKFVQNLMSEVTFRKDHLEDCLKSLACDVMARERSNFETYSMFYENLLHQEHQLL--------------YQKEQVGYLYKPLLTAEMSHELLLEVTALRAKLSDLEEESLSSRETIRKEIQEEHEALVRSL----FAQCVYLKSKLEEYYINMKQHVSEL-------------ISGVRKEGVDDI----ILLKKK-------------------------YGFTK-DYSSLAAQNKKEGLKLK-------LSVAQEVTLLRQQLMVARTSLTRTQAENSHLNQQLCNGLEHRYSQEMRNRQQAE----------REKSASVDKLLGDIQDRESRLRTVTEEAERSSRMGQMEQNKIKREVKQMRSQLIQERSLKLDAFHRVDELQTQVYDLEM-FSIRNSST 708          
BLAST of DUF4549 domain-containing protein vs. Ensembl Mouse
Match: Ccdc162 (coiled-coil domain containing 162 [Source:MGI Symbol;Acc:MGI:1923223])

HSP 1 Score: 340.502 bits (872), Expect = 8.236e-147
Identity = 280/918 (30.50%), Postives = 440/918 (47.93%), Query Frame = 1
Query: 1159 MDSAMRALLKPANWKPFNKFTPKINLLEARYLNKLRDEEIKDEFLITASLFLKKSNAEETQMNLRHHALVIQHLPVVYN-----TAVVTNPKGFDIADILKTIYTKCDVNLRTFTTDD---KPNNDSSGDHD-------NYNFTEALQLLGLDESIETKDDSSTVQGAYLSYLHLRFLKIRDMQRTCLSILNYFRSVERTLVIDEYQFTKESVRPVKKSNPASSQDLDSSN---FDNLGNHGYLQATVDDFKISIEDFMKTNEIENHDDFYLHENGRIHVQDLMGNWIMYDVALKDFEKLESDLILIGSYYITFDKEMRSSTLFNRKQSQSEHTEGSEFYILEYGHREVDRFGVLYDLWCQHTDFMEQKKKLFDLNMEVYNTVCKQEDRQHLAQTLINLMHHKPRIDLHSKYFLISYRYENMILERKFQIFKMILDKEISREREYLSKVYKDSDYPYR----HIPHLLIAPN----SDEC-ALQEVHFLEFLPSLSQVCQINKMIDYASLNIKNLSSNTPVTSMLKKE-------LDLLDTIYKEISEYEDITRQFTDPNLIKFLSQDSVICNPLIMEEIGRKYLKIIDSKNTRGEKKRRKIRC--INEFSRLIELANIRFRLIHVLHETEYLHSIYDNQAITLGYDNFHLFMRQVPFERAVKTEGAEYYKPFLYXXXXXXXXXXXXKYRPEHPYPAIHELDNVHFGLFNLITINDIIQCLESKGLENLQVMLKVQFCHKNAVASGVLLCDYCRPSVYKSHKEKSLSHI--ESSLGQTVTTYNLPISAQSGPTPLALDS---------------------SRASIHALTDSYPEALFSLQLEKVPIRDKMLNNFLKKFPSPSTVSQV----DMEKAKRDCITFFTNAFYDRIAHIALKAQIIAYYNSIINTLNAVPEI 3723
            M      L K A+W PF K  PK +  + + L +L++ +  DE +   S FLK S+       L+ HA   + +P+  N      A   +P+ +D   + K IY+   +      +DD   KP+   S D          YNF  ALQLLGL +  E   +   ++GAYLS+L LR L IR++QR CL +LN+FRSVERTL ++    T  S   V     +S  ++          LG H Y+  T  + K+    F++ +E EN DDF+  + G +H QD +G +++YD AL+D ++LES+L+LI S+YI  +K  R              +EGS+  +L + H  VDRF VLYDLW   T+ +E K++L D   E Y      E+R  LAQ + ++MH +P+ DL   YF  +YR +   L    Q+ + IL   + ++R+Y+ ++++  D+P       +P  +I       S+ C A  +VH LE  PSL     I K +++     ++       +S+ + E       LDL  +  K  + Y           L + L    V+ +P +MEE+G   L  + S   +G K+ +      ++ FSRL+EL  +R RLI    E+ YL  +Y   A+ +G++  HL +R V FE A   +  +   P ++++S+ +D S VD+Y P     AI ELD+   G F+  T   I++     G+EN+QV L  Q   +NA+   +              ++    HI    SL     T + P     G +P   DS                     + +S    +   PEA  S+QLEK  +RD MLN FL +    + + Q+    D+EK K++ I  +      R++H +L+ QI+AY NS+   L+  P I
Sbjct:  342 MSGPTTTLRKRADWIPFVKVKPKCDPWQKKMLTRLKERKRIDELMNLQSQFLKISDPVRVMQVLQDHA--AKTVPMASNHPSRPPAQPLHPRNYD--QVWKNIYSNPKLYQAENPSDDDFAKPHLSQSSDGSLKQRTETGYNFAVALQLLGLSDGTEPDRNPVLMRGAYLSFLCLRHLHIRELQRICLGVLNFFRSVERTLTMNTSGLTLVSGTLVPTLGDSSWINMSKGGMGTLQGLGTHHYIHGTPAEHKVHSIQFLEFSEAENQDDFHTTQAGYVHTQDQLGEYVVYDSALQDLKELESELLLIASHYIEKEKSHRGEC----------RSEGSQ--LLGWAHANVDRFAVLYDLWTCETNLLEGKRQLLDSYFEAYQHTLDPEERFALAQAMTDIMHRRPKFDLSHSYFTKAYRDDCTCLRLHLQLVRGILSHHLEQQRDYVQRLWR-GDHPEAPKTFGLPLNVICKQFVSISNSCPASGKVHPLELHPSLGLAGLIPKALEHLFREARHAHKAASPSSLAQIEICSLQLALDLWLSPVKPEAWY--------SAQLQRELFSAQVMGDPFLMEEVG---LLALRSAVDKGVKQGQDFHTLLLDTFSRLLELLTLRHRLIETSVESAYLAGLYKELALEMGFEESHLHLRPVHFEFASHKDKVDPPPP-VFITSLLEDSSRVDRYCPTSLVLAISELDDNQIGKFSFHTKEAILKLFVHSGVENMQVTLACQTAQRNALMVAI--------------QQAFFYHIPGAGSLVDLKETSSDP-RHHGGVSPCRRDSRTTNGKECLLLTPTLKTPDTFTHSSGFKTSKRAPEAFVSIQLEKAGLRDLMLNTFLHR--KQTMMDQIKSPDDVEKVKKELIVEYCQKLNRRMSHYSLRGQIMAYCNSLRVLLDDFPTI 1213          

HSP 2 Score: 121.709 bits (304), Expect = 8.236e-147
Identity = 95/349 (27.22%), Postives = 166/349 (47.56%), Query Frame = 3
Query:  108 LDELLKMDVVELKAQIEENQLIYGLNNKDPSSIYTPKDPEFYXXXXXXXXXXQIDGQCTHTGKIVADTIKLEIECCEKFEYRDKSLLLLVYQYFKNRMKVLVNMKRSQMLRYKRYCINKTLTEFIKEHYNARLNAINTEYNDVRARYNRLKAAQEGFICNSDQGLEEITMDDIFIYMKWLIQHMYNMEYITTMVKIIRWIPIKYRKNNAAKAENDTDSFNKSESTYKYIRSTTSILQNRESSLTARHSQRTISNTRSDINLSAASGG-------GYAVDERNLLFPLHTNDMHYLEHLLIYFCEVYGINMDVHKIRNAADEMELYSVVSRRFKTVFNMQEQMRTFKVYD 1133
            L++ L + + ELK ++E+  L  G  N+  SS+  PKD   + ++R   LKR +    +    I AD +K E+E C + EY  ++L LL+ QY+  R+  L   K   +LR+KR C      E +   Y  +++ I  E+ND   R  RL  A+E  +   +   + +T +D+ IY +WL+ H++ +  I   ++ ++++PI    + AAK                  + + S  ++ ++ +T               +L AAS G       G    +   + P H  D   L+  L      + I  DV K+ ++A EM L+S VS+ F+++F  Q++M TF  Y+
Sbjct:   16 LEKELAVKLSELKTEVEDQGLFPGTGNRIFSSVQIPKDVAHFRREREAALKRTLQVAESKPLVIQADVLKRELESCLRREYTPENLPLLLLQYYTERITQLGQSKYLHVLRWKRLCQTSMAMEELYPLYKKQVDYIMQEFNDSVQRAERLSVARENLLMGKNNRPDLVTQEDLAIYTRWLVCHLHALRTIHHFLQALQYLPISRVLSLAAK------------------QVSGSSEEDGKACVT---------------DLHAASPGPLGPHVSGSGRTDAAFVLPQHVTDRDDLKPQLRRLLSHFHIPDDVQKLSDSAKEMGLFSSVSQNFQSIFMEQQRMWTFPDYE 331          

HSP 3 Score: 103.605 bits (257), Expect = 8.236e-147
Identity = 109/518 (21.04%), Postives = 214/518 (41.31%), Query Frame = 2
Query: 3728 FFQFGKAFNPAKSTVDANCNLDKNPKK-LHNRCRKVIDDDGQKLINIWYIPHFSEILFLYRQTEDAKANLILYNFLRLVMAFHDIIQYVVGFWKFGFNSTRVPEKMKMKINKIYNLPTDTNSQNIVHHLHCDEVADLSYFTDYNTTNTYQLRKEFVDLEIQIEHLPNPYDLEQVIDLLNIRRKYHFYYFEICATLLLKELFLSTDNIHCYKKLMNGIQSSIPTIRNVRYTKHISEGLCIPSLISETDPEIDKLFPWRSMMLKSGPVFINFDCTMNICDY-LQLCFICIPQKYRFLIYNQFYNLNLSLEDML------VEQETMTTNPSINNDNXXXXXXXXXXXXXXXXXXXXXATEHVKKDDLESTIIEEKKSLSLRENPIQTYEHLLTFLYVLRQLYVLRDIYSFKVSQIKKIDSYESFLTVSKQYKLSILFPVLRKLSYDINVPNFYFYGPLKAEDVVTYPKGIPEVSIYNLLIKALINKIEKQQINLLRSKITQKIDHVIKQRHYESETIDMEK 5257
            FF  G+  N  K   D++  L  +  +    R R ++  DG+  +N+W+IPH SE+LF+++   + +A   L   L+LV + HDI+ Y   F K G                 ++LP   N                    D+       +  E  +L+  I+ L  P D  QV   L +RR+     F+     LL+  FL+  N   Y+ +       +P + N       S  L +P  +    P+   LFPWR+ +   GP F       +  +Y +Q+C   +    R + + +   + + +ED+L      + + +     +++N    +     ++  + +         H K   L     +   SLSL          L +FL + ++L VL++ +     + + I+S       S+ Y+  IL+P ++ L+  +   + +    L+++ ++  PKG  E+ I    ++ L+  +E   I  +  K+ +++   + ++  E  T+  ++
Sbjct: 1217 FFMVGQP-NEKKGLKDSSGELKADSSRSFQPRPRSLLSADGRVFLNLWFIPHPSEVLFMFKSLPEEEAFRALTLTLQLVASLHDIVAYTFSFAKLG------------NCPACFDLPLSPN----------------PLMRDWGGAEG--IGNELQELQKMIDSLQRPQDPSQVAQALLLRREVTLLQFDAAMRHLLRT-FLAAGNAPAYQSVAESACYGLPPLSNALGKSIFSSQLSLPQPLDPWSPQAFALFPWRAFLEDGGP-FPVISSVPDTLEYDMQMCLCGLSDCDRRVAHGELVGVQMLMEDVLLGSCHVIRKASTEWQAALDNAQPDWSKLPGLYPNQLE--------SHPKASALLEGQCDVVMSLSL----------LKSFLILWKRLEVLKEHWGRFKLRGQDINSALLHRQFSELYEAEILYPSMKALARQMGKEDEFEELMLRSQSILP-PKGASEIEIKTQQLQKLLESLEIHMIQEVLRKVNREMTLFLSEKSKEESTLPTDR 1682          
BLAST of DUF4549 domain-containing protein vs. Ensembl Mouse
Match: Ccdc162 (coiled-coil domain containing 162 [Source:MGI Symbol;Acc:MGI:1923223])

HSP 1 Score: 124.02 bits (310), Expect = 1.646e-55
Identity = 94/342 (27.49%), Postives = 162/342 (47.37%), Query Frame = 3
Query:  108 LDELLKMDVVELKAQIEENQLIYGLNNKDPSSIYTPKDPEFYXXXXXXXXXXQIDGQCTHTGKIVADTIKLEIECCEKFEYRDKSLLLLVYQYFKNRMKVLVNMKRSQMLRYKRYCINKTLTEFIKEHYNARLNAINTEYNDVRARYNRLKAAQEGFICNSDQGLEEITMDDIFIYMKWLIQHMYNMEYITTMVKIIRWIPIKYRKNNAAKAENDTDSFNKSESTYKYIRSTTSILQNRESSLTARHSQRTISNTRSDINLSAASGGGYAVDERNLLFPLHTNDMHYLEHLLIYFCEVYGINMDVHKIRNAADEMELYSVVSRRFKTVFNMQEQMRTFKVYD 1133
            L++ L + + ELK ++E+  L  G  N+  SS+  PKD   + ++R   LKR +    +    I AD +K E+E C + EY  ++L LL+ QY+  R+  L   K   +LR+KR C      E +   Y  +++ I  E+ND   R  RL  A+E  +   +   + +T +D+ IY +WL+ H++ +  I   ++ ++++PI    + AAK          S S+ +  ++  + L          H                 SG G    +   + P H  D   L+  L      + I  DV K+ ++A EM L+S VS+ F+++F  Q++M TF  Y+
Sbjct:   16 LEKELAVKLSELKTEVEDQGLFPGTGNRIFSSVQIPKDVAHFRREREAALKRTLQVAESKPLVIQADVLKRELESCLRREYTPENLPLLLLQYYTERITQLGQSKYLHVLRWKRLCQTSMAMEELYPLYKKQVDYIMQEFNDSVQRAERLSVARENLLMGKNNRPDLVTQEDLAIYTRWLVCHLHALRTIHHFLQALQYLPISRVLSLAAK--------QVSGSSEEDGKACVTDLHAASPGPLGPH----------------VSGSGRT--DAAFVLPQHVTDRDDLKPQLRRLLSHFHIPDDVQKLSDSAKEMGLFSSVSQNFQSIFMEQQRMWTFPDYE 331          

HSP 2 Score: 115.161 bits (287), Expect = 1.646e-55
Identity = 83/254 (32.68%), Postives = 121/254 (47.64%), Query Frame = 1
Query: 1159 MDSAMRALLKPANWKPFNKFTPKINLLEARYLNKLRDEEIKDEFLITASLFLKKSNAEETQMNLRHHALVIQHLPVVYN-----TAVVTNPKGFDIADILKTIYTKCDVNLRTFTTDD---KPNNDSSGDHD-------NYNFTEALQLLGLDESIETKDDSSTVQGAYLSYLHLRFLKIRDMQRTCLSILNYFRSVERTLVIDEYQFTKESVRPVKKSNPASSQDLDSSN---FDNLGNHGYLQATVDDFKIS 1866
            M      L K A+W PF K  PK +  + + L +L++ +  DE +   S FLK S+       L+ HA   + +P+  N      A   +P+ +D   + K IY+   +      +DD   KP+   S D          YNF  ALQLLGL +  E   +   ++GAYLS+L LR L IR++QR CL +LN+FRSVERTL ++    T  S   V     +S  ++          LG H Y+  T  + K S
Sbjct:  342 MSGPTTTLRKRADWIPFVKVKPKCDPWQKKMLTRLKERKRIDELMNLQSQFLKISDPVRVMQVLQDHA--AKTVPMASNHPSRPPAQPLHPRNYD--QVWKNIYSNPKLYQAENPSDDDFAKPHLSQSSDGSLKQRTETGYNFAVALQLLGLSDGTEPDRNPVLMRGAYLSFLCLRHLHIRELQRICLGVLNFFRSVERTLTMNTSGLTLVSGTLVPTLGDSSWINMSKGGMGTLQGLGTHHYIHGTPAEHKES 591          
BLAST of DUF4549 domain-containing protein vs. Ensembl Mouse
Match: Ccdc162 (coiled-coil domain containing 162 [Source:MGI Symbol;Acc:MGI:1923223])

HSP 1 Score: 77.0258 bits (188), Expect = 3.048e-13
Identity = 93/442 (21.04%), Postives = 175/442 (39.59%), Query Frame = 2
Query: 3950 LRLVMAFHDIIQYVVGFWKFGFNSTRVPEKMKMKINKIYNLPTDTNSQNIVHHLHCDEVADLSYFTDYNTTNTYQLRKEFVDLEIQIEHLPNPYDLEQVIDLLNIRRKYHFYYFEICATLLLKELFLSTDNIHCYKKLMNGIQSSIPTIRNVRYTKHISEGLCIPSLISETDPEIDKLFPWRSMMLKSGPVFINFDCTMNICDY-LQLCFICIPQKYRFLIYNQFYNLNLSLEDMLVEQ----ETMTTNPSINNDNXXXXXXXXXXXXXXXXXXXXXATEHVKKDDLESTIIEEKKSLSLRENPIQTYEHLLTFLYVLRQLYVLRDIYS-FKVSQIKKIDSYESFLTVSKQYKLSILFPVLRKLSYDINVPNFYFYGPLKAEDVVTYPKGIPEVSIYNLLIKALINKIEKQQINLLRSKITQKIDHVIKQRHYESETIDMEK 5257
            L+LV + HDI+ Y   F K G                 ++LP   N                    D+       +  E  +L+  I+ L  P D  QV   L +RR+     F+     LL+  FL+  N   Y+ +       +P + N       S  L +P  +    P+   LFPWR+ +   GP F       +  +Y +Q+C   +    R + + +   + + +ED+L+         +T      DN +   SK       +         H K   L     +   SLSL          L +FL + ++L VL++ +  FK+ + + I+S       S+ Y+  IL+P ++ L+  +   + +    L+++ ++  PKG  E+ I    ++ L+  +E   I  +  K+ +++   + ++  E  T+  ++
Sbjct:   18 LQLVASLHDIVAYTFSFAKLG------------NCPACFDLPLSPNP----------------LMRDWGGAEG--IGNELQELQKMIDSLQRPQDPSQVAQALLLRREVTLLQFDAAMRHLLR-TFLAAGNAPAYQSVAESACYGLPPLSNALGKSIFSSQLSLPQPLDPWSPQAFALFPWRAFLEDGGP-FPVISSVPDTLEYDMQMCLCGLSDCDRRVAHGELVGVQMLMEDVLLGSCHVIRKASTEWQAALDNAQPDWSKLPGLYPNQLES------HPKASALLEGQCDVVMSLSL----------LKSFLILWKRLEVLKEHWGRFKL-RGQDINSALLHRQFSELYEAEILYPSMKALARQMGKEDEFEELMLRSQSILP-PKGASEIEIKTQQLQKLLESLEIHMIQEVLRKVNREMTLFLSEKSKEESTLPTDR 409          
BLAST of DUF4549 domain-containing protein vs. Ensembl Mouse
Match: Ccdc162 (coiled-coil domain containing 162 [Source:MGI Symbol;Acc:MGI:1923223])

HSP 1 Score: 76.6406 bits (187), Expect = 3.261e-13
Identity = 93/442 (21.04%), Postives = 175/442 (39.59%), Query Frame = 2
Query: 3950 LRLVMAFHDIIQYVVGFWKFGFNSTRVPEKMKMKINKIYNLPTDTNSQNIVHHLHCDEVADLSYFTDYNTTNTYQLRKEFVDLEIQIEHLPNPYDLEQVIDLLNIRRKYHFYYFEICATLLLKELFLSTDNIHCYKKLMNGIQSSIPTIRNVRYTKHISEGLCIPSLISETDPEIDKLFPWRSMMLKSGPVFINFDCTMNICDY-LQLCFICIPQKYRFLIYNQFYNLNLSLEDMLVEQ----ETMTTNPSINNDNXXXXXXXXXXXXXXXXXXXXXATEHVKKDDLESTIIEEKKSLSLRENPIQTYEHLLTFLYVLRQLYVLRDIYS-FKVSQIKKIDSYESFLTVSKQYKLSILFPVLRKLSYDINVPNFYFYGPLKAEDVVTYPKGIPEVSIYNLLIKALINKIEKQQINLLRSKITQKIDHVIKQRHYESETIDMEK 5257
            L+LV + HDI+ Y   F K G                 ++LP   N                    D+       +  E  +L+  I+ L  P D  QV   L +RR+     F+     LL+  FL+  N   Y+ +       +P + N       S  L +P  +    P+   LFPWR+ +   GP F       +  +Y +Q+C   +    R + + +   + + +ED+L+         +T      DN +   SK       +         H K   L     +   SLSL          L +FL + ++L VL++ +  FK+ + + I+S       S+ Y+  IL+P ++ L+  +   + +    L+++ ++  PKG  E+ I    ++ L+  +E   I  +  K+ +++   + ++  E  T+  ++
Sbjct:   18 LQLVASLHDIVAYTFSFAKLG------------NCPACFDLPLSPNP----------------LMRDWGGAEG--IGNELQELQKMIDSLQRPQDPSQVAQALLLRREVTLLQFDAAMRHLLR-TFLAAGNAPAYQSVAESACYGLPPLSNALGKSIFSSQLSLPQPLDPWSPQAFALFPWRAFLEDGGP-FPVISSVPDTLEYDMQMCLCGLSDCDRRVAHGELVGVQMLMEDVLLGSCHVIRKASTEWQAALDNAQPDWSKLPGLYPNQLES------HPKASALLEGQCDVVMSLSL----------LKSFLILWKRLEVLKEHWGRFKL-RGQDINSALLHRQFSELYEAEILYPSMKALARQMGKEDEFEELMLRSQSILP-PKGASEIEIKTQQLQKLLESLEIHMIQEVLRKVNREMTLFLSEKSKEESTLPTDR 409          
BLAST of DUF4549 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q0VG85|CC162_MOUSE (Coiled-coil domain-containing protein 162 OS=Mus musculus OX=10090 GN=Ccdc162 PE=1 SV=4)

HSP 1 Score: 76.6406 bits (187), Expect = 2.281e-12
Identity = 93/442 (21.04%), Postives = 175/442 (39.59%), Query Frame = 2
Query: 3950 LRLVMAFHDIIQYVVGFWKFGFNSTRVPEKMKMKINKIYNLPTDTNSQNIVHHLHCDEVADLSYFTDYNTTNTYQLRKEFVDLEIQIEHLPNPYDLEQVIDLLNIRRKYHFYYFEICATLLLKELFLSTDNIHCYKKLMNGIQSSIPTIRNVRYTKHISEGLCIPSLISETDPEIDKLFPWRSMMLKSGPVFINFDCTMNICDY-LQLCFICIPQKYRFLIYNQFYNLNLSLEDMLVEQ----ETMTTNPSINNDNXXXXXXXXXXXXXXXXXXXXXATEHVKKDDLESTIIEEKKSLSLRENPIQTYEHLLTFLYVLRQLYVLRDIYS-FKVSQIKKIDSYESFLTVSKQYKLSILFPVLRKLSYDINVPNFYFYGPLKAEDVVTYPKGIPEVSIYNLLIKALINKIEKQQINLLRSKITQKIDHVIKQRHYESETIDMEK 5257
            L+LV + HDI+ Y   F K G                 ++LP   N                    D+       +  E  +L+  I+ L  P D  QV   L +RR+     F+     LL+  FL+  N   Y+ +       +P + N       S  L +P  +    P+   LFPWR+ +   GP F       +  +Y +Q+C   +    R + + +   + + +ED+L+         +T      DN +   SK       +         H K   L     +   SLSL          L +FL + ++L VL++ +  FK+ + + I+S       S+ Y+  IL+P ++ L+  +   + +    L+++ ++  PKG  E+ I    ++ L+  +E   I  +  K+ +++   + ++  E  T+  ++
Sbjct:   18 LQLVASLHDIVAYTFSFAKLG------------NCPACFDLPLSPNP----------------LMRDWGGAEG--IGNELQELQKMIDSLQRPQDPSQVAQALLLRREVTLLQFDAAMRHLLR-TFLAAGNAPAYQSVAESACYGLPPLSNALGKSIFSSQLSLPQPLDPWSPQAFALFPWRAFLEDGGP-FPVISSVPDTLEYDMQMCLCGLSDCDRRVAHGELVGVQMLMEDVLLGSCHVIRKASTEWQAALDNAQPDWSKLPGLYPNQLES------HPKASALLEGQCDVVMSLSL----------LKSFLILWKRLEVLKEHWGRFKL-RGQDINSALLHRQFSELYEAEILYPSMKALARQMGKEDEFEELMLRSQSILP-PKGASEIEIKTQQLQKLLESLEIHMIQEVLRKVNREMTLFLSEKSKEESTLPTDR 409          
BLAST of DUF4549 domain-containing protein vs. TrEMBL
Match: A0A4V3SDX3 (DUF4549 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007481 PE=4 SV=1)

HSP 1 Score: 622.468 bits (1604), Expect = 0.000e+0
Identity = 359/931 (38.56%), Postives = 554/931 (59.51%), Query Frame = 1
Query: 1012 IWMCTKFAMQLMKWSCIVLSADDLKPFSTCKNK*--------ELSKF----TIK*IQERWGMDSAMRALLKPANWKPFNKFTPKINLLEARYLNKLRDEEIKDEFLITASLFLKKSNAEETQMNLRHHALVIQHLPVVYNTAVVTNPKGFDIADILKTIYTKCDVNLRTFTTDDKPNNDSSGDHDNYNFTEALQLLGLDESIETKDDSSTVQGAYLSYLHLRFLKIRDMQRTCLSILNYFRSVERTLVIDEYQFTKESVRPVKKSNPASSQ-DLDSSNFDNLGN----HGYLQATVDDFKISIEDFMKTNEIENHDDFYLHENGRIHVQDLMGNWIMYDVALKDFEKLESDLILIGSYYITFDKEMRSSTLFNRKQSQSEHTEGSEFYILEYGHREVDRFGVLYDLWCQHTDFMEQKKKLFDLNMEVYNTVCKQEDRQHLAQTLINLMHHKPRIDLHSKYFLISYRYENMILERKFQIFKMILDKEISREREYLSKVYKDS---DYPYRHIPHLLIAPNSDECALQEVHFLEFLPSLSQVCQINKMIDYASLNIKNL-SSNTPVTSMLKKELDLLDTIYKEISEYEDITRQFTDPNLIKFLSQDSVICNPLIMEEIGRKYLKIIDSKNTRGEKKRRKIRCINEFSRLIELANIRFRLIHVLHETEYLHSIYDNQAITLGYDNFHLFMRQVPFERAVKTEGAEYYKPFLYXXXXXXXXXXXXKYRPEHPYPAIHELDNVHFGLFNLITINDIIQCLESKGLENLQVMLKVQFCHKNAVASGVLLCDYCRPSVYKSHKEKSLSHI--ESSLGQTVTTYNLPISAQSGPTPLALDSSRASIHALTDSYPEALFSLQLEKVPIRDKMLNNFLKKFPSPSTVSQVDMEKA---KRDCITFFTNAFYDRIAHIALKAQIIAYYNSIINTLNAVPEIV 3726
            ++ C  + +Q M    I  SAD+++ F+    K         E+  F    + K   ERWG+DS +RA+ KP+NW P+ K  PK +    +   +LR   + D+ L  ++ FLK  + E+ Q +LRHHA+++QH P+V++ +VV++ +G   A+I K IY   D   +     D+P        D+Y+FT+A+Q+LGLD++   KDD S+VQGAYLSYLHLR LK+RD+ RTC+S+LNYFRS+ERTL I++   +  S   V++++P + +   ++      GN    HGYL  +  +FKI   +FM+  EI+NHDDFY HE GRIHV+D +G WI+YD AL+DF KLE DL+L+ + +I  D+++R+S+   +K+   +  + S+  I  Y HR+VDRFGVLYD+W     F + K+KL D+ MEVY  +  ++ R+ LAQ + NLM+ +PR+DL+  YF+++YRYE  IL ++ +I + IL+ +I  +REYL K++ D      P   +    IA +SDE  L  V+ LEF PSLS    +   +D +   +  L + + P+  ++  E    D +  E+   + +   +T   L + L     + + + M E+  ++L  I ++N+RG+KK R++  +NE  RL++L  +R RLI  + E E L  IY   A  +G+D+FHLF+R + FE A   EGA+  +P +Y+++VQDDDS++DK+ P     AIHELD  H G F+      I++ LE++G+EN+  +LKVQ  HKNA+ + V+L    RPS Y  H  K+ + I   S+ G  + +Y      Q GPTPLAL+ S+  ++A  D +PEA FS+QLEK P RD+  N F+K+       S     ++   KR+ I+ F   F  R  HI+L+AQII+ Y+SI+  L  VP + 
Sbjct:  447 VYFCHAYGIQ-MNIQAIRSSADEMELFAVINRKFRQIFSRQEEMLTFKTYDSAKSASERWGLDSWVRAVRKPSNWLPYVKLRPKRHEYLVKLTMELRSGTVVDDLLKASANFLKVKSPEKVQDSLRHHAMLVQHPPIVHSASVVSHRQGQSTAEIFKKIYNNSDFFGKASADSDEPGKR----QDDYDFTQAMQMLGLDDATNAKDDPSSVQGAYLSYLHLRHLKLRDVMRTCISVLNYFRSIERTLTINDQGLSMNSRGGVERTSPPNHRVGTEAQGHKGGGNTIDGHGYLFNSPQEFKIKETEFMQFAEIDNHDDFYFHEEGRIHVRDQVGFWIIYDAALEDFNKLEQDLLLLATAFIQKDRQLRTSS-NTKKKGVDQEAQPSDLDIARYAHRDVDRFGVLYDIWINECAFQQAKQKLMDVYMEVYGHIISRDSRRRLAQIMTNLMYQRPRLDLNESYFVLAYRYECAILRQRTEIMRCILNHQILNQREYLKKIHVDKPEFGMPPPLLERFPIAVHSDETLLTPVYLLEFHPSLSCAPSLAAAMDRSVQQLYELFTPDQPMQEIVL-EKRFYDFLRYEVETLKPLGGSYT-AQLQRDLFSSYFVEDAIQMCELSNQHLAAIQNRNSRGDKKTRQMYLLNELGRLLDLVTLRHRLIDCMWECEVLSKIYLTVAHEMGFDDFHLFIRPLQFEAAKYKEGADDLRPPIYITAVQDDDSMLDKFLPSALPLAIHELDETHVGKFSFRGKVTIMEMLETRGVENMLTILKVQTAHKNALTASVMLAYNARPSFYSMHAPKTKTGILRPSNTGANLISYTGLSGTQVGPTPLALERSKHQLNA--DYHPEAFFSIQLEKSPSRDRTQNAFIKRTQGGGIASSKSSVESEKMKREFISQFCMDFGQRTQHISLRAQIISTYSSILTILEKVPTVT 1367          

HSP 2 Score: 370.548 bits (950), Expect = 0.000e+0
Identity = 299/1138 (26.27%), Postives = 518/1138 (45.52%), Query Frame = 2
Query: 3728 FFQFGKAFNPAKSTVDANCNLDKNPKKLHNRCRKVIDDDGQKLINIWYIPHFSEILFLYRQTEDAKANLILYNFLRLVMAFHDIIQYVVGFWKFGFNSTRV-PEKMKMKINKIYN-------------LPTDTN-SQNIVHHLHCDE-VADLSYFTDYNTTN---------------TYQLRKEFVD---------LEIQIEHLPNPYDLEQVIDLLNIRRKYHFYYFEICATLLLKELFLSTDNIHCYKKLMNGIQSSIPTIRNVRYTKHISEGLCIPSLISETDPEIDKLFPWRSM--------MLKSGPVFINFD---C-----------------TMNIC--DYLQLCFICIPQKYRFLIYNQFYNLNLSLEDML-----------VEQETMTTNPS---------INNDNXXXXXXXXXXXXXXXXXXXXXATEHVKKDDLE--STIIEEKKSLSLRENPIQTYEHLLTFLYVLRQLYVLRDIYSFKVSQIKKIDSYESFLTVSKQYKLSILFPVLRKLSYDINVPNFYFYGPLKAEDVVTYPKGIPEVSIYNLLIKALINKIEKQQINLLRSKITQKIDHVIKQRHYESETIDME--KSPYLIFKNSLKNPNLVADLIKKFEAPFQLAXXXXXXXXXXXXXXXXXDGKENEKEIENDNLVYSKMYVNKCLQYLANTLLRIHRETYESFAMYFENLLKHQQQLLLFRNREYYGLKEEFHEKEQSLSVERQFILANKVSERILEINYLRGKVKEDKQNIQNKENTLRRQTSLSFKFLIRNLYNLGFEQMTRIKVSRFKLHCDVYQRINATRLNAFYEMNKIKERSGAKYTTDDEIALRNLILTKKMSDARAVNFSLFQFIARMKSLFNWIYNYTVCDWENMLNENMNRTDRVKGLVFLVTVNAQQKVKLIKCEFKRLKVIISDTEKELSELKNTLNKEITQQTQKRQKAKLKHLSLXXXXXXXXXXXSDLMNQLQEMNGQIATMKMKFESHIKNNKSVTVTSHNQVEKLSTILTDERRKKLNAFNKVDDLIAQVYEFEAGFAM------VNTQSEASRGRVEKNYKARLLQTKTKKVDLRGNYPDLILHQRQLTYDAIIKRHCIPYTPCHFLPFRRDRVEAHRMKMRIQNRLIK 6841
            FF  G AF       D +  +  +P+ L  R R+V+  DG KL N W+IPHF E+LF++R  +D      L    RL    HDI+ Y++ + + G +S ++ PE+ +  I                  LPT    + NI      +  VA LS      + N               +   R   VD         ++ QI  LP+P D EQVI +L +RR   F  F++C   +L+E FL+  N+  YK+++      +  + +V+     +  + +P  +   D +   +FPWRS+        +   GP  I ++   C                  MN+C  D L +  I   +    +   Q  N++  L                   T T  P+          N  N        ++     E     ++ H         +T  ++   LS  ++P+  Y  L  FL + +++ +L+  +  +   ++ I++   F T    YK   L+P++R L+     P+ Y  GPL A D++  PKGIPE+ +    +  LI   E   I  LR  + ++ D VIK+R+ E   + +E  K P +    S+K P L  + + +  +                           EK  +ND    +K  +N+ LQ +A +++R  RE+YE+++MY+ENLLK+Q  LL  + RE   LKE   + E   +V  QF ++ +    +LE+  LR K+ E ++     E+ +R +    F   +R L+ L FEQ +RI   R  LH    QRI   R  A  EM +IKERSGA+ + +DE+A RNL L+++++     N +L Q ++R++ + +W      C +E  ++    + ++ K  V  + + ++Q+V+++  E  +L+  +S+TEK L++++  L+KE++ + +KR  A+ K  + K+  + KQ  I  LM ++ E N  +  M    ++  K+ K     S  +V+ L   L +ER+ K +A +KVDDL++Q+YEFE  ++       VN  +   +G       AR L  +                QR +TY+ ++ +   PYT  H+L FR++     +++ R+  +++K
Sbjct: 1370 FFVIGYAFEKKNPEDDLDVQV-TDPRTLRTRPRRVLSTDGTKLYNFWFIPHFIEVLFIFRHLDDLSCTKALQRMARLACVLHDILHYLIAYARLGISSAKITPEQRQQVIAGSQKHGGQQWRTAIRGALPTAAEVASNIAGTTSAETFVAQLSSAGTIPSMNMALSSPALSVTPLDLSVHGRSLVVDQIIATELREIQYQINRLPDPTDPEQVIQMLELRRDVMFLQFDVCMRTILRETFLAAGNVEAYKEVVENSHFPLSELSDVQRPCLNAIEMNVPEPLEARDDQAKAIFPWRSLMNSCGPFLLFCFGPSTIEYNIRLCLAGLKPVDRPTVHGELLAMNLCLEDVLDVGDIPEAKAGEPMPIQQAENMHCMLGKRTRDRRREIPPPNAASPTGTGGPASTPGSVAGTTNPVNATGTSINTINITHSSETQGQKSSTHGGAGGTGPLTTTADKTPKLSTLDSPVAAYTLLKKFLILWKRVELLKYAWGRRRLGVEAINNPNLFKTFCSIYKREKLYPLIRSLAIQYRQPDMYALGPLDATDIIVMPKGIPEMVVRQRQLLKLIEAFEFYMIADLRKLLVRQTDLVIKERNREEGNLPLELWKRPAMKETLSVKRPGLADEFLVELMSHL-------------------------EKNAKNDTYTITKDKLNEVLQTVAISVMRTQRESYENYSMYYENLLKNQHSLLYAKEREIETLKETLRQNELETNVTVQFQMSEQAHNLLLEVTALRAKIAELEEINLKTESKVRNRVRREFSVAMRKLFGLSFEQKSRIDQYRDHLHAITLQRIAEVREEASAEMARIKERSGARASAEDELAERNLRLSREVNTLHQRNIALQQMMSRLRVMAHWQQTTLRCAFEKQISGVEEQRNQSKSQVTRLGILSEQRVRMLNEEMSKLRDHLSNTEKHLNDMRKALDKEMSDKVEKRHAAERKAATDKQMAMVKQMHIDQLMAEIAEKNATLEKMGSLLDASAKSKKQEADKSVREVDLLRKQLREERKLKKSAIHKVDDLMSQLYEFETAYSSGQNRPGVNLPTMTPKGEAAAG-GARKLSAEI---------------QRPVTYEDLVAKKSGPYTSKHYLRFRQETARVPQLRERLVQQILK 2465          

HSP 3 Score: 150.984 bits (380), Expect = 2.919e-32
Identity = 72/201 (35.82%), Postives = 133/201 (66.17%), Query Frame = 3
Query:  120 LKMDVVELKAQIEENQLIYGLNNKDPSSIYTPKDPEFYXXXXXXXXXXQIDGQCTHTGKIVADTIKLEIECCEKFEYRDKSLLLLVYQYFKNRMKVLVNMKRSQMLRYKRYCINKTLTEFIKEHYNARLNAINTEYNDVRARYNRLKAAQEGFICNSDQGLEEITMDDIFIYMKWLIQHMYNMEYITTMVKIIRWIPIKYR 722
            L+ D++EL+AQIEEN+LI+G+ +K  SS+Y PKDP+++ ++R+L L+R +         + A+ +  E++ C + E+ +++L +L++QYF +R+  +V +K   +LR+KRYC +    E I+  Y  RL  +  EY D  +R +RL + +EG + NSD G+E++T++D  IY+++ + H+ ++ Y   ++ II+W+P  +R
Sbjct:   15 LRSDILELRAQIEENELIHGIPSKGMSSVYIPKDPDYFRRERKLILQRTLQVLEPQPIMLQAELMMQELDACNQREFTERTLPILLHQYFIDRIHQIVLLKHGYLLRWKRYCSSTAAVETIQSEYLNRLEYLTNEYLDASSRAHRLASTREGILANSDNGVEDVTVEDYQIYLRYHLSHLQSLSYTNQLLNIIKWLPYSHR 215          

HSP 4 Score: 100.908 bits (250), Expect = 4.194e-17
Identity = 43/101 (42.57%), Postives = 70/101 (69.31%), Query Frame = 3
Query:  861 ISNTRSDINLSAASGGGYAVDERNLLFPLHTNDMHYLEHLLIYFCEVYGINMDVHKIRNAADEMELYSVVSRRFKTVFNMQEQMRTFKVYDKIDSRTMGYG 1163
            +  T+++ +L A+SGGG   +++    PLH+ND+  L   L+YFC  YGI M++  IR++ADEMEL++V++R+F+ +F+ QE+M TFK YD   S +  +G
Sbjct:  407 LQPTKANFDL-ASSGGGIVTNDKVAAPPLHSNDLETLRPHLVYFCHAYGIQMNIQAIRSSADEMELFAVINRKFRQIFSRQEEMLTFKTYDSAKSASERWG 506          
BLAST of DUF4549 domain-containing protein vs. TrEMBL
Match: A0A4S2LFV1 (DUF4549 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007481 PE=4 SV=1)

HSP 1 Score: 621.698 bits (1602), Expect = 0.000e+0
Identity = 359/931 (38.56%), Postives = 554/931 (59.51%), Query Frame = 1
Query: 1012 IWMCTKFAMQLMKWSCIVLSADDLKPFSTCKNK*--------ELSKF----TIK*IQERWGMDSAMRALLKPANWKPFNKFTPKINLLEARYLNKLRDEEIKDEFLITASLFLKKSNAEETQMNLRHHALVIQHLPVVYNTAVVTNPKGFDIADILKTIYTKCDVNLRTFTTDDKPNNDSSGDHDNYNFTEALQLLGLDESIETKDDSSTVQGAYLSYLHLRFLKIRDMQRTCLSILNYFRSVERTLVIDEYQFTKESVRPVKKSNPASSQ-DLDSSNFDNLGN----HGYLQATVDDFKISIEDFMKTNEIENHDDFYLHENGRIHVQDLMGNWIMYDVALKDFEKLESDLILIGSYYITFDKEMRSSTLFNRKQSQSEHTEGSEFYILEYGHREVDRFGVLYDLWCQHTDFMEQKKKLFDLNMEVYNTVCKQEDRQHLAQTLINLMHHKPRIDLHSKYFLISYRYENMILERKFQIFKMILDKEISREREYLSKVYKDS---DYPYRHIPHLLIAPNSDECALQEVHFLEFLPSLSQVCQINKMIDYASLNIKNL-SSNTPVTSMLKKELDLLDTIYKEISEYEDITRQFTDPNLIKFLSQDSVICNPLIMEEIGRKYLKIIDSKNTRGEKKRRKIRCINEFSRLIELANIRFRLIHVLHETEYLHSIYDNQAITLGYDNFHLFMRQVPFERAVKTEGAEYYKPFLYXXXXXXXXXXXXKYRPEHPYPAIHELDNVHFGLFNLITINDIIQCLESKGLENLQVMLKVQFCHKNAVASGVLLCDYCRPSVYKSHKEKSLSHI--ESSLGQTVTTYNLPISAQSGPTPLALDSSRASIHALTDSYPEALFSLQLEKVPIRDKMLNNFLKKFPSPSTVSQVDMEKA---KRDCITFFTNAFYDRIAHIALKAQIIAYYNSIINTLNAVPEIV 3726
            ++ C  + +Q M    I  SAD+++ F+    K         E+  F    + K   ERWG+DS +RA+ KP+NW P+ K  PK +    +   +LR   + D+ L  ++ FLK  + E+ Q +LRHHA+++QH P+V++ +VV++ +G   A+I K IY   D   +     D+P        D+Y+FT+A+Q+LGLD++   KDD S+VQGAYLSYLHLR LK+RD+ RTC+S+LNYFRS+ERTL I++   +  S   V++++P + +   ++      GN    HGYL  +  +FKI   +FM+  EI+NHDDFY HE GRIHV+D +G WI+YD AL+DF KLE DL+L+ + +I  D+++R+S+   +K+   +  + S+  I  Y HR+VDRFGVLYD+W     F + K+KL D+ MEVY  +  ++ R+ LAQ + NLM+ +PR+DL+  YF+++YRYE  IL ++ +I + IL+ +I  +REYL K++ D      P   +    IA +SDE  L  V+ LEF PSLS    +   +D +   +  L + + P+  ++  E    D +  E+   + +   +T   L + L     + + + M E+  ++L  I ++N+RG+KK R++  +NE  RL++L  +R RLI  + E E L  IY   A  +G+D+FHLF+R + FE A   EGA+  +P +Y+++VQDDDS++DK+ P     AIHELD  H G F+      I++ LE++G+EN+  +LKVQ  HKNA+ + V+L    RPS Y  H  K+ + I   S+ G  + +Y      Q GPTPLAL+ S+  ++A  D +PEA FS+QLEK P RD+  N F+K+       S     ++   KR+ I+ F   F  R  HI+L+AQII+ Y+SI+  L  VP + 
Sbjct:  447 VYFCHAYGIQ-MNIQAIRSSADEMELFAVINRKFRQIFSRQEEMLTFKTYDSAKSASERWGLDSWVRAVRKPSNWLPYVKLRPKRHEYLVKLTMELRSGTVVDDLLKASANFLKVKSPEKVQDSLRHHAMLVQHPPIVHSASVVSHRQGQSTAEIFKKIYNNSDFFGKASADSDEPGKR----QDDYDFTQAMQMLGLDDATNAKDDPSSVQGAYLSYLHLRHLKLRDVMRTCISVLNYFRSIERTLTINDQGLSMNSRGGVERTSPPNHRVGTEAQGHKGGGNTIDGHGYLFNSPQEFKIKETEFMQFAEIDNHDDFYFHEEGRIHVRDQVGFWIIYDAALEDFNKLEQDLLLLATAFIQKDRQLRTSS-NTKKKGVDQEAQPSDLDIARYAHRDVDRFGVLYDIWINECAFQQAKQKLMDVYMEVYGHIISRDSRRRLAQIMTNLMYQRPRLDLNESYFVLAYRYECAILRQRTEIMRCILNHQILNQREYLKKIHVDKPEFGMPPPLLERFPIAVHSDETLLTPVYLLEFHPSLSCAPSLAAAMDRSVQQLYELFTPDQPMQEIVL-EKRFYDFLRYEVETLKPLGGSYT-AQLQRDLFSSYFVEDAIQMCELSNQHLAAIQNRNSRGDKKTRQMYLLNELGRLLDLVTLRHRLIDCMWECEVLSKIYLTVAHEMGFDDFHLFIRPLQFEAAKYKEGADDLRPPIYITAVQDDDSMLDKFLPSALPLAIHELDETHVGKFSFRGKVTIMEMLETRGVENMLTILKVQTAHKNALTASVMLAYNARPSFYSMHAPKTKTGILRPSNTGANLISYTGLSGTQVGPTPLALERSKHQLNA--DYHPEAFFSIQLEKSPSRDRTQNAFIKRTQGGGIASSKSSVESEKMKREFISQFCMDFGQRTQHISLRAQIISTYSSILTILEKVPTVT 1367          

HSP 2 Score: 372.089 bits (954), Expect = 0.000e+0
Identity = 296/1152 (25.69%), Postives = 519/1152 (45.05%), Query Frame = 2
Query: 3728 FFQFGKAFNPAKSTVDANCNLDKNPKKLHNRCRKVIDDDGQKLINIWYIPHFSEILFLYRQTEDAKANLILYNFLRLVMAFHDIIQYVVGFWKFGFNSTRV-PEKMKMKINK-----------------------IYNLPTDTNSQNIVHHLHCDEVA-----------------DLSY-------------FTDYNTTNTYQLRKEFVDLEIQIEHLPNPYDLEQVIDLLNIRRKYHFYYFEICATLLLKELFLSTDNIHCYKKLMNGIQSSIPTIRNVRYTKHISEGLCIPSLISETDPEIDKLFPWRSM--------MLKSGPVFINFD---C-----------------TMNIC--DYLQLCFICIPQKYRFLIYNQFYNLNLSLEDML-----------VEQETMTTNPS---------INNDNXXXXXXXXXXXXXXXXXXXXXATEHVKKDDLE--STIIEEKKSLSLRENPIQTYEHLLTFLYVLRQLYVLRDIYSFKVSQIKKIDSYESFLTVSKQYKLSILFPVLRKLSYDINVPNFYFYGPLKAEDVVTYPKGIPEVSIYNLLIKALINKIEKQQINLLRSKITQKIDHVIKQRHYESETIDME--KSPYLIFKNSLKNPNLVADLIKKFEAPFQLAXXXXXXXXXXXXXXXXXDGKENEKEIENDNLVYSKMYVNKCLQYLANTLLRIHRETYESFAMYFENLLKHQQQLLLFRNREYYGLKEEFHEKEQSLSVERQFILANKVSERILEINYLRGKVKEDKQNIQNKENTLRRQTSLSFKFLIRNLYNLGFEQMTRIKVSRFKLHCDVYQRINATRLNAFYEMNKIKERSGAKYTTDDEIALRNLILTKKMSDARAVNFSLFQFIARMKSLFNWIYNYTVCDWENMLNENMNRTDRVKGLVFLVTVNAQQKVKLIKCEFKRLKVIISDTEKELSELKNTLNKEITQQTQKRQKAKLKHLSLXXXXXXXXXXXSDLMNQLQEMNGQIATMKMKFESHIKNNKSVTVTSHNQVEKLSTILTDERRKKLNAFNKVDDLIAQVYEFEAGFA------MVNTQSEASRGRVEKNYKARLLQTKTKKVDLRGNYPDLILHQRQLTYDAIIKRHCIPYTPCHFLPFRRDRVEAHRMKMRIQNRLIK 6841
            FF  G AF       D +  +  +P+ L  R R+V+  DG KL N W+IPHF E+LF++R  +D      L    RL    HDI+ Y++ + + G +S ++ PE+ +  I                           N+   T+++  V  L                       DLS               +D++      L  E  +++ QI  LP+P D EQVI +L +RR   F  F++C   +L+E FL+  N+  YK+++      +  + +V+     +  + +P  +   D +   +FPWRS+        +   GP  I ++   C                  MN+C  D L +  I   +    +   Q  N++  L                   T T  P+          N  N        ++     E     ++ H         +T  ++   LS  ++P+  Y  L  FL + +++ +L+  +  +   ++ I++   F T    YK   L+P++R L+     P+ Y  GPL A D++  PKGIPE+ +    +  LI   E   I  LR  + ++ D VIK+R+ E   + +E  K P +    S+K P L  + + +  +                           EK  +ND    +K  +N+ LQ +A +++R  RE+YE+++MY+ENLLK+Q  LL  + RE   LKE   + E   +V  QF ++ +    +LE+  LR K+ E ++     E+ +R +    F   +R L+ L FEQ +RI   R  LH    QRI   R  A  EM +IKERSGA+ + +DE+A RNL L+++++     N +L Q ++R++ + +W      C +E  ++    + ++ K  V  + + ++Q+V+++  E  +L+  +S+TEK L++++  L+KE++ + +KR  A+ K  + K+  + KQ  I  LM ++ E N  +  M    ++  K+ K     S  +V+ L   L +ER+ K +A +KVDDL++Q+YEFE  ++       VN  +   +G       AR L  +                QR +TY+ ++ +   PYT  H+L FR++     +++ R+  +++K
Sbjct: 1370 FFVIGYAFEKKNPEDDLDVQV-TDPRTLRTRPRRVLSTDGTKLYNFWFIPHFIEVLFIFRHLDDLSCTKALQRMARLACVLHDILHYLIAYARLGISSAKITPEQRQQVIAGSQKHGGQQWRTAIRGALPTAAEVASNIAGTTSAETFVAQLSSAGTIPSMNMALSSPALSVTPLDLSVHGRSLVVDQIIEDLSDFDGGPMSMLATELREIQYQINRLPDPTDPEQVIQMLELRRDVMFLQFDVCMRTILRETFLAAGNVEAYKEVVENSHFPLSELSDVQRPCLNAIEMNVPEPLEARDDQAKAIFPWRSLMNSCGPFLLFCFGPSTIEYNIRLCLAGLKPVDRPTVHGELLAMNLCLEDVLDVGDIPEAKAGEPMPIQQAENMHCMLGKRTRDRRREIPPPNAASPTGTGGPASTPGSVAGTTNPVNATGTSINTINITHSSETQGQKSSTHGGAGGTGPLTTTADKTPKLSTLDSPVAAYTLLKKFLILWKRVELLKYAWGRRRLGVEAINNPNLFKTFCSIYKREKLYPLIRSLAIQYRQPDMYALGPLDATDIIVMPKGIPEMVVRQRQLLKLIEAFEFYMIADLRKLLVRQTDLVIKERNREEGNLPLELWKRPAMKETLSVKRPGLADEFLVELMSHL-------------------------EKNAKNDTYTITKDKLNEVLQTVAISVMRTQRESYENYSMYYENLLKNQHSLLYAKEREIETLKETLRQNELETNVTVQFQMSEQAHNLLLEVTALRAKIAELEEINLKTESKVRNRVRREFSVAMRKLFGLSFEQKSRIDQYRDHLHAITLQRIAEVREEASAEMARIKERSGARASAEDELAERNLRLSREVNTLHQRNIALQQMMSRLRVMAHWQQTTLRCAFEKQISGVEEQRNQSKSQVTRLGILSEQRVRMLNEEMSKLRDHLSNTEKHLNDMRKALDKEMSDKVEKRHAAERKAATDKQMAMVKQMHIDQLMAEIAEKNATLEKMGSLLDASAKSKKQEADKSVREVDLLRKQLREERKLKKSAIHKVDDLMSQLYEFETAYSSGQNRPGVNLPTMTPKGEAAAG-GARKLSAEI---------------QRPVTYEDLVAKKSGPYTSKHYLRFRQETARVPQLRERLVQQILK 2479          

HSP 3 Score: 150.984 bits (380), Expect = 2.950e-32
Identity = 72/201 (35.82%), Postives = 133/201 (66.17%), Query Frame = 3
Query:  120 LKMDVVELKAQIEENQLIYGLNNKDPSSIYTPKDPEFYXXXXXXXXXXQIDGQCTHTGKIVADTIKLEIECCEKFEYRDKSLLLLVYQYFKNRMKVLVNMKRSQMLRYKRYCINKTLTEFIKEHYNARLNAINTEYNDVRARYNRLKAAQEGFICNSDQGLEEITMDDIFIYMKWLIQHMYNMEYITTMVKIIRWIPIKYR 722
            L+ D++EL+AQIEEN+LI+G+ +K  SS+Y PKDP+++ ++R+L L+R +         + A+ +  E++ C + E+ +++L +L++QYF +R+  +V +K   +LR+KRYC +    E I+  Y  RL  +  EY D  +R +RL + +EG + NSD G+E++T++D  IY+++ + H+ ++ Y   ++ II+W+P  +R
Sbjct:   15 LRSDILELRAQIEENELIHGIPSKGMSSVYIPKDPDYFRRERKLILQRTLQVLEPQPIMLQAELMMQELDACNQREFTERTLPILLHQYFIDRIHQIVLLKHGYLLRWKRYCSSTAAVETIQSEYLNRLEYLTNEYLDASSRAHRLASTREGILANSDNGVEDVTVEDYQIYLRYHLSHLQSLSYTNQLLNIIKWLPYSHR 215          

HSP 4 Score: 100.908 bits (250), Expect = 4.027e-17
Identity = 43/101 (42.57%), Postives = 70/101 (69.31%), Query Frame = 3
Query:  861 ISNTRSDINLSAASGGGYAVDERNLLFPLHTNDMHYLEHLLIYFCEVYGINMDVHKIRNAADEMELYSVVSRRFKTVFNMQEQMRTFKVYDKIDSRTMGYG 1163
            +  T+++ +L A+SGGG   +++    PLH+ND+  L   L+YFC  YGI M++  IR++ADEMEL++V++R+F+ +F+ QE+M TFK YD   S +  +G
Sbjct:  407 LQPTKANFDL-ASSGGGIVTNDKVAAPPLHSNDLETLRPHLVYFCHAYGIQMNIQAIRSSADEMELFAVINRKFRQIFSRQEEMLTFKTYDSAKSASERWG 506          
BLAST of DUF4549 domain-containing protein vs. TrEMBL
Match: A0A504Y5J3 (Coiled-coil domain-containing protein OS=Fasciola gigantica OX=46835 GN=FGIG_05483 PE=4 SV=1)

HSP 1 Score: 621.313 bits (1601), Expect = 0.000e+0
Identity = 357/930 (38.39%), Postives = 549/930 (59.03%), Query Frame = 1
Query: 1012 IWMCTKFAMQLMKWSCIVLSADDLKPFSTCKNK*--------ELSKF----TIK*IQERWGMDSAMRALLKPANWKPFNKFTPKINLLEARYLNKLRDEEIKDEFLITASLFLKKSNAEETQMNLRHHALVIQHLPVVYNTAVVTNPKGFDIADILKTIYTKCDVNLRTFTTDDKPNNDSSGDHDNYNFTEALQLLGLDESIETKDDSSTVQGAYLSYLHLRFLKIRDMQRTCLSILNYFRSVERTLVIDEYQFTKESVRPVKKSNPASSQ-DLDSSNFDNLGN----HGYLQATVDDFKISIEDFMKTNEIENHDDFYLHENGRIHVQDLMGNWIMYDVALKDFEKLESDLILIGSYYITFDKEMRSSTLFNRKQSQSEHTEGSEFYILEYGHREVDRFGVLYDLWCQHTDFMEQKKKLFDLNMEVYNTVCKQEDRQHLAQTLINLMHHKPRIDLHSKYFLISYRYENMILERKFQIFKMILDKEISREREYLSKVYKDS---DYPYRHIPHLLIAPNSDECALQEVHFLEFLPSLSQVCQINKMIDYASLNIKNLSSNTPVTSMLKKELDLLDTIYKEISEYEDITRQFTDPNLIKFLSQDSVICNPLIMEEIGRKYLKIIDSKNTRGEKKRRKIRCINEFSRLIELANIRFRLIHVLHETEYLHSIYDNQAITLGYDNFHLFMRQVPFERAVKTEGAEYYKPFLYXXXXXXXXXXXXKYRPEHPYPAIHELDNVHFGLFNLITINDIIQCLESKGLENLQVMLKVQFCHKNAVASGVLLCDYCRPSVYKSHKEKSLSHI--ESSLGQTVTTYNLPISAQSGPTPLALDSSRASIHALTDSYPEALFSLQLEKVPIRDKMLNNFLKKFPSPSTVSQVDMEKA---KRDCITFFTNAFYDRIAHIALKAQIIAYYNSIINTLNAVPEIV 3726
            +  C  + +Q M    I  SAD+++ FS    K         E+  F    + +   ERWG+D   RA+ KP+NW PF +  P+ N    R +  LR + + D+ L  A+ FL   + E  Q +LRHHA+++QH P+++  +V+++ +G   ADI K IYT  D+  +T    D+P        + Y+FT+A+Q+LGLD++   KDD S+VQGAYLS+LHLR LK+RD+ RTCLS+LNYFRSVERTL I++   +  S   V++++P + +   ++      GN    HGYL  T  +FKI   +FM+ +E++NHDDFY HE GR+HV+D +G WI+Y+ AL DFE+LE D++L+ + +I  D   R ++ F RK + +E  + ++  I  Y HREVDRFGVLYD+W   T F E KK+L D+ MEVY  +  ++ R+ LAQ + +LM+ + R+DL+  YF+ +YRYE  IL ++ +  + IL+ +I  +REYL K+  +      P   I    IAPNSDE  L  V+ LEF PSL+    + + +D++   + +L +       +  E    D +  E+   + +   +T P L + L     I + + M E+  ++L  I  +N+RG+KK R++  +NE  RL++L ++R RL+  + E E L  IY N A  +G+D+FHLF+R + FE A   EGA+ ++P +Y++++QDDDS +DK+ P     AIHELD  H G F+      I++ LE++G+ENL  +LK Q  HKN + + VLL    RPS Y +H  K+ + +   SS G  + +Y      Q GPTPLAL+ S+  ++A  + +PEA FS+QLEK P RD+M N+F+K+       S     ++   KR+ I+ F   F +R    +L+AQII+ Y+SI+  L  VP + 
Sbjct:  463 VHFCHAYNVQ-MNIQAIRSSADEMELFSVINRKFRHIFNRQEEMRTFKAYDSSRSGSERWGLDLWTRAVKKPSNWLPFVQLRPRRNEYLVRVIMDLRCKNVVDDLLRAAANFLLIKSPERVQDSLRHHAMLVQHPPMIHAASVISHRQGQSTADIFKKIYTNPDLYGQTSNDLDEPGKK----QNEYDFTQAMQMLGLDDAANAKDDPSSVQGAYLSFLHLRHLKLRDVMRTCLSVLNYFRSVERTLTINDQGLSMSSRGSVERTSPPNHRMGTETQGLQGGGNILDGHGYLFNTPHEFKIMETEFMQFSEVDNHDDFYFHEEGRVHVRDQIGFWIVYESALDDFERLEQDMLLLATAFIQKDTGTRGASNFKRKHASTEQGQANDIDIAMYSHREVDRFGVLYDMWINETAFQEAKKRLMDVYMEVYGHIVSRDSRRRLAQVMTDLMYQRARLDLNENYFVQAYRYECAILRQRTEAMRCILNHQIINQREYLKKIQPEKPEFGLPPPLIERFPIAPNSDETFLTPVYVLEFHPSLACTPSLAEAMDHSVRLVYDLFTPAHPMQEIILEKRYYDFLRYEVDTLKPLGASYT-PQLQRDLFSSYFIEDAMQMCELSNQHLAAIQQRNSRGDKKTRQMYLLNELGRLLDLISLRHRLMDCMWECEVLSKIYLNFANEMGFDDFHLFIRPLQFEAAKYKEGADEFRPPIYITAIQDDDSSLDKFLPSALPLAIHELDETHVGKFSFRGKVTIMEMLETRGVENLLTILKTQIAHKNGLTAAVLLAYNARPSFYTAHAPKAKNGVMRPSSTGANLISYTGLSGTQVGPTPLALERSKHQLNA--EYHPEAFFSIQLEKSPSRDRMQNSFIKRTQGGGIASSKSSIESEKMKREFISQFCADFGERAQQASLRAQIISTYSSILTILEKVPTVT 1384          

HSP 2 Score: 117.857 bits (294), Expect = 0.000e+0
Identity = 96/369 (26.02%), Postives = 153/369 (41.46%), Query Frame = 2
Query: 3728 FFQFGKAFNPAKSTVDANCNLDKNPKKLHNRCRKVIDDDGQKLINIWYIPHFSEILFLYRQTED----------AKANLILYNFLRLVMAFHDI------------IQYVVGFWKFGFNSTRVPEK------------------------------------MKMKINKIYNLPTDTNSQNIVHHLHCDEVA-DLSYFTDYNTTNTYQLRKEFVDLEIQIEHLPNPYDLEQVIDLLNIRRKYHFYYFEICATLLLKELFLSTDNIHCYKKLMNGIQSSIPTIRNVRYTKHISEGLCIPSLISETDPEIDKLFPWRSMMLKSGPVFINFDCTMNICDY-LQLCFICIPQKYRFLIYNQFYNLNLSLEDML 4654
            FF  G AF       D +   + +P+ L  R R+V+  DG KL N+W+IPHF E+LF++R  +D          A+   +L++ L  ++A+  +            +Q + G  +      R   +                                    M +    +   P   N+    H L  D+V  DLS   D++      L  E  +++ QI  LP+P + EQVI LL  RR   F  F++C   +L E FL+  N   Y+ L       +  + NV+     +  L +P  +   D     LFPWRS++   GP F+ F       +Y ++LC   +    R  ++ +   LNLSLED+L
Sbjct: 1387 FFVLGYAFEKKSPEDDLDVQ-ETDPRSLRARPRRVLSTDGTKLYNLWFIPHFIEVLFIFRHLDDESCTRALRCMARLACVLHDILHYLIAYARLGISSAKITPEQRLQIIAGSKQSASAQKRTGSRTTLPSASDAATAVAGAAVYSTAVAQLVNAGTIGGMNMTLSAPAMSVTPLGLNAHG--HSLVVDQVVEDLS---DFDGGPMSTLATELREIQYQINRLPDPAEPEQVISLLCQRRDCMFLQFDVCLRSVLGETFLAAGNQEAYQVLKENSHFPLAELSNVQRPCLTAIDLNVPEPMEARDDMAQNLFPWRSLVNYYGP-FLLFSFGPCSIEYNIRLCLAGLKPVDRPTVHGELLALNLSLEDVL 1748          

HSP 3 Score: 158.688 bits (400), Expect = 1.147e-34
Identity = 94/288 (32.64%), Postives = 164/288 (56.94%), Query Frame = 3
Query:  120 LKMDVVELKAQIEENQLIYGLNNKDPSSIYTPKDPEFYXXXXXXXXXXQIDGQCTHTGKIVADTIKLEIECCEKFEYRDKSLLLLVYQYFKNRMKVLVNMKRSQMLRYKRYCINKTLTEFIKEHYNARLNAINTEYNDVRARYNRLKAAQEGFICNSDQGLEEITMDDIFIYMKWLIQHMYNMEYITTMVKIIRWIPIKYR---KNNAAKA-----ENDTDSFNKSESTYKYIRSTTSILQNRESSLTARHSQ------------------RTISNTRSDINLSAASG 905
            L+ D++ELK+QIEEN+LI+G+ +K  SSIY PKDP+F+ ++R+L L+R +         + AD +  E+E C+K EY +++L +L++QYF +RM   V +K   +LR+KR+C +    E I   Y  +L  +  EY D  +R +RL + +EG + NSD G+E++T+DD  I++++ I H+ ++ Y   ++ II+W P  +R   K+  AK       +++ S    +++ +     ++ ++N +  L    +Q                  RTI+++ SD   SAA G
Sbjct:   15 LRADILELKSQIEENELIHGIPSKGMSSIYIPKDPDFFRRERKLILQRTLQVLEPRPNILQADLMSKELEACDKREYTERTLPILLHQYFLDRMHQTVLLKHGYLLRWKRFCSSTAAVESIHGEYLNQLEHLTEEYLDSSSRAHRLASTREGILSNSDHGVEDVTVDDFQIFLRYFICHLQSLSYTNQLLNIIKWFPYSHRDKIKDGIAKQYPYTMGDESLSGTGKDASDQNAGQDSTPVENAKPGLGTNLTQSYSGAEEDTNIPAQTDHARTINHSSSDRQDSAAPG 302          

HSP 4 Score: 106.301 bits (264), Expect = 1.015e-18
Identity = 48/98 (48.98%), Postives = 70/98 (71.43%), Query Frame = 3
Query:  870 TRSDINLSAASGGGYAVDERNLLFPLHTNDMHYLEHLLIYFCEVYGINMDVHKIRNAADEMELYSVVSRRFKTVFNMQEQMRTFKVYDKIDSRTMGYG 1163
            T ++INL AASGGG   +E++   PLHTND+  L   L++FC  Y + M++  IR++ADEMEL+SV++R+F+ +FN QE+MRTFK YD   S +  +G
Sbjct:  426 TAANINL-AASGGGIVTNEKSNGLPLHTNDLETLRPHLVHFCHAYNVQMNIQAIRSSADEMELFSVINRKFRHIFNRQEEMRTFKAYDSSRSGSERWG 522          

HSP 5 Score: 98.9821 bits (245), Expect = 1.579e-16
Identity = 70/218 (32.11%), Postives = 104/218 (47.71%), Query Frame = 2
Query: 4931 SQIKKIDSYESFLTVSKQYKLSILFPVLRKLSYDINVPNFYFYGPLKAEDVVTYPKGIPEVSIYNLLIKALINKIEKQQINLLRSKITQKIDHVIKQRHYESE--TIDMEKSPYLIFKNSLKNPNLVADLIKKFEAPFQLAXXXXXXXXXXXXXXXXXDGKENEKEIENDNLVYSKMYVNKCLQYLANTLLRIHRETYESFAMYFENLLKHQQQLLLF 5578
            S    I S   F+  S  YK   L+P+LR L+      + Y  GPL   D+   PKGIPE+ +    +  LI   E   I  LR  + ++ D VIK+R+ E     +D+ K P +    S K P L  + I    +  QL                  D + N+  I  D L       N+ LQ +A +++R+ RE+YE+++MY+ENLLK+QQQ  L+
Sbjct: 1866 SLTSPIRSKHCFVFSSNLYKREKLYPLLRSLAIQYRQHDMYSMGPLDETDIFVMPKGIPEMVVRQRQLLKLIEAFEFYMIADLRKLVVRQTDMVIKERNREEGNLPLDLWKRPAMKEAMSFKRPALADEFIVDLMSNMQL------------------DERSNQYSISKDKL-------NEVLQTMAISVMRVQRESYENYSMYYENLLKNQQQAFLY 2058          
BLAST of DUF4549 domain-containing protein vs. TrEMBL
Match: A0A074ZYC6 (DUF4549 domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_02675 PE=4 SV=1)

HSP 1 Score: 620.928 bits (1600), Expect = 0.000e+0
Identity = 358/931 (38.45%), Postives = 554/931 (59.51%), Query Frame = 1
Query: 1012 IWMCTKFAMQLMKWSCIVLSADDLKPFSTCKNK*--------ELSKF----TIK*IQERWGMDSAMRALLKPANWKPFNKFTPKINLLEARYLNKLRDEEIKDEFLITASLFLKKSNAEETQMNLRHHALVIQHLPVVYNTAVVTNPKGFDIADILKTIYTKCDVNLRTFTTDDKPNNDSSGDHDNYNFTEALQLLGLDESIETKDDSSTVQGAYLSYLHLRFLKIRDMQRTCLSILNYFRSVERTLVIDEYQFTKESVRPVKKSNPASSQ-DLDSSNFDNLGN----HGYLQATVDDFKISIEDFMKTNEIENHDDFYLHENGRIHVQDLMGNWIMYDVALKDFEKLESDLILIGSYYITFDKEMRSSTLFNRKQSQSEHTEGSEFYILEYGHREVDRFGVLYDLWCQHTDFMEQKKKLFDLNMEVYNTVCKQEDRQHLAQTLINLMHHKPRIDLHSKYFLISYRYENMILERKFQIFKMILDKEISREREYLSKVYKDS---DYPYRHIPHLLIAPNSDECALQEVHFLEFLPSLSQVCQINKMIDYASLNIKNL-SSNTPVTSMLKKELDLLDTIYKEISEYEDITRQFTDPNLIKFLSQDSVICNPLIMEEIGRKYLKIIDSKNTRGEKKRRKIRCINEFSRLIELANIRFRLIHVLHETEYLHSIYDNQAITLGYDNFHLFMRQVPFERAVKTEGAEYYKPFLYXXXXXXXXXXXXKYRPEHPYPAIHELDNVHFGLFNLITINDIIQCLESKGLENLQVMLKVQFCHKNAVASGVLLCDYCRPSVYKSHKEKSLSHI--ESSLGQTVTTYNLPISAQSGPTPLALDSSRASIHALTDSYPEALFSLQLEKVPIRDKMLNNFLKKFPSPSTVSQVDMEKA---KRDCITFFTNAFYDRIAHIALKAQIIAYYNSIINTLNAVPEIV 3726
            ++ C  + +Q M    I  SAD+++ F+    K         E+  F    + K   ERWG+DS +RA+ KP+NW P+ K  P+ +    +   +LR   + D+ L  ++ FLK  + E+ Q +LRHHA+++QH P+V++ +VV++ +G   A+I K IY   DV  +     D+P        D+Y+FT+A+Q+LGLD++   KDD S+VQGAYLSYLHLR LK+RD+ RTC+S+LNYFRS+ERTL I++   +  S   V++++P + +   ++      GN    HGYL  +  +FKI   +FM+  E++NHDDFY HE GRIHV+D +G WI+YD AL+DF KLE DL+L+ + +I  D++ R S+   +K+  ++  + S+  I  Y HR+VDRFGVLYD+W     F + K+KL D+ MEVY  +  ++ R+ LAQ + NLM+ +PR+DL+  YF+++YRYE  IL ++ +I + IL+ +I  +REYL K++ +      P   +    IA +SDE  L  V+ LEF PSLS    +   +D +   +  L + N P+  ++  E    D +  E+   + +   +T   L + L     + + + M E+  ++L  I ++N+RG+KK R++  +NE  RL++L  +R RLI  + E E L  IY   A  +G+D+FHLF+R + FE A   EGA+  +P +Y+++VQDDDS++DK+ P     AIHELD  H G F+      I++ LE++G+EN+  +LKVQ  HKNA+ + V+L    RPS Y  H  K+ + I   S+ G  + +Y      Q GPTPLAL+ S+  ++A  D +PEA FS+QLEK P RD+  N F+K+       S     ++   KR+ I+ F   F  R  HI+L+AQII+ Y+SI+  L  VP + 
Sbjct:  430 VYFCHAYGIQ-MNIQAIRSSADEMELFAVINRKFRQIFSRQEEMLTFKTYDSAKSASERWGLDSWVRAVRKPSNWLPYVKLRPRRHEYLVKLTMELRSGTVVDDLLKASANFLKMKSPEKVQDSLRHHAMLVQHPPIVHSASVVSHRQGQSTAEIFKKIYNNSDVFGKASADTDEPGKR----QDDYDFTQAMQMLGLDDATNAKDDPSSVQGAYLSYLHLRHLKLRDVMRTCISVLNYFRSIERTLTINDQGLSMNSRGGVERTSPPNHRVGTEAQGHKGGGNTIDGHGYLFNSPQEFKIKETEFMQFAEVDNHDDFYFHEEGRIHVRDQVGFWIVYDAALEDFNKLEQDLLLLATAFIQRDRQSRMSS-NTKKKGVNQEAQSSDLDIARYAHRDVDRFGVLYDIWINECAFQQAKQKLMDVYMEVYGHIISRDSRRRLAQIMTNLMYQRPRLDLNESYFVLAYRYECAILRQRTEIMRCILNHQILNQREYLKKIHVEKPEFGLPPPLLERFPIAVHSDETLLTPVYLLEFHPSLSCAPSLAAAMDQSVQQLYELFTPNHPMQEIVL-EKRFYDFLRYEVETLKPLGGSYT-AQLQRDLFSSYFVEDAIQMCELSNQHLAAIQNRNSRGDKKTRQMYLLNELGRLLDLVTLRHRLIDCMWECEVLSKIYLTVAHEMGFDDFHLFIRPLQFEAAKYKEGADDLRPPIYITAVQDDDSMLDKFLPSALPLAIHELDETHVGKFSFRGKVTIMEMLETRGVENMLTILKVQTAHKNALTASVMLAYNARPSFYTMHAPKTKTGILRPSNTGANLISYTGLSGTQVGPTPLALERSKHQLNA--DYHPEAFFSIQLEKSPSRDRTQNAFIKRTQGGGIASSKSSVESEKMKREFISQFCMDFGQRTQHISLRAQIISTYSSILTILEKVPTVT 1350          

HSP 2 Score: 359.762 bits (922), Expect = 0.000e+0
Identity = 304/1159 (26.23%), Postives = 525/1159 (45.30%), Query Frame = 2
Query: 3728 FFQFGKAFNPAKSTVDANCNLDKNPKKLHNRCRKVIDDDGQKLINIWYIPHFSEILFLYRQTEDAKANLILYNFLRLVMAFHDIIQYVVGFWKFGFNSTRV-PEKMKMKINKIYN-------------LPTDTN-SQNIVHHLHCDE-VADLSYFTDYNTTN---------------TYQLRKEFVD---------LEIQIEHLPNPYDLEQVIDLLNIRRKYHFYYFEICATLLLKELFLSTDNIHCYKKLMNGIQSSIPTIRNVRYTKHISEGLCIPSLISETDPEIDKLFPWRSMMLKSG--------PVFINFD---C-----------------TMNIC--DYLQLCFICIPQKYRFLIYNQFYNLNLSLEDML-----------VEQETMTTNPS---------INNDNXXXXXXXXXXXXXXXXXXXXXATEHVKKDDLE--STIIEEKKSLSLRENPIQTYEHLLTFLYVLRQLYVLRDIYSFKVSQIKKIDSYESFLTVSKQYKLSILFPVLRKLSYDINVPNFYFYGPLKAEDVVTYPKGIPEVSIYNLLIKALINKIEKQQINLLRSKITQKIDHVIKQRHYESETIDME--KSPYL-------------IFKNSLKNPNLVADLIKKFEA--PFQLAXXXXXXXXXXXXXXXXXDG------KENEKEIENDNLVYSKMYVNKCLQYLANTLLRIHRETYESFAMYFENLLKHQQQLLLFRNREYYGLKEEFHEKEQSLSVERQFILANKVSERILEINYLRGKVKEDKQNIQNKENTLRRQTSLSFKFLIRNLYNLGFEQMTRIKVSRFKLHCDVYQRINATRLNAFYEMNKIKERSGAKYTTDDEIALRNLILTKKMSDARAVNFSLFQFIARMKSLFNWIYNYTVCDWENMLNENMNRTDRVKGLVFLVTVNAQQKVKLIKCEFKRLKVIISDTEKELSELKNTLNKEITQQTQKRQKAKLKHLSLXXXXXXXXXXXSDLMNQLQEMNGQIATMKMKFESHIKNNKSVTVTSHNQVEKLSTILTDERRKKLNAFNKVDDLIAQVYEFEAGFAM------VNTQSEASRGRVEKNYKARLLQTKTKKVDLRGNYPDLILHQRQLTYDAIIKRHCIPYTPCHFLPFRRDRVEAHRMKMRIQNRLIK 6841
            FF  G AF       D +  +  +P+ L  R R+V+  DG KL N W+IPHF E+LF++R  +D      L    RL    HDI+ Y++ + + G +S ++ PE+ +  I                  LPT    + NI      +  VA LS      + N               +   R   VD         ++ QI  LP+P D EQVI +L++RR   F  F++C   +L+E FL+  N+  YK+++      +  + +V+     +  + +P  +   D +   LFPWRS+M + G        P  I ++   C                  MN+C  D L +  I   +    +   Q  N++  L                   T T  P+          N  N        M+     E     ++ H         +T  ++   LS  ++P+  Y  L  FL + +++ +L+  +  +   ++ I++   F T    YK   L+P++R L+     P+ Y  GPL A D++  PKGIPE+ +    +  LI   E   I  LR  + ++ D VIK+R+ E   + +E  K P L             + K  L+  +LV     + E   P +L ++   ++    K     D          E+   ND  + +K  +N+ LQ +A +++R  RE+YE+++MY+ENLLK+Q  LL  + RE   LKE   + E   +V  QF ++ +    +LE+  LR K+ E +      E  +R +    F   +R L+ L FEQ +RI   R  LH    QRI   R  A  EM +IKERSGA+ + +DE+A RNL L+++++     N  L Q ++R++ + +W      C +E  ++    + ++ K  V  + + ++Q+V+++  E  +L+  +S+TEK L++++  L+KE++ + +KR  A+ K  + K+  + KQ  I  LM ++ E N  +  M    ++  K+ K     S  +V+ L   L +ER+ K +A +KVDDL++Q+YEFE  ++       VN  + A +G       AR L  + ++                  Y+ ++ +   PYT  H+L FR++     +++ R+  ++++
Sbjct: 1353 FFVIGYAFEKKNPEDDLDVQV-TDPRTLRTRPRRVLSTDGTKLYNFWFIPHFIEVLFIFRHLDDLSCTKALQRMARLACVLHDILHYLIAYARLGISSAKITPEQRQQVIAGSQKHGGQQWRTATRGALPTAAEVAANIAGTTSAETFVAQLSSAGTIPSMNMALSSPALSVTPLDLSVHGRSLVVDQIIATELREIQYQINRLPDPTDPEQVIQMLDLRRDVMFLQFDVCMRTILRETFLAAGNVEAYKEVVENSHFPLSELSDVQRPCLNAIEMNVPEPLEARDDQAKALFPWRSLMNRCGPFLLFCFGPSTIEYNIHLCMAGLKPVDRPTVHGELLAMNLCLEDVLDVGDIPEAKAGEPMPIQQAENMHCMLGKRTRDRRREIPPPNAASPTGTGGPASTPGSVAGTTNPANATGTSINTMNITHSSETQGQKSSTHGGAGGTGPLTTTPDKTPKLSTLDSPVAAYTLLKKFLILWKRVELLKYAWGRRRLGVESINNPNLFKTFCSIYKREKLYPLIRSLAIQYRQPDMYALGPLDATDIIVMPKGIPEMVVRQRQLLKLIEAFEFYMIADLRKLLLRQTDLVIKERNREEGNLPLELWKRPLLKLIEAFEFYMIADLRKLLLRQTDLVIKERNREEGNLPLELWKRPAMKETLSVKRPGLADEFLVELMSHLEQNARNDTYIITKDKLNEVLQTVAISVMRTQRESYENYSMYYENLLKNQHSLLYAKEREIETLKETLRQNELETNVTVQFQMSEQAHNLLLEVTALRAKIAELEDINLKTEAKVRNRVRREFSVAMRKLFGLSFEQKSRIDQYRDHLHAITLQRIAEVREEASAEMARIKERSGARASAEDELAERNLRLSREVNTLHQRNIGLQQMMSRLRVMAHWQQTTLRCAFEKQISGVEEQRNQSKSQVTRLGILSEQRVRMLNEEMSKLRDHLSNTEKHLNDMRKALDKEMSDKVEKRHAAERKAATDKQMAMVKQMHIDQLMAEIAEKNATLEKMGSLLDASAKSKKQEADKSVREVDLLRKQLREERKLKKSAIHKVDDLMSQLYEFETAYSSGQNRPGVNLPTVAPKGEATAG-GARKLSAEIQR-----------------PYEDLVAKKSGPYTSKHYLRFRQETTRVPQLRERLAQQILR 2492          

HSP 3 Score: 134.806 bits (338), Expect = 2.586e-27
Identity = 67/190 (35.26%), Postives = 124/190 (65.26%), Query Frame = 3
Query:  120 LKMDVVELKAQIEENQLIYGLNNKDPSSIYTPKDPEFYXXXXXXXXXXQIDGQCTHTGKIVADTIKLEIECCEKFEYRDKSLLLLVYQYFKNRMKVLVNMKRSQMLRYKRYCINKTLTEFIKEHYNARLNAINTEYNDVRARYNRLKAAQEGFICNSDQGLEEITMDDIFIYMKWLIQHMYNMEYITTMV 689
            L+ D++EL+AQIEEN+LI+G+ +K  SS+Y PKDP+++ ++R+L L+R +         + A+ +  E++ C + E+ +K+L +L++QYF +R+  +V +K   +LR+KRYC +    E I+  Y  RL  +  EY D  +R +RL + +EG + NSD G+E++T++D  IY+++ +  + ++ Y   ++
Sbjct:   15 LRSDILELRAQIEENELIHGIPSKGMSSVYIPKDPDYFRRERKLILQRTLQVLEPKPITLQAELMMQELDACSQREFTEKTLPILLHQYFIDRIHQIVLLKHGYLLRWKRYCSSTAAVETIQSEYLNRLEYLTNEYLDASSRAHRLASTREGILANSDNGVEDVTVEDYQIYLRYHLSQLQSLSYANQLL 204          

HSP 4 Score: 102.064 bits (253), Expect = 2.183e-17
Identity = 43/101 (42.57%), Postives = 71/101 (70.30%), Query Frame = 3
Query:  861 ISNTRSDINLSAASGGGYAVDERNLLFPLHTNDMHYLEHLLIYFCEVYGINMDVHKIRNAADEMELYSVVSRRFKTVFNMQEQMRTFKVYDKIDSRTMGYG 1163
            +  T+++++L A+SGGG   +++    PLH+ND+  L   L+YFC  YGI M++  IR++ADEMEL++V++R+F+ +F+ QE+M TFK YD   S +  +G
Sbjct:  390 LQPTKANLDL-ASSGGGIVTNDKVAAPPLHSNDLETLRPHLVYFCHAYGIQMNIQAIRSSADEMELFAVINRKFRQIFSRQEEMLTFKTYDSAKSASERWG 489          
BLAST of DUF4549 domain-containing protein vs. TrEMBL
Match: A0A1S8X970 (DUF4549 domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=X801_00873 PE=4 SV=1)

HSP 1 Score: 611.683 bits (1576), Expect = 0.000e+0
Identity = 360/959 (37.54%), Postives = 554/959 (57.77%), Query Frame = 1
Query: 1012 IWMCTKFAMQLMKWSCIVLSADDLKPFSTCKNK*--------ELSKF----TIK*IQERWGMDSAMRALLKPANWKPFNKFTPKINLLEARYLNKLRDEEIKDEFLITASLFLKKSNAEETQMNLRHHALVIQHLPVVYNTAVVTNPKGFDIADILKTIYTKCDVNLRTFTTDDKPNNDSSGDHDNYNFTEALQLLGLDESIETKDDSSTVQGAYLSYLHLRFLKIRDMQRTCLSILNYFRSVERTLVIDEYQFTKESVRPVKKSNPASSQ-DLDSSNFDNLGN----HGYLQATVDDFKISIEDFMKTNEIENHDDFYLHENGRIHVQDLMGNWIMYDVALKDFEKLESDLILIGSYYITFDKEMRSSTLFNRKQSQSEHTEGSEFYILEYGHREVDRFGVLYDLWCQHTDFMEQKKKLFDLNMEVYNTVCKQEDRQHLAQTLINLMHHKPRIDLHSKYFLISYRYENMILERKFQIFKMILDKEISREREYLSKVYKDS---DYPYRHIPHLLIAPNSDECALQEVHFLEFLPSLSQVCQINKMIDYASLNIKNL-SSNTPVTSMLKKELDLLDTIYKEISEYEDI----TRQFTDPNLIKFLSQDSVIC------------------------NPLIMEEIGRKYLKIIDSKNTRGEKKRRKIRCINEFSRLIELANIRFRLIHVLHETEYLHSIYDNQAITLGYDNFHLFMRQVPFERAVKTEGAEYYKPFLYXXXXXXXXXXXXKYRPEHPYPAIHELDNVHFGLFNLITINDIIQCLESKGLENLQVMLKVQFCHKNAVASGVLLCDYCRPSVYKSHKEKSLSHI--ESSLGQTVTTYNLPISAQSGPTPLALDSSRASIHALTDSYPEALFSLQLEKVPIRDKMLNNFLKKFPSPSTVSQVDMEKA---KRDCITFFTNAFYDRIAHIALKAQIIAYYNSIINTLNAVPEIV 3726
            ++ C  + +Q M    I  SAD+++ F+    K         E+  F    + K   ERWG+DS +RA+ KP+NW P+ K  P+ +    +   +LR   + D+ L  ++ FLK  + E+ Q +LRHHA+++QH P+V++ +VV++ +G   A+I K IY   DV  +     D+P        D+Y+FT+A+Q+LGLD++   KDD S+VQGAYLSYLHLR LK+RD+ RTC+S+LNYFRS+ERTL I++   +  S   V++++P + +   ++      GN    HGYL  +  +FKI   +FM+  E++NHDDFY HE GRIHV+D +G WI+YD AL+DF KLE DL+L+ + +I  D++ R S+   +K+  ++  + S+  I  Y HR+VDRFGVLYD+W     F + K+KL D+ MEVY  +  ++ R+ LAQ + NLM+ +PR+DL+  YF+++YRYE  IL ++ +I + IL+ +I  +REYL K++ +      P   +    IA +SDE  L  V+ LEF PSLS    +   +D +   +  L + N P+  ++  E    D +  E+   + +    T Q       +    D  IC                        + + M E+  ++L  I ++N+RG+KK R++  +NE  RL++L  +R RLI  + E E L  IY   A  +G+D+FHLF+R + FE A   EGA+  +P +Y+++VQDDDS++DK+ P     AIHELD  H G F+      I++ LE++G+EN+  +LKVQ  HKNA+ + V+L    RPS Y  H  K+ + I   S+ G  + +Y      Q GPTPLAL+ S+  ++A  D +PEA FS+QLEK P RD+  N F+K+       S     ++   KR+ I+ F   F  R  HI+L+AQII+ Y+SI+  L  VP + 
Sbjct:  430 VYFCHAYGIQ-MNIQAIRSSADEMELFAVINRKFRQIFSRQEEMLTFKTYDSAKSASERWGLDSWVRAVRKPSNWLPYVKLRPRRHEYLVKLTMELRSGTVVDDLLKASANFLKMKSPEKVQDSLRHHAMLVQHPPIVHSASVVSHRQGQSTAEIFKKIYNNSDVFGKASADTDEPGKR----QDDYDFTQAMQMLGLDDATNAKDDPSSVQGAYLSYLHLRHLKLRDVMRTCISVLNYFRSIERTLTINDQGLSMNSRGGVERTSPPNHRVGTEAQGHKGGGNTIDGHGYLFNSPQEFKIKETEFMQFAEVDNHDDFYFHEEGRIHVRDQVGFWIVYDAALEDFNKLEQDLLLLATAFIQRDRQSRMSS-NTKKKGVNQEAQSSDLDIARYAHRDVDRFGVLYDIWINECAFQQAKQKLMDVYMEVYGHIISRDSRRRLAQIMTNLMYQRPRLDLNESYFVLAYRYECAILRQRTEIMRCILNHQILNQREYLKKIHVEKPEFGLPPPLLERFPIAVHSDETLLTPVYLLEFHPSLSCAPSLAAAMDQSVQQLYELFTPNHPMQEIV-LEKRFYDFLRYEVETLKPLGGSYTAQLQRDVRGRIRQSDDFICFCTHLVSRNMESVSSKLFSSYFVEDAIQMCELSNQHLSAIQNRNSRGDKKTRQMYLLNELGRLLDLVTLRHRLIDCMWECEVLSKIYLTVAHEMGFDDFHLFIRPLQFEAAKYKEGADDLRPPIYITAVQDDDSMLDKFLPSALPLAIHELDETHVGKFSFRGKVTIMEMLETRGVENMLTILKVQTAHKNALTASVMLAYNARPSFYTMHAPKTKTGILRPSNTGANLISYTGLSGTQVGPTPLALERSKHQLNA--DYHPEAFFSIQLEKSPSRDRTQNAFIKRTQGGGIASSKSSVESEKMKREFISQFCMDFGQRTQHISLRAQIISTYSSILTILEKVPTVT 1379          

HSP 2 Score: 397.897 bits (1021), Expect = 0.000e+0
Identity = 300/1094 (27.42%), Postives = 524/1094 (47.90%), Query Frame = 2
Query: 3728 FFQFGKAFNPAKSTVDANCNLDKNPKKLHNRCRKVIDDDGQKLINIWYIPHFSEILFLYRQTEDAKANLILYNFLRLVMAFHDIIQYVVGFWKFGFNSTRV-PEKMKMKINKIYN-------------LPTDTN-SQNIVHHLHCDE-VADLSYFTDYNTTN---------------TYQLRKEFVD---------LEIQIEHLPNPYDLEQVIDLLNIRRKYHFYYFEICATLLLKELFLSTDNIHCYKKLMNGIQSSIPTIRNVRYTKHISEGLCIPSLISETDPEIDKLFPWRSMMLKSGPVFINFDCTMNICDY-LQLCFICIPQKYRFLIYNQFYNLNLSLEDML-----VEQETMTTNPSINNDNXXXXXXXXXXXXXXXXXXXXXA--TEHVKKDDLESTIIEEKKSLSLRENPIQTYEHLLTFLYVLRQLYVLRDIYSFKVSQIKKIDSYESFLTVSKQYKLSILFPVLRKLSYDINVPNFYFYGPLKAEDVVTYPKGIPEVSIYNLLIKALINKIEKQQINLLRSKITQKIDHVIKQRHYESETIDME--KSPYLIFKNSLKNPNLVADLIKKFEAPFQLAXXXXXXXXXXXXXXXXXDGKENEKEIENDNLVYSKMYVNKCLQYLANTLLRIHRETYESFAMYFENLLKHQQQLLLFRNREYYGLKEEFHEKEQSLSVERQFILANKVSERILEINYLRGKVKEDKQNIQNKENTLRRQTSLSFKFLIRNLYNLGFEQMTRIKVSRFKLHCDVYQRINATRLNAFYEMNKIKERSGAKYTTDDEIALRNLILTKKMSDARAVNFSLFQFIARMKSLFNWIYNYTVCDWENMLNENMNRTDRVKGLVFLVTVNAQQKVKLIKCEFKRLKVIISDTEKELSELKNTLNKEITQQTQKRQKAKLKHLSLXXXXXXXXXXXSDLMNQLQEMNGQIATMKMKFESHIKNNKSVTVTSHNQVEKLSTILTDERRKKLNAFNKVDDLIAQVYEFEAGFAM------VNTQSEASRGRVEKNYKARLLQTKTKKVDLRGNYPDLILHQRQLTYDAIIKRHCIPYTPCHFLPFRRDRVEAHRMKMRIQNRLIK 6841
            FF  G AF       D +  +  +P+ L  R R+V+  DG KL N W+IPHF E+LF++R  +D      L    RL    HDI+ Y++ + + G +S ++ PE+ +  I                  LPT    + NI      +  VA LS      + N               +   R   VD         ++ QI  LP+P D EQVI +L++RR   F  F++C   +L+E FL+  N+  YK+++      +  + +V+     +  + +P  +   D +   LFPWRS+M + GP F+ F    +  +Y + LC   +    R  ++ +   +NL LED+L      E +     P    +N   +L K+   + ++    + A  T          ++ ++   LS  ++P+  Y  L  FL + +++ +L+  +  +   ++ I++   F T    YK   L+P++R L+     P+ Y  GPL A D++  PKGIPE+ +    +  LI   E   I  LR  + ++ D VIK+R+ E   + +E  K P +    S+K P L  + + +  +                           E+   ND  + +K  +N+ LQ +A +++R  RE+YE+++MY+ENLLK+Q  LL  + RE   LKE   + E   +V  QF ++ +    +LE+  LR K+ E +      E  +R +    F   +R L+ L FEQ +RI   R  LH    QRI   R  A  EM +IKERSGA+ + +DE+A RNL L+++++     N  L Q ++R++ + +W      C +E  ++    + ++ K  V  + + ++Q+V+++  E  +L+  +S+TEK L++++  L+KE++ + +KR  A+ K  + K+  + KQ  I  LM ++ E N  +  M    ++  K+ K     S  +V+ L   L +ER+ K +A +KVDDL++Q+YEFE  ++       VN  + A +G       AR L  +                QR +TY+ ++ +   PYT  H+L FR++     +++ R+  ++++
Sbjct: 1382 FFVIGYAFEKKNPEDDLDVQV-TDPRTLRTRPRRVLSTDGTKLYNFWFIPHFIEVLFIFRHLDDLSCTKALQRMARLACVLHDILHYLIAYARLGISSAKITPEQRQQVIAGSQKHGGQQWRTATRGALPTAAEVAANIAGTTSAETFVAQLSSAGTIPSMNMALSSPALSVTPLDLSVHGRSLVVDQIIATELREIQYQINRLPDPTDPEQVIQMLDLRRDVMFLQFDVCMRTILRETFLAAGNVEAYKEVVENSHFPLSELSDVQRPCLNAIEMNVPEPLEARDDQAKALFPWRSLMNRCGP-FLLFCFGPSTIEYNIHLCMAGLKPVDRPTVHGELLAMNLCLEDVLDVGDIPEAKAGEPMPIQQAENMHCMLGKRTRDRRREIPPPNAASPTGTGGPASTPGSVADKTPKLSTLDSPVAAYTLLKKFLILWKRVELLKYAWGRRRLGVESINNPNLFKTFCSIYKREKLYPLIRSLAIQYRQPDMYALGPLDATDIIVMPKGIPEMVVRQRQLLKLIEAFEFYMIADLRKLLLRQTDLVIKERNREEGNLPLELWKRPAMKETLSVKRPGLADEFLVELMSHL-------------------------EQNARNDTYIITKDKLNEVLQTVAISVMRTQRESYENYSMYYENLLKNQHSLLYAKEREIETLKETLRQNELETNVTVQFQMSEQAHNLLLEVTALRAKIAELEDINLKTEAKVRNRVRREFSVAMRKLFGLSFEQKSRIDQYRDHLHAITLQRIAEVREEASAEMARIKERSGARASAEDELAERNLRLSREVNTLHQRNIGLQQMMSRLRVMAHWQQTTLRCAFEKQISGVEEQRNQSKSQVTRLGILSEQRVRMLNEEMSKLRDHLSNTEKHLNDMRKALDKEMSDKVEKRHAAERKAATDKQMAMVKQMHIDQLMAEIAEKNATLEKMGSLLDASAKSKKQEADKSVREVDLLRKQLREERKLKKSAIHKVDDLMSQLYEFETAYSSGQNRPGVNLPTVAPKGEATAG-GARKLSAEI---------------QRPVTYEDLVAKKSGPYTSKHYLRFRQETTRVPQLRERLAQQILR 2432          

HSP 3 Score: 134.42 bits (337), Expect = 2.721e-27
Identity = 67/190 (35.26%), Postives = 124/190 (65.26%), Query Frame = 3
Query:  120 LKMDVVELKAQIEENQLIYGLNNKDPSSIYTPKDPEFYXXXXXXXXXXQIDGQCTHTGKIVADTIKLEIECCEKFEYRDKSLLLLVYQYFKNRMKVLVNMKRSQMLRYKRYCINKTLTEFIKEHYNARLNAINTEYNDVRARYNRLKAAQEGFICNSDQGLEEITMDDIFIYMKWLIQHMYNMEYITTMV 689
            L+ D++EL+AQIEEN+LI+G+ +K  SS+Y PKDP+++ ++R+L L+R +         + A+ +  E++ C + E+ +K+L +L++QYF +R+  +V +K   +LR+KRYC +    E I+  Y  RL  +  EY D  +R +RL + +EG + NSD G+E++T++D  IY+++ +  + ++ Y   ++
Sbjct:   15 LRSDILELRAQIEENELIHGIPSKGMSSVYIPKDPDYFRRERKLILQRTLQVLEPKPITLQAELMMQELDACSQREFTEKTLPILLHQYFIDRIHQIVLLKHGYLLRWKRYCSSTAAVETIQSEYLNRLEYLTNEYLDASSRAHRLASTREGILANSDNGVEDVTVEDYQIYLRYHLSQLQSLSYANQLL 204          

HSP 4 Score: 100.908 bits (250), Expect = 4.112e-17
Identity = 42/101 (41.58%), Postives = 71/101 (70.30%), Query Frame = 3
Query:  861 ISNTRSDINLSAASGGGYAVDERNLLFPLHTNDMHYLEHLLIYFCEVYGINMDVHKIRNAADEMELYSVVSRRFKTVFNMQEQMRTFKVYDKIDSRTMGYG 1163
            +  T+++++L A+SGGG   +++    P+H+ND+  L   L+YFC  YGI M++  IR++ADEMEL++V++R+F+ +F+ QE+M TFK YD   S +  +G
Sbjct:  390 LQPTKANLDL-ASSGGGIVTNDKVAAPPMHSNDLETLRPHLVYFCHAYGIQMNIQAIRSSADEMELFAVINRKFRQIFSRQEEMLTFKTYDSAKSASERWG 489          
BLAST of DUF4549 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000000633.2 (pep primary_assembly:Astyanax_mexicanus-2.0:9:24590039:24605479:-1 gene:ENSAMXG00000000603.2 transcript:ENSAMXT00000000633.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 179.874 bits (455), Expect = 4.702e-55
Identity = 208/973 (21.38%), Postives = 403/973 (41.42%), Query Frame = 2
Query: 3731 FQFGKAFNPAKSTVDANCNLDKNPKKLHNRCRKVIDDDGQKLINIWYIPHFSEILFLYRQTEDAKANLILYNFLRLVMAFHDIIQYVVGFWKFGFNSTRVPEKMKMKINKIYNLPTDTNSQNIVHHLHCDEVADLSYFTDYNTTNTYQLRKEFVDLEIQIEHLPNPYDLEQVIDLLNIRRKYHFYYFEICATLLLKELFLSTDNIHCYKKLMNGIQSSIPTIRNVRYTKHISEGLCIPSLISETDPEIDKLFPWRSMMLKSG--PVFINFDCTMNICDYLQLCFICIPQKYRFLIYNQFYNLNLSLEDMLVE---------QETMTTNPSINNDNXXXXXXXXXXXXXXXXXXXXXATEHVKKDDLESTIIEEKKSLSLRENPIQTYEHLLTFLYVLRQLYVLRDIYSFKVSQIKKIDSYESFLTVSKQYKLSILFPVLRKLSYDINVPNFYFYGPLKAEDVVTYPKGIPEVSIYNLLIKALINKIEKQQINLLRSKITQKIDHVIKQR--HYESETIDMEKSPYLIFKNSLKNPNLVADLIKKFEAPFQLAXXXXXXXXXXXXXXXXXDGKENEKEIENDNLVYSKMYVNKCLQYLANTLLRIHRETYESFAMYFENLLKHQQQLLLFRNREYYGLKEEFHEKEQSLSVERQFILANKVSERIL-EINYLRGKVKEDKQNIQNKENTLRRQTSLSFK----FLIRNLYNLGFEQMTRIKVSRFKLHCDVYQRINATRLNAFYEMNKIKERSGAKYTTDDEIALRNLILTKKMSDARAVNFSLFQFIARMKSLFNWIYNYTVCDWENMLNENMNRTDRVKGLVFLVTVNAQQKVKLIKCEFKRLKVIISDTEKELSELKNTLNKEITQQTQKRQKAKLKHLSLXXXXXXXXXXXSDLMNQLQE----MNGQIATMKMKFESHIKNNKSVTVTSHNQVEKLSTILTDERRKKLNAFNKVDDLIAQVYEFEAGFA 6583
            F  G+A    K   D       +P+    R R+++  DG+ L+N+W+IPH++E+LF+++  E+      L + L +V A HDI+ Y+V     G N  R                              D   +L    D+  + +  +R E  D++ Q++ L  P   E V   L +RR+  F  F++     ++E FLS+  I  Y+ + + +  ++  + +    K     L +P  +    PE  ++FPWRS +   G  P+    D  + I   +QLC   +  + R         ++L L+DML           Q    ++ ++ NDNE    +                      +D+ES   + K+ +    NPIQ       FL + +QL V +D ++ +   +++I S   F   S  Y+  I +P ++ L+  +     Y    L  +     P G  EV +    + +L+   E   +  ++ +I +++  V+ +R  H  +   ++ K   +    SL+ P +V + +++                        + GKE E E+     V+S  ++ KC+  L + ++     ++  ++ ++E LL+ Q QLL  R ++   L E  H     L     +  A ++   ++ E+  LR +V +    ++ ++  +R+Q +L ++     L+  L++   +Q  R+     ++  DV Q ++  R     ++  IK R+    T D +     L   + + D    N  L   + +++    W         +  L +        K     V + +Q+   +IK E + +K  +   + E    K    ++I +QTQ+ Q  K + +   ++  + +      + QLQE     + QI  +  + E   + ++     SH Q++K+   L  ER  KL AF +VD L  Q++  E   +
Sbjct:  153 FVIGEAGEIQKG-ADEEKGFQHDPRTFQVRPRQLLSADGKTLLNLWFIPHYTEVLFMFKTLEEKACCQALQHTLMIVSALHDIVFYLVSLASLG-NPKR----------------------------SLDSSDELKLTADWGGSES--IRAELWDIQQQVDSLSEPNSPEVVGRYLQLRREVLFLRFDVAVRCTIREAFLSSGVISAYQSVSDNMSHALSVLSD--SLKRSDSQLPLPQPLDSCSPESQRIFPWRSFLACHGLHPLEPILD-ILPIEFTMQLCLSGLNDRSRMEANGAMLGVSLCLDDMLRSDRDAAPLQLQGQADSDITVENDNELLHST----------------------EDVESVSRKPKEIMPKAHNPIQALTQQKGFLLLWKQLEVFKDSWARQQLGVEQITSVALFNQFSLIYRTEIYYPSMQALAQQMEKEQEYETLLLHNQSF-QAPPGATEVDVKTWQLLSLLESTECDMVRAVQRRINKELTLVMSERARHDTALPAELWKKDSMKHCFSLERPQIVENFVQQL----------------------MDGGKEREGEV-----VFSMAHLQKCVSELGSAVMSRECSSFLLYSQFYEQLLQQQGQLLYQREQDVKDL-EAAH-----LQANDPYCKAAELCRSVMAEVITLRARVTQ----LEEEQKCVRQQINLEYRKRYDSLLHQLFSTCIQQKARLDKYHVRMDHDVKQLVSTVRREGVDKI--IKLRNKLSITKDGDSVNSKLSEKEILEDLYLENSQLSGLLYKLRVFHRWRQVVGQAKLQRELLQCQQSEISCKLEALAVKMTSQEGEMIIKQELEAVKAAMMQCKTEYEHTK----QQIVKQTQQLQDVKHRSVQEVRSQQELESFRMQSVEQLQEDMEQRDTQIRALSAQLEKTSRESELQQHHSHKQIKKVQNQLNHERSLKLEAFQRVDKLQHQIHSMETALS 1024          

HSP 2 Score: 57.7658 bits (138), Expect = 4.702e-55
Identity = 53/170 (31.18%), Postives = 76/170 (44.71%), Query Frame = 1
Query: 3226 LENLQVMLKVQFCHKNAVASGVLLCDYCRPSVYKSHKEKSLSHIESSLGQTVTTYNLPISAQS--GPTPLALDSSRASIHALTDSYPEALFSLQLEKVPIRDKMLNNFLKKFPSPSTVSQVDME--KAKRDCITFFTNAFYDRIAHIALKAQIIAYYNSIINTLNAVPEI 3723
            LE+LQV+L  Q   KNAV                             L QT  ++    S +S      L L +SR    A  D    A  S+QLEK  +RD+MLN+F+KK    ST+     E  + KR  IT F   F   ++   +++QIIA   S+ + L+ +P+I
Sbjct:    6 LESLQVVLACQITQKNAVLGA--------------------------LKQTSVSFWAEYSNKSPKAAECLTLRASRGDSCA-RDRLAGAFVSIQLEKTHLRDEMLNSFVKKKELMSTLMSNPEEVFRIKRKMITEFCQKFSLVMSQCCVRSQIIALCYSLTSLLDQLPDI 148          
BLAST of DUF4549 domain-containing protein vs. Ensembl Cavefish
Match: ccdc162 (coiled-coil domain containing 162 [Source:ZFIN;Acc:ZDB-GENE-131121-612])

HSP 1 Score: 55.0694 bits (131), Expect = 4.241e-8
Identity = 40/135 (29.63%), Postives = 70/135 (51.85%), Query Frame = 3
Query:   96 EINQLDELLKMDVVELKAQIEENQLIYGLNNKDPSSIYTPKDPEFYXXXXXXXXXXQIDGQCTHTGKIVADTIKLEIECCEKFEYRDKSLLLLVYQYFKNRMKVLVNMKRSQMLRYKRYCINKTLTEFIKEHYNA 500
            ++ QL+  L + +  L+ +IE N+  +GL  K   S++ PKD  ++  +R+  L++ +           A  I+ E+E C   EY  +SL LL++Q+F +R   L   K   MLR+KR+C +  + E +   Y  
Sbjct:    4 KVEQLEAELSLQLQALRTEIENNE-THGLFTKS-YSVHIPKDVSYFRTERQQVLQKGLKKPVVSQ----AGVIQKELESCLGQEYTPESLPLLLHQFFTDRTYQLAQFKYQLMLRWKRFCRHSIILEQLYPQYKV 132          
BLAST of DUF4549 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009936.1 (pep scaffold:Pmarinus_7.0:GL484636:314:10512:1 gene:ENSPMAG00000008988.1 transcript:ENSPMAT00000009936.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.6709 bits (239), Expect = 2.226e-21
Identity = 83/349 (23.78%), Postives = 157/349 (44.99%), Query Frame = 1
Query: 2215 KLFDLNMEVYNTVCKQEDRQHLAQTLINLMHHKPRIDLHSKYFLISYRYENMILERKFQIFKMILDKEISREREYLSKVYKDS------DY--PYRHIPHLLIA-PNSDECALQEVHFLEFLPSLSQVCQINKMIDYASLNIKNLSSNTPVTSMLKKELDLLDTIYKEISEYEDITRQFTDPNLI------KFLSQDSVICNPLIMEEIGRKYLKIIDSKNTRGE-KKRRKIRCINEFSRLIELANIRFRLIHVLHETEYLHSIYDNQAITLGYDNFHLFMRQVPFERAVKTEGAEYYKPFLYXXXXXXXXXXXXKYRPEHPYPAIHELDNVHFGLFNLITINDIIQCL 3213
            +L D   + Y      E+R  LAQ + + +H +PR +  S  F  +YR E   L+   Q+   ++D++++  R+Y   V++D       DY  P R +P   IA  ++   A + +  LE  PSL  V ++   +  A   +    S  P    L    + L    + +            P L       + L  + ++ +P  + E+G   +   ++++   E   +R  R ++ ++ L+++ ++R R+    HET  L  +Y      +G++  HL++R VPFE A   +GA     FL  ++  D D+ +D++ P     AI ELD       +  +++ ++Q L
Sbjct:    1 QLVDCYFQAYEHSLDGEERVALAQIIADTVHQRPRFEQRSIDFAETYRMERACLQTLHQLLVGVMDRQVAAMRDYARSVWRDGERGNTLDYGLPPRIVPTEPIALASTSSAATRPLSLLEVHPSLGLVWRVTHALRLACSEL----SPPPSPQRLPSGTERLRVEQRVLRAALATWAAAETPELDYGAAVHRELFGEGLLGDPWCVCELGSALVGAGETRHGGEETPGQRAERALSSWALLLDVLSLRHRIAESAHETALLARLYKGLVGRMGFEECHLYLRPVPFEFASHGDGAGEGPVFL--TATLDADASLDRFIPSQLPLAISELDEAPVKRLSFHSLDSLMQVL 343          
BLAST of DUF4549 domain-containing protein vs. Ensembl Nematostella
Match: EDO39453 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9W2])

HSP 1 Score: 310.071 bits (793), Expect = 4.136e-140
Identity = 211/662 (31.87%), Postives = 335/662 (50.60%), Query Frame = 1
Query: 1786 QDLDSSNFDNLGNHGYLQATVDDFKISIEDFMKTNEIENHDDFYLHENGRIHVQDLMGNWIMYDVALKDFEKLESDLILIGSYYITFDKEMRSSTLFNRKQSQSEHTEGSEFYILEYGHREVDRFGVLYDLWCQHTDFMEQKKKLFDLNMEVYNTVCKQEDRQHLAQTLINLMHHKPRIDLHSKYFLISYRYENMILERKFQIFKMILDKEISREREYLSKVYKDS-----DYPYRHIPHLLIAPNSDECALQEVHFLEFLPSLSQVCQINKMIDYASLNIKNLSSNTPVTSMLKKELDLLDTIYKEISEYEDITRQFTDPNLIKFLSQDSVICNPLIMEEIGRKYLKIIDSKNTRGEK--KRRKIRCINEFSRLIELANIRFRLIHVLHETEYLHSIYDNQAITLGYDNFHLFMRQVPFERAVKTEGAEYYKPFLYXXXXXXXXXXXXKYRPEHPYPAIHELDNVHFGLFNLITINDIIQCLESKGLENLQVMLKVQFCHKNAVASGVLLCDYCRPSVYKSHKEKSLS---------HIESSLGQTVTTYNLPISAQSGPTPLALDSSRASIHALTDSYPEALFSLQLEKVPIRDKMLNNFLKKFPSPS-TVSQVD-MEKAKRDCITFFTNAFYDRIAHIALKAQIIAYYNSIINTLNAVP 3717
            Q         +GNH Y+  T  D+++    FM+ +E+ENHDDFY  E GR+HVQD  G +I YD AL DF+ LE++L+L+ S++IT DKE R+          S    G    I  Y H+++DRF VL DLW     ++E K++L D   E Y  V    ++++LAQ + N++  +PR D  + Y +  YR E + L     + K +LDK+I  EREYL KV ++        P+R IP   IA N    ALQ ++ LEF PSL+   +I K + +     +NL        ++  E  +L+ + KE    +     F      K L  +  + +PL + E+ +  +   ++K   G K  K ++      +SR++E+  +R RLI    ET  +  IY  +A  +G+D +H F+R V F+ A     A+     + ++ +Q+DDS +D+Y P +   AI ELD  H G F+  T    +  +   G++ L V+L  Q CHKN + S +L  D C  +V ++ K K+ +            SS  Q++T+     S +  P+ L+  S++           E   S+QLEK  +RDKMLN +++K      T+  +D + K KR  I  F      R+   +L+AQI+AY  S+++ +   P
Sbjct:  747 QVFHGGGISGIGNHQYVHNTPADYRVDQAQFMEFSELENHDDFYSQEEGRVHVQDQRGYYITYDSALDDFKNLETELLLVASHFITKDKEFRNP-------KPSAKYRGDHLDIASYSHQQIDRFAVLLDLWTNEAAYLENKRQLLDCYFEAYQHVFDASEKKNLAQVMTNVVSMRPRFDFTADYLVRIYRAECVNLRLHCNLIKGVLDKQIDEEREYLQKVCREDTSGLFGLPHRVIPQQHIAVNISRPALQYIYMLEFHPSLALAAKIPKALSHVFKTFQNLQKPKSTGEIISMERRMLEVVQKEWDFLQPSGNDFA-VQTQKDLFSEVFVEDPLFVCEVAQSLITAEENKKGGGRKSVKEKQQILTRIWSRILEVITLRHRLIMASQETSVVTKIYRRRAKEIGFDEYHAFLRIVSFDFAQTKPEAD--TDTVSITLIQEDDSRIDRYTPAYLPLAIQELDEKHVGNFSFRTREGFMHIVSDSGVDKLGVVLMTQICHKNIIISSLLRMDGC-AAVIRAVKAKAATAEKSGGSGLSPRSSRDQSLTSRR--NSVEESPSHLSAFSTKRLDREFERKMQEVFVSVQLEKTFLRDKMLNEYIRKKEQLGVTLKSIDEVVKLKRKLIMDFNTNLQKRVTQYSLQAQIVAYTTSLLDLMGDFP 1395          

HSP 2 Score: 209.534 bits (532), Expect = 4.136e-140
Identity = 198/848 (23.35%), Postives = 362/848 (42.69%), Query Frame = 2
Query: 3797 NPKKLHNRCRKVIDDDGQKLINIWYIPHFSEILFLYRQTEDAKANLILYNFLRLVMAFHDIIQYVVGFWKFGFNSTRVPEKMKMKINKIYNLPTDTNSQNIVHHLHCDEVADLSYFTDYNTTNTYQLRKEFVDLEIQIEHLPNPYDLEQVIDLLNIRRKYHFYYFEICATLLLKELFLSTDNIHCYKKLMNGIQSSIPTIRNVRYTKHISEGLCIPSLISETDPEIDKLFPWRSMMLKSGPVFINFDCTMNICDYLQLCFICIPQKYRFLIYNQFYNLNLSLEDML---------VEQETMTTNPSINNDNXXXXXXXXXXXXXXXXXXXXXATEHVKKDDLESTIIEE--KKSLSLRENPIQTYEHLLTFLYVLRQLYVLRDIYSFKVSQIKKIDSYESFLTVSKQYKLSILFPVLRKLSYDINVPNFYFY-GPLKAED-VVTYPKGIPEVSIYNLLIKALINKIEKQQINLLRSKITQKIDHVIKQRHYESETIDMEKSPYLIFKNSLKNPNLVADLIKKFEAPFQLAXXXXXXXXXXXXXXXXXDGKENEKEIENDNLVYSKMYVNKCLQYLANTLLRIHRETYESFAMYFENLLKHQQQLLLFRNREYYGLKEEFHEKEQSLSVERQFILANKVSERILEINYLRGKVKEDKQNIQNKENTLRRQTSLSFKFLIRNLYNLGFEQMTRIKVSRFKLHCDVYQRINATRLNAFYEMNKIKERSGAKYTTDDEIALRNLILTKKMSDARAVNFSLFQFIARMKSLFNWIYNYTVCDWENMLNENMNRTDRVKGLVFLVTVNAQQKVKLIKCEFKRLKVI---------ISDTEKELSELKNTLNKEI 6274
            +PK   +R R+++  DG+KL+N+W+IPH++E++ ++ + +    N  L   L LV + HDI QY+    + G ++ R  +                          C   +      D+  T    +  E  +++ QI HL NP D  +V + L  RR   F   +I  +  +++ FLST N   Y+ + + +  ++  + N+      S  + +P  +   D    +L+PWRS M + GP  + +     I D++QLC   + +  R ++  +   ++L LED+L          +QE    + +          S++   ++                  E+T   +  K  LS   NP    + +  FL +  +L VL+  +  +   + +I S +++    K YK+ +L  V ++++  + +   Y   G L ++D  +  P G  E+ +                          KI  V+K    E+ TI     P+L+        N V DL+                          +DG+  E         +++ ++NKCL  LA       R  +ES+AMY+E+LL+HQ QLL  R +E    +++      +  V+    LA++  E++LEI  LR K+ E + +I N+E  LR +    F  L++ L++  FE   + +  R  L+ DV++ +N  R  A  +M   +E+SG+      +  L+      ++ D +  N +L Q   +MK++ NW        + + ++   +  DR K     V   A++K  L+K E   L+ I         +S+ EKE   L+  L  E+
Sbjct: 1421 DPKHFKSRPRRMLSVDGKKLMNLWFIPHYTEVMKMFSKEKIDTRNRALTVMLELVSSMHDICQYLCAHARLGSSTARWRD--------------------------CRSWSSGVIGADWGGTEG--IGAELREIQRQINHLENPTDPHEVAEFLVKRRDNLFLEVDISVSHSVRDTFLSTGNEAAYRSITDNMHFALQDLSNLPRPNMYSTHVTVPGPLGARDNLGRELYPWRSFMQRYGPFPMMYWQWYAIGDHMQLCLAGLKEVDRHVVNGEILGVSLLLEDVLQAGLPDMFFSKQEDEIGSSTSPRSRPATSSSRRPTSRQSDTSEDGTGVSGKDPKSAETTGYGDIPKGKLSHSTNPKAAVKLINMFLLICSRLEVLKTDWGCRKLGVNEISSTKNYRAFLKLYKIDVLQSVYQQIAAKLGLGQEYAALGVLTSDDEPLATPPGATEMEL--------------------------KIKQVMK----ENSTI---TKPHLV-------ENFVLDLMAGH----------------------MDDGETIE---------FTREHLNKCLLRLATETNLRERVCFESYAMYYESLLRHQHQLLFMREQEIKQCQDQMEANAVATVVDVHCQLADRSHEQLLEITALRAKIMEMRDSIMNQEKELREKIKKDFANLVQELFSNCFEMKNKFEEFRLFLYDDVHESLNDVRRQALEDM---REKSGSMKAVGTDPVLKK---CDQIRDIQEDNTNLGQMFLKMKTMNNWKKTRLFLRYLDSVDSLRDEADRAKRECLEVKKLAEEKAILMKQEQAALRQIAKKDCKYQALSELEKECQRLRRKLQFEV 2163          

HSP 3 Score: 134.42 bits (337), Expect = 4.859e-43
Identity = 100/377 (26.53%), Postives = 181/377 (48.01%), Query Frame = 3
Query:  150 QIEENQLIYGLNNKDPSSIYTPKDPEFYXXXXXXXXXXQIDGQCTHTGKIVADTIKLEIECCEKFEYRDKSLLLLVYQ----------------------YFKNRMKVLVNMKRSQMLRYKRYCINKTLTEFIKEHYNARLNAINTEYNDVRARYNRLKAAQEGFICNSDQGLEEITMDDIFIYMKWLIQHMYNMEYITTMVKIIRWIPIKYRKNNAAKAENDTD------------SFNKSESTYKYIRSTTSILQN----RESSLTARHSQRTISNTRSDINLSAASGG-----------GYAVDERNLLFPLHTNDMHYLEHLLIYFCEVYGINMDVHKIRNAADEMELYSVVSRRFKTVFNMQEQMRTFKVYD 1133
            +IEE   +     K   S+  PKD E + ++R+L + + +  +        ++ ++ E+E   K EY  KS+ LL++Q                      +F +R++ LV  K   MLR+ R+  +    E +   Y  RL+ I  EY+D   R  RL  A+E  +  S+  +  +T++D+ IY +WL+ +M++++ + + +++I W+P+ + KN     E + D              +++    K I S  +I  +    R  +            + S   L +A+             G A +E +L+ P+H  ++  L  LL +    Y ++MD+H+I   ADEM+L+++V+RRFK VF+ QEQ+RTF +YD
Sbjct:   30 EIEEGNFLRPGQVKALGSVPLPKDIEHFRRERKLAVSKTLTIREAQPLINQSEVMREEMETSVKSEYSPKSIPLLLHQKRTVELHFQIFAVSSTRQKRQKFFSDRIEHLVQCKHMHMLRWARFNEHSKAIENLYPAYQQRLSHIMEEYHDAFQRARRLAVAREASLAGSESAMGAVTVEDLLIYTRWLVCYMHSVKRMHSFLRVIEWLPVMH-KNTIKPQEIEKDESPVEVESKPSGPPSRARGNLKRIMSQVAITAHLNVLRPMAKPDASLPPPPPLSLSPYQLVSATNPSVAAAAAASGGGLASNEVHLVLPMHETNLPKLMLLLEFLMSCYSVDMDIHQINTNADEMDLFTMVTRRFKKVFSKQEQLRTFPIYD 405          

HSP 4 Score: 61.2326 bits (147), Expect = 4.859e-43
Identity = 67/271 (24.72%), Postives = 110/271 (40.59%), Query Frame = 1
Query: 1165 SAMRALLKPANWKPFNKFTPKINLLEARYLNKLRDEEIKDEFLITASLFLKKSNAEETQMNLRHHALVIQHLPVVYNTAVVTNPKGFDIADILKTIYTKCDVNLRT-----FTTDDKPNNDSSGDHDNYNFTEALQLLGLDESIETKDDSSTVQGAYLSYLHLRFLKIRDMQRT------------------------------CLSILNYFRSVERTLVIDEYQFTKESVRPVKKSNPASSQDLDSSNFDNLGNHGYLQATVDDFKISIE 1872
             A+    + +NW PF    P+ +  + + + KL+ +   DE L + S FL                    H+    N          D A + K I+T    ++       F T     +    D   ++   A++LLGL++    K+  S +QGAY+S+L LR L++RD+QRT                              CL ILNYFRSV+RT+ I++   + E      K   +  Q         +GNH Y+  T  D++ +++
Sbjct:  420 GALYTFKQTSNWLPFIMLRPEKDSNQIKAMAKLKQQGQIDELLKSHSRFL--------------------HIQDSSN----------DTAAVWKKIFTYASSSVTRDDVLEFDTKVSDEDLGGSDQGGFDLGTAVELLGLEDD-NAKNQGSMLQGAYMSFLLLRHLRLRDLQRTVGVEISRISCSRWSHACIYFKACHVTIKYECLGILNYFRSVQRTMTINDGGLSLEG----GKQRSSKYQVFHGGGISGIGNHQYVHNTPADYRPALQ 655          
BLAST of DUF4549 domain-containing protein vs. Planmine SMEST
Match: SMESG000078557.1 (SMESG000078557.1)

HSP 1 Score: 2045.78 bits (5299), Expect = 0.000e+0
Identity = 1063/1063 (100.00%), Postives = 1063/1063 (100.00%), Query Frame = 2
Query: 3728 FFQFGKAFNPAKSTVDANCNLDKNPKKLHNRCRKVIDDDGQKLINIWYIPHFSEILFLYRQTEDAKANLILYNFLRLVMAFHDIIQYVVGFWKFGFNSTRVPEKMKMKINKIYNLPTDTNSQNIVHHLHCDEVADLSYFTDYNTTNTYQLRKEFVDLEIQIEHLPNPYDLEQVIDLLNIRRKYHFYYFEICATLLLKELFLSTDNIHCYKKLMNGIQSSIPTIRNVRYTKHISEGLCIPSLISETDPEIDKLFPWRSMMLKSGPVFINFDCTMNICDYLQLCFICIPQKYRFLIYNQFYNLNLSLEDMLVEQETMTTNPSINNDNXXXXXXXXXXXXXXXXXXXXXATEHVKKDDLESTIIEEKKSLSLRENPIQTYEHLLTFLYVLRQLYVLRDIYSFKVSQIKKIDSYESFLTVSKQYKLSILFPVLRKLSYDINVPNFYFYGPLKAEDVVTYPKGIPEVSIYNLLIKALINKIEKQQINLLRSKITQKIDHVIKQRHYESETIDMEKSPYLIFKNSLKNPNLVADLIKKFEAPFQLAXXXXXXXXXXXXXXXXXDGKENEKEIENDNLVYSKMYVNKCLQYLANTLLRIHRETYESFAMYFENLLKHQQQLLLFRNREYYGLKEEFHEKEQSLSVERQFILANKVSERILEINYLRGKVKEDKQNIQNKENTLRRQTSLSFKFLIRNLYNLGFEQMTRIKVSRFKLHCDVYQRINATRLNAFYEMNKIKERSGAKYTTDDEIALRNLILTKKMSDARAVNFSLFQFIARMKSLFNWIYNYTVCDWENMLNENMNRTDRVKGLVFLVTVNAQQKVKLIKCEFKRLKVIISDTEKELSELKNTLNKEITQQTQKRQKAKLKHLSLXXXXXXXXXXXSDLMNQLQEMNGQIATMKMKFESHIKNNKSVTVTSHNQVEKLSTILTDERRKKLNAFNKVDDLIAQVYEFEAGFAMVNTQSEASRGRVEKNYKARLLQTKTKKVDLRGNYPDLILHQRQLTYDAIIKRHCIPYTPCHFLPFRRDRVEAHRMKMRIQNRLIKKEPDSKVHSLPKLRKTGNLVKFQKN 6916
            FFQFGKAFNPAKSTVDANCNLDKNPKKLHNRCRKVIDDDGQKLINIWYIPHFSEILFLYRQTEDAKANLILYNFLRLVMAFHDIIQYVVGFWKFGFNSTRVPEKMKMKINKIYNLPTDTNSQNIVHHLHCDEVADLSYFTDYNTTNTYQLRKEFVDLEIQIEHLPNPYDLEQVIDLLNIRRKYHFYYFEICATLLLKELFLSTDNIHCYKKLMNGIQSSIPTIRNVRYTKHISEGLCIPSLISETDPEIDKLFPWRSMMLKSGPVFINFDCTMNICDYLQLCFICIPQKYRFLIYNQFYNLNLSLEDMLVEQETMTTNPSINNDNEKFLLSKKMHKKEKKEGHQHLATEHVKKDDLESTIIEEKKSLSLRENPIQTYEHLLTFLYVLRQLYVLRDIYSFKVSQIKKIDSYESFLTVSKQYKLSILFPVLRKLSYDINVPNFYFYGPLKAEDVVTYPKGIPEVSIYNLLIKALINKIEKQQINLLRSKITQKIDHVIKQRHYESETIDMEKSPYLIFKNSLKNPNLVADLIKKFEAPFQLAEKKEEEKAEGTKENESEDGKENEKEIENDNLVYSKMYVNKCLQYLANTLLRIHRETYESFAMYFENLLKHQQQLLLFRNREYYGLKEEFHEKEQSLSVERQFILANKVSERILEINYLRGKVKEDKQNIQNKENTLRRQTSLSFKFLIRNLYNLGFEQMTRIKVSRFKLHCDVYQRINATRLNAFYEMNKIKERSGAKYTTDDEIALRNLILTKKMSDARAVNFSLFQFIARMKSLFNWIYNYTVCDWENMLNENMNRTDRVKGLVFLVTVNAQQKVKLIKCEFKRLKVIISDTEKELSELKNTLNKEITQQTQKRQKAKLKHLSLKKTTIQKQKQISDLMNQLQEMNGQIATMKMKFESHIKNNKSVTVTSHNQVEKLSTILTDERRKKLNAFNKVDDLIAQVYEFEAGFAMVNTQSEASRGRVEKNYKARLLQTKTKKVDLRGNYPDLILHQRQLTYDAIIKRHCIPYTPCHFLPFRRDRVEAHRMKMRIQNRLIKKEPDSKVHSLPKLRKTGNLVKFQKN
Sbjct: 1205 FFQFGKAFNPAKSTVDANCNLDKNPKKLHNRCRKVIDDDGQKLINIWYIPHFSEILFLYRQTEDAKANLILYNFLRLVMAFHDIIQYVVGFWKFGFNSTRVPEKMKMKINKIYNLPTDTNSQNIVHHLHCDEVADLSYFTDYNTTNTYQLRKEFVDLEIQIEHLPNPYDLEQVIDLLNIRRKYHFYYFEICATLLLKELFLSTDNIHCYKKLMNGIQSSIPTIRNVRYTKHISEGLCIPSLISETDPEIDKLFPWRSMMLKSGPVFINFDCTMNICDYLQLCFICIPQKYRFLIYNQFYNLNLSLEDMLVEQETMTTNPSINNDNEKFLLSKKMHKKEKKEGHQHLATEHVKKDDLESTIIEEKKSLSLRENPIQTYEHLLTFLYVLRQLYVLRDIYSFKVSQIKKIDSYESFLTVSKQYKLSILFPVLRKLSYDINVPNFYFYGPLKAEDVVTYPKGIPEVSIYNLLIKALINKIEKQQINLLRSKITQKIDHVIKQRHYESETIDMEKSPYLIFKNSLKNPNLVADLIKKFEAPFQLAEKKEEEKAEGTKENESEDGKENEKEIENDNLVYSKMYVNKCLQYLANTLLRIHRETYESFAMYFENLLKHQQQLLLFRNREYYGLKEEFHEKEQSLSVERQFILANKVSERILEINYLRGKVKEDKQNIQNKENTLRRQTSLSFKFLIRNLYNLGFEQMTRIKVSRFKLHCDVYQRINATRLNAFYEMNKIKERSGAKYTTDDEIALRNLILTKKMSDARAVNFSLFQFIARMKSLFNWIYNYTVCDWENMLNENMNRTDRVKGLVFLVTVNAQQKVKLIKCEFKRLKVIISDTEKELSELKNTLNKEITQQTQKRQKAKLKHLSLKKTTIQKQKQISDLMNQLQEMNGQIATMKMKFESHIKNNKSVTVTSHNQVEKLSTILTDERRKKLNAFNKVDDLIAQVYEFEAGFAMVNTQSEASRGRVEKNYKARLLQTKTKKVDLRGNYPDLILHQRQLTYDAIIKRHCIPYTPCHFLPFRRDRVEAHRMKMRIQNRLIKKEPDSKVHSLPKLRKTGNLVKFQKN 2267          

HSP 2 Score: 1765.74 bits (4572), Expect = 0.000e+0
Identity = 861/861 (100.00%), Postives = 861/861 (100.00%), Query Frame = 1
Query: 1144 QERWGMDSAMRALLKPANWKPFNKFTPKINLLEARYLNKLRDEEIKDEFLITASLFLKKSNAEETQMNLRHHALVIQHLPVVYNTAVVTNPKGFDIADILKTIYTKCDVNLRTFTTDDKPNNDSSGDHDNYNFTEALQLLGLDESIETKDDSSTVQGAYLSYLHLRFLKIRDMQRTCLSILNYFRSVERTLVIDEYQFTKESVRPVKKSNPASSQDLDSSNFDNLGNHGYLQATVDDFKISIEDFMKTNEIENHDDFYLHENGRIHVQDLMGNWIMYDVALKDFEKLESDLILIGSYYITFDKEMRSSTLFNRKQSQSEHTEGSEFYILEYGHREVDRFGVLYDLWCQHTDFMEQKKKLFDLNMEVYNTVCKQEDRQHLAQTLINLMHHKPRIDLHSKYFLISYRYENMILERKFQIFKMILDKEISREREYLSKVYKDSDYPYRHIPHLLIAPNSDECALQEVHFLEFLPSLSQVCQINKMIDYASLNIKNLSSNTPVTSMLKKELDLLDTIYKEISEYEDITRQFTDPNLIKFLSQDSVICNPLIMEEIGRKYLKIIDSKNTRGEKKRRKIRCINEFSRLIELANIRFRLIHVLHETEYLHSIYDNQAITLGYDNFHLFMRQVPFERAVKTEGAEYYKPFLYXXXXXXXXXXXXKYRPEHPYPAIHELDNVHFGLFNLITINDIIQCLESKGLENLQVMLKVQFCHKNAVASGVLLCDYCRPSVYKSHKEKSLSHIESSLGQTVTTYNLPISAQSGPTPLALDSSRASIHALTDSYPEALFSLQLEKVPIRDKMLNNFLKKFPSPSTVSQVDMEKAKRDCITFFTNAFYDRIAHIALKAQIIAYYNSIINTLNAVPEIV 3726
            QERWGMDSAMRALLKPANWKPFNKFTPKINLLEARYLNKLRDEEIKDEFLITASLFLKKSNAEETQMNLRHHALVIQHLPVVYNTAVVTNPKGFDIADILKTIYTKCDVNLRTFTTDDKPNNDSSGDHDNYNFTEALQLLGLDESIETKDDSSTVQGAYLSYLHLRFLKIRDMQRTCLSILNYFRSVERTLVIDEYQFTKESVRPVKKSNPASSQDLDSSNFDNLGNHGYLQATVDDFKISIEDFMKTNEIENHDDFYLHENGRIHVQDLMGNWIMYDVALKDFEKLESDLILIGSYYITFDKEMRSSTLFNRKQSQSEHTEGSEFYILEYGHREVDRFGVLYDLWCQHTDFMEQKKKLFDLNMEVYNTVCKQEDRQHLAQTLINLMHHKPRIDLHSKYFLISYRYENMILERKFQIFKMILDKEISREREYLSKVYKDSDYPYRHIPHLLIAPNSDECALQEVHFLEFLPSLSQVCQINKMIDYASLNIKNLSSNTPVTSMLKKELDLLDTIYKEISEYEDITRQFTDPNLIKFLSQDSVICNPLIMEEIGRKYLKIIDSKNTRGEKKRRKIRCINEFSRLIELANIRFRLIHVLHETEYLHSIYDNQAITLGYDNFHLFMRQVPFERAVKTEGAEYYKPFLYVSSVQDDDSVVDKYRPEHPYPAIHELDNVHFGLFNLITINDIIQCLESKGLENLQVMLKVQFCHKNAVASGVLLCDYCRPSVYKSHKEKSLSHIESSLGQTVTTYNLPISAQSGPTPLALDSSRASIHALTDSYPEALFSLQLEKVPIRDKMLNNFLKKFPSPSTVSQVDMEKAKRDCITFFTNAFYDRIAHIALKAQIIAYYNSIINTLNAVPEIV
Sbjct:  342 QERWGMDSAMRALLKPANWKPFNKFTPKINLLEARYLNKLRDEEIKDEFLITASLFLKKSNAEETQMNLRHHALVIQHLPVVYNTAVVTNPKGFDIADILKTIYTKCDVNLRTFTTDDKPNNDSSGDHDNYNFTEALQLLGLDESIETKDDSSTVQGAYLSYLHLRFLKIRDMQRTCLSILNYFRSVERTLVIDEYQFTKESVRPVKKSNPASSQDLDSSNFDNLGNHGYLQATVDDFKISIEDFMKTNEIENHDDFYLHENGRIHVQDLMGNWIMYDVALKDFEKLESDLILIGSYYITFDKEMRSSTLFNRKQSQSEHTEGSEFYILEYGHREVDRFGVLYDLWCQHTDFMEQKKKLFDLNMEVYNTVCKQEDRQHLAQTLINLMHHKPRIDLHSKYFLISYRYENMILERKFQIFKMILDKEISREREYLSKVYKDSDYPYRHIPHLLIAPNSDECALQEVHFLEFLPSLSQVCQINKMIDYASLNIKNLSSNTPVTSMLKKELDLLDTIYKEISEYEDITRQFTDPNLIKFLSQDSVICNPLIMEEIGRKYLKIIDSKNTRGEKKRRKIRCINEFSRLIELANIRFRLIHVLHETEYLHSIYDNQAITLGYDNFHLFMRQVPFERAVKTEGAEYYKPFLYVSSVQDDDSVVDKYRPEHPYPAIHELDNVHFGLFNLITINDIIQCLESKGLENLQVMLKVQFCHKNAVASGVLLCDYCRPSVYKSHKEKSLSHIESSLGQTVTTYNLPISAQSGPTPLALDSSRASIHALTDSYPEALFSLQLEKVPIRDKMLNNFLKKFPSPSTVSQVDMEKAKRDCITFFTNAFYDRIAHIALKAQIIAYYNSIINTLNAVPEIV 1202          

HSP 3 Score: 688.337 bits (1775), Expect = 0.000e+0
Identity = 341/346 (98.55%), Postives = 342/346 (98.84%), Query Frame = 3
Query:  126 MDVVELKAQIEENQLIYGLNNKDPSSIYTPKDPEFYXXXXXXXXXXQIDGQCTHTGKIVADTIKLEIECCEKFEYRDKSLLLLVYQYFKNRMKVLVNMKRSQMLRYKRYCINKTLTEFIKEHYNARLNAINTEYNDVRARYNRLKAAQEGFICNSDQGLEEITMDDIFIYMKWLIQHMYNMEYITTMVKIIRWIPIKYRKNNAAKAENDTDSFNKSESTYKYIRSTTSILQNRESSLTARHSQRTISNTRSDINLSAASGGGYAVDERNLLFPLHTNDMHYLEHLLIYFCEVYGINMDVHKIRNAADEMELYSVVSRRFKTVFNMQEQMRTFKVYDKIDSRTMGYG 1163
            MDVVELKAQIEENQLIYGLNNKDPSSIYTPKDPEFYLKKRRLKLKRQIDGQCTHTGKIVADTIKLEIECCEKFEYRDKSLLLLVYQYFKNRMKVLVNMKRSQMLRYKRYCINKTLTEFIKEHYNARLNAINTEYNDVRARYNRLKAAQEGFICNSDQGLEEITMDDIFIYMKWLIQHMYNMEYITTMVKIIRWIPIKYRKNNAAKAENDTDSFNKSESTYKYIRSTTSILQNRESSLTARHSQRTISNTRSDINLSAASGGGYAVDERNLLFPLHTNDMHYLEHLLIYFCEVYGINMDVHKIRNAADEMELYSVVSRRFKTVFNMQEQMRTFKVYDKIDS    +G
Sbjct:    1 MDVVELKAQIEENQLIYGLNNKDPSSIYTPKDPEFYLKKRRLKLKRQIDGQCTHTGKIVADTIKLEIECCEKFEYRDKSLLLLVYQYFKNRMKVLVNMKRSQMLRYKRYCINKTLTEFIKEHYNARLNAINTEYNDVRARYNRLKAAQEGFICNSDQGLEEITMDDIFIYMKWLIQHMYNMEYITTMVKIIRWIPIKYRKNNAAKAENDTDSFNKSESTYKYIRSTTSILQNRESSLTARHSQRTISNTRSDINLSAASGGGYAVDERNLLFPLHTNDMHYLEHLLIYFCEVYGINMDVHKIRNAADEMELYSVVSRRFKTVFNMQEQMRTFKVYDKIDSSQERWG 346          
BLAST of DUF4549 domain-containing protein vs. Planmine SMEST
Match: SMESG000078557.1 (SMESG000078557.1)

HSP 1 Score: 2045.4 bits (5298), Expect = 0.000e+0
Identity = 1063/1063 (100.00%), Postives = 1063/1063 (100.00%), Query Frame = 2
Query: 3728 FFQFGKAFNPAKSTVDANCNLDKNPKKLHNRCRKVIDDDGQKLINIWYIPHFSEILFLYRQTEDAKANLILYNFLRLVMAFHDIIQYVVGFWKFGFNSTRVPEKMKMKINKIYNLPTDTNSQNIVHHLHCDEVADLSYFTDYNTTNTYQLRKEFVDLEIQIEHLPNPYDLEQVIDLLNIRRKYHFYYFEICATLLLKELFLSTDNIHCYKKLMNGIQSSIPTIRNVRYTKHISEGLCIPSLISETDPEIDKLFPWRSMMLKSGPVFINFDCTMNICDYLQLCFICIPQKYRFLIYNQFYNLNLSLEDMLVEQETMTTNPSINNDNXXXXXXXXXXXXXXXXXXXXXATEHVKKDDLESTIIEEKKSLSLRENPIQTYEHLLTFLYVLRQLYVLRDIYSFKVSQIKKIDSYESFLTVSKQYKLSILFPVLRKLSYDINVPNFYFYGPLKAEDVVTYPKGIPEVSIYNLLIKALINKIEKQQINLLRSKITQKIDHVIKQRHYESETIDMEKSPYLIFKNSLKNPNLVADLIKKFEAPFQLAXXXXXXXXXXXXXXXXXDGKENEKEIENDNLVYSKMYVNKCLQYLANTLLRIHRETYESFAMYFENLLKHQQQLLLFRNREYYGLKEEFHEKEQSLSVERQFILANKVSERILEINYLRGKVKEDKQNIQNKENTLRRQTSLSFKFLIRNLYNLGFEQMTRIKVSRFKLHCDVYQRINATRLNAFYEMNKIKERSGAKYTTDDEIALRNLILTKKMSDARAVNFSLFQFIARMKSLFNWIYNYTVCDWENMLNENMNRTDRVKGLVFLVTVNAQQKVKLIKCEFKRLKVIISDTEKELSELKNTLNKEITQQTQKRQKAKLKHLSLXXXXXXXXXXXSDLMNQLQEMNGQIATMKMKFESHIKNNKSVTVTSHNQVEKLSTILTDERRKKLNAFNKVDDLIAQVYEFEAGFAMVNTQSEASRGRVEKNYKARLLQTKTKKVDLRGNYPDLILHQRQLTYDAIIKRHCIPYTPCHFLPFRRDRVEAHRMKMRIQNRLIKKEPDSKVHSLPKLRKTGNLVKFQKN 6916
            FFQFGKAFNPAKSTVDANCNLDKNPKKLHNRCRKVIDDDGQKLINIWYIPHFSEILFLYRQTEDAKANLILYNFLRLVMAFHDIIQYVVGFWKFGFNSTRVPEKMKMKINKIYNLPTDTNSQNIVHHLHCDEVADLSYFTDYNTTNTYQLRKEFVDLEIQIEHLPNPYDLEQVIDLLNIRRKYHFYYFEICATLLLKELFLSTDNIHCYKKLMNGIQSSIPTIRNVRYTKHISEGLCIPSLISETDPEIDKLFPWRSMMLKSGPVFINFDCTMNICDYLQLCFICIPQKYRFLIYNQFYNLNLSLEDMLVEQETMTTNPSINNDNEKFLLSKKMHKKEKKEGHQHLATEHVKKDDLESTIIEEKKSLSLRENPIQTYEHLLTFLYVLRQLYVLRDIYSFKVSQIKKIDSYESFLTVSKQYKLSILFPVLRKLSYDINVPNFYFYGPLKAEDVVTYPKGIPEVSIYNLLIKALINKIEKQQINLLRSKITQKIDHVIKQRHYESETIDMEKSPYLIFKNSLKNPNLVADLIKKFEAPFQLAEKKEEEKAEGTKENESEDGKENEKEIENDNLVYSKMYVNKCLQYLANTLLRIHRETYESFAMYFENLLKHQQQLLLFRNREYYGLKEEFHEKEQSLSVERQFILANKVSERILEINYLRGKVKEDKQNIQNKENTLRRQTSLSFKFLIRNLYNLGFEQMTRIKVSRFKLHCDVYQRINATRLNAFYEMNKIKERSGAKYTTDDEIALRNLILTKKMSDARAVNFSLFQFIARMKSLFNWIYNYTVCDWENMLNENMNRTDRVKGLVFLVTVNAQQKVKLIKCEFKRLKVIISDTEKELSELKNTLNKEITQQTQKRQKAKLKHLSLKKTTIQKQKQISDLMNQLQEMNGQIATMKMKFESHIKNNKSVTVTSHNQVEKLSTILTDERRKKLNAFNKVDDLIAQVYEFEAGFAMVNTQSEASRGRVEKNYKARLLQTKTKKVDLRGNYPDLILHQRQLTYDAIIKRHCIPYTPCHFLPFRRDRVEAHRMKMRIQNRLIKKEPDSKVHSLPKLRKTGNLVKFQKN
Sbjct: 1222 FFQFGKAFNPAKSTVDANCNLDKNPKKLHNRCRKVIDDDGQKLINIWYIPHFSEILFLYRQTEDAKANLILYNFLRLVMAFHDIIQYVVGFWKFGFNSTRVPEKMKMKINKIYNLPTDTNSQNIVHHLHCDEVADLSYFTDYNTTNTYQLRKEFVDLEIQIEHLPNPYDLEQVIDLLNIRRKYHFYYFEICATLLLKELFLSTDNIHCYKKLMNGIQSSIPTIRNVRYTKHISEGLCIPSLISETDPEIDKLFPWRSMMLKSGPVFINFDCTMNICDYLQLCFICIPQKYRFLIYNQFYNLNLSLEDMLVEQETMTTNPSINNDNEKFLLSKKMHKKEKKEGHQHLATEHVKKDDLESTIIEEKKSLSLRENPIQTYEHLLTFLYVLRQLYVLRDIYSFKVSQIKKIDSYESFLTVSKQYKLSILFPVLRKLSYDINVPNFYFYGPLKAEDVVTYPKGIPEVSIYNLLIKALINKIEKQQINLLRSKITQKIDHVIKQRHYESETIDMEKSPYLIFKNSLKNPNLVADLIKKFEAPFQLAEKKEEEKAEGTKENESEDGKENEKEIENDNLVYSKMYVNKCLQYLANTLLRIHRETYESFAMYFENLLKHQQQLLLFRNREYYGLKEEFHEKEQSLSVERQFILANKVSERILEINYLRGKVKEDKQNIQNKENTLRRQTSLSFKFLIRNLYNLGFEQMTRIKVSRFKLHCDVYQRINATRLNAFYEMNKIKERSGAKYTTDDEIALRNLILTKKMSDARAVNFSLFQFIARMKSLFNWIYNYTVCDWENMLNENMNRTDRVKGLVFLVTVNAQQKVKLIKCEFKRLKVIISDTEKELSELKNTLNKEITQQTQKRQKAKLKHLSLKKTTIQKQKQISDLMNQLQEMNGQIATMKMKFESHIKNNKSVTVTSHNQVEKLSTILTDERRKKLNAFNKVDDLIAQVYEFEAGFAMVNTQSEASRGRVEKNYKARLLQTKTKKVDLRGNYPDLILHQRQLTYDAIIKRHCIPYTPCHFLPFRRDRVEAHRMKMRIQNRLIKKEPDSKVHSLPKLRKTGNLVKFQKN 2284          

HSP 2 Score: 1765.36 bits (4571), Expect = 0.000e+0
Identity = 861/861 (100.00%), Postives = 861/861 (100.00%), Query Frame = 1
Query: 1144 QERWGMDSAMRALLKPANWKPFNKFTPKINLLEARYLNKLRDEEIKDEFLITASLFLKKSNAEETQMNLRHHALVIQHLPVVYNTAVVTNPKGFDIADILKTIYTKCDVNLRTFTTDDKPNNDSSGDHDNYNFTEALQLLGLDESIETKDDSSTVQGAYLSYLHLRFLKIRDMQRTCLSILNYFRSVERTLVIDEYQFTKESVRPVKKSNPASSQDLDSSNFDNLGNHGYLQATVDDFKISIEDFMKTNEIENHDDFYLHENGRIHVQDLMGNWIMYDVALKDFEKLESDLILIGSYYITFDKEMRSSTLFNRKQSQSEHTEGSEFYILEYGHREVDRFGVLYDLWCQHTDFMEQKKKLFDLNMEVYNTVCKQEDRQHLAQTLINLMHHKPRIDLHSKYFLISYRYENMILERKFQIFKMILDKEISREREYLSKVYKDSDYPYRHIPHLLIAPNSDECALQEVHFLEFLPSLSQVCQINKMIDYASLNIKNLSSNTPVTSMLKKELDLLDTIYKEISEYEDITRQFTDPNLIKFLSQDSVICNPLIMEEIGRKYLKIIDSKNTRGEKKRRKIRCINEFSRLIELANIRFRLIHVLHETEYLHSIYDNQAITLGYDNFHLFMRQVPFERAVKTEGAEYYKPFLYXXXXXXXXXXXXKYRPEHPYPAIHELDNVHFGLFNLITINDIIQCLESKGLENLQVMLKVQFCHKNAVASGVLLCDYCRPSVYKSHKEKSLSHIESSLGQTVTTYNLPISAQSGPTPLALDSSRASIHALTDSYPEALFSLQLEKVPIRDKMLNNFLKKFPSPSTVSQVDMEKAKRDCITFFTNAFYDRIAHIALKAQIIAYYNSIINTLNAVPEIV 3726
            QERWGMDSAMRALLKPANWKPFNKFTPKINLLEARYLNKLRDEEIKDEFLITASLFLKKSNAEETQMNLRHHALVIQHLPVVYNTAVVTNPKGFDIADILKTIYTKCDVNLRTFTTDDKPNNDSSGDHDNYNFTEALQLLGLDESIETKDDSSTVQGAYLSYLHLRFLKIRDMQRTCLSILNYFRSVERTLVIDEYQFTKESVRPVKKSNPASSQDLDSSNFDNLGNHGYLQATVDDFKISIEDFMKTNEIENHDDFYLHENGRIHVQDLMGNWIMYDVALKDFEKLESDLILIGSYYITFDKEMRSSTLFNRKQSQSEHTEGSEFYILEYGHREVDRFGVLYDLWCQHTDFMEQKKKLFDLNMEVYNTVCKQEDRQHLAQTLINLMHHKPRIDLHSKYFLISYRYENMILERKFQIFKMILDKEISREREYLSKVYKDSDYPYRHIPHLLIAPNSDECALQEVHFLEFLPSLSQVCQINKMIDYASLNIKNLSSNTPVTSMLKKELDLLDTIYKEISEYEDITRQFTDPNLIKFLSQDSVICNPLIMEEIGRKYLKIIDSKNTRGEKKRRKIRCINEFSRLIELANIRFRLIHVLHETEYLHSIYDNQAITLGYDNFHLFMRQVPFERAVKTEGAEYYKPFLYVSSVQDDDSVVDKYRPEHPYPAIHELDNVHFGLFNLITINDIIQCLESKGLENLQVMLKVQFCHKNAVASGVLLCDYCRPSVYKSHKEKSLSHIESSLGQTVTTYNLPISAQSGPTPLALDSSRASIHALTDSYPEALFSLQLEKVPIRDKMLNNFLKKFPSPSTVSQVDMEKAKRDCITFFTNAFYDRIAHIALKAQIIAYYNSIINTLNAVPEIV
Sbjct:  359 QERWGMDSAMRALLKPANWKPFNKFTPKINLLEARYLNKLRDEEIKDEFLITASLFLKKSNAEETQMNLRHHALVIQHLPVVYNTAVVTNPKGFDIADILKTIYTKCDVNLRTFTTDDKPNNDSSGDHDNYNFTEALQLLGLDESIETKDDSSTVQGAYLSYLHLRFLKIRDMQRTCLSILNYFRSVERTLVIDEYQFTKESVRPVKKSNPASSQDLDSSNFDNLGNHGYLQATVDDFKISIEDFMKTNEIENHDDFYLHENGRIHVQDLMGNWIMYDVALKDFEKLESDLILIGSYYITFDKEMRSSTLFNRKQSQSEHTEGSEFYILEYGHREVDRFGVLYDLWCQHTDFMEQKKKLFDLNMEVYNTVCKQEDRQHLAQTLINLMHHKPRIDLHSKYFLISYRYENMILERKFQIFKMILDKEISREREYLSKVYKDSDYPYRHIPHLLIAPNSDECALQEVHFLEFLPSLSQVCQINKMIDYASLNIKNLSSNTPVTSMLKKELDLLDTIYKEISEYEDITRQFTDPNLIKFLSQDSVICNPLIMEEIGRKYLKIIDSKNTRGEKKRRKIRCINEFSRLIELANIRFRLIHVLHETEYLHSIYDNQAITLGYDNFHLFMRQVPFERAVKTEGAEYYKPFLYVSSVQDDDSVVDKYRPEHPYPAIHELDNVHFGLFNLITINDIIQCLESKGLENLQVMLKVQFCHKNAVASGVLLCDYCRPSVYKSHKEKSLSHIESSLGQTVTTYNLPISAQSGPTPLALDSSRASIHALTDSYPEALFSLQLEKVPIRDKMLNNFLKKFPSPSTVSQVDMEKAKRDCITFFTNAFYDRIAHIALKAQIIAYYNSIINTLNAVPEIV 1219          

HSP 3 Score: 722.235 bits (1863), Expect = 0.000e+0
Identity = 358/363 (98.62%), Postives = 359/363 (98.90%), Query Frame = 3
Query:   75 MDIPKNHEINQLDELLKMDVVELKAQIEENQLIYGLNNKDPSSIYTPKDPEFYXXXXXXXXXXQIDGQCTHTGKIVADTIKLEIECCEKFEYRDKSLLLLVYQYFKNRMKVLVNMKRSQMLRYKRYCINKTLTEFIKEHYNARLNAINTEYNDVRARYNRLKAAQEGFICNSDQGLEEITMDDIFIYMKWLIQHMYNMEYITTMVKIIRWIPIKYRKNNAAKAENDTDSFNKSESTYKYIRSTTSILQNRESSLTARHSQRTISNTRSDINLSAASGGGYAVDERNLLFPLHTNDMHYLEHLLIYFCEVYGINMDVHKIRNAADEMELYSVVSRRFKTVFNMQEQMRTFKVYDKIDSRTMGYG 1163
            MDIPKNHEINQLDELLKMDVVELKAQIEENQLIYGLNNKDPSSIYTPKDPEFYLKKRRLKLKRQIDGQCTHTGKIVADTIKLEIECCEKFEYRDKSLLLLVYQYFKNRMKVLVNMKRSQMLRYKRYCINKTLTEFIKEHYNARLNAINTEYNDVRARYNRLKAAQEGFICNSDQGLEEITMDDIFIYMKWLIQHMYNMEYITTMVKIIRWIPIKYRKNNAAKAENDTDSFNKSESTYKYIRSTTSILQNRESSLTARHSQRTISNTRSDINLSAASGGGYAVDERNLLFPLHTNDMHYLEHLLIYFCEVYGINMDVHKIRNAADEMELYSVVSRRFKTVFNMQEQMRTFKVYDKIDS    +G
Sbjct:    1 MDIPKNHEINQLDELLKMDVVELKAQIEENQLIYGLNNKDPSSIYTPKDPEFYLKKRRLKLKRQIDGQCTHTGKIVADTIKLEIECCEKFEYRDKSLLLLVYQYFKNRMKVLVNMKRSQMLRYKRYCINKTLTEFIKEHYNARLNAINTEYNDVRARYNRLKAAQEGFICNSDQGLEEITMDDIFIYMKWLIQHMYNMEYITTMVKIIRWIPIKYRKNNAAKAENDTDSFNKSESTYKYIRSTTSILQNRESSLTARHSQRTISNTRSDINLSAASGGGYAVDERNLLFPLHTNDMHYLEHLLIYFCEVYGINMDVHKIRNAADEMELYSVVSRRFKTVFNMQEQMRTFKVYDKIDSSQERWG 363          
BLAST of DUF4549 domain-containing protein vs. Planmine SMEST
Match: SMESG000002927.1 (SMESG000002927.1)

HSP 1 Score: 747.658 bits (1929), Expect = 0.000e+0
Identity = 398/876 (45.43%), Postives = 573/876 (65.41%), Query Frame = 1
Query: 1147 ERWGMDSAMRALLKPANWKPFNKFTPKINLLEARYLNKLRDEEIKDEFLITASLFLKKSNAEETQMNLRHHALVIQHLPVVYNTAVVTNPKGFDIADILKTIYTKCDVNLRTFTTDDKPNNDSSG---DHDNYNFTEALQLLGLDESIETKDDSSTVQGAYLSYLHLRFLKIRDMQRTCLSILNYFRSVERTLVIDEYQFTKESV---RPVKKSNPASSQDLDSSNFDNLGNHGYLQATVDDFKISIEDFMKTNEIENHDDFYLHENGRIHVQDLMGNWIMYDVALKDFEKLESDLILIGSYYITFDKEMRSSTLFNRKQSQSEHTEGSEFYILEYGHREVDRFGVLYDLWCQHTDFMEQKKKLFDLNMEVYNTVCKQEDRQHLAQTLINLMHHKPRIDLHSKYFLISYRYENMILERKFQIFKMILDKEISREREYLSKV---YKDSDYPYRHIPHLLIAPNSDECALQEVHFLEFLPSLSQVCQINKMIDYASLNIKNLSSNTPVTSMLKKELDLLDTIYKEISEYEDITRQFTDPNLIKFLSQDSVICNPLIMEEIGRKYLKIIDSKNTRGEKKRRKIRCINEFSRLIELANIRFRLIHVLHETEYLHSIYDNQAITLGYDNFHLFMRQVPFERAVKTEGAEYYKPFLYXXXXXXXXXXXXKYRPEHPYPAIHELDNVHFGLFNLITINDIIQCLESKGLENLQVMLKVQFCHKNAVASGVLLCDYCRPSVYKSHKEKSLSHI--------ESSLGQTVTTYNLPISAQSGPTPLALDSSRASIHALTDSYPEALFSLQLEKVPIRDKMLNNFLKKFPSPSTVSQVDMEKAKRDCITFFTNAFYDRIAHIALKAQIIAYYNSIINTLNAVPEI 3723
            E+WG+D+  + +LKPANW P+ K  PK +L   +Y+ +LR +   DE L  A+ F+  +N +  Q  LRHHAL++QH PV+++ AV+++ +G +I++I K IY    +N   F   +   NDSS     HDNY F + +Q+LGLD+S ETKDD S+VQGAYLSYLHLR LKIRD+QRTCLSILNYFRSVERT+VI++   +  +    R  +     SS         N+G+HGYL  T  +F+I+  DFM+  E+ENHDDFY HE+GRIHV+D  G+WI+YDVA+ DFEKLE DL+LI S +I  +K +RS++LF RK+ + E ++  +F I +Y H EVDRFGVL+D+W  HT  +E KKK+ D+ ME YN    +++R+ ++Q+++NLM+ KPRID+ S YF+ +YR E  IL  +  IF+ +L+K+I  +REY+  +    +D   P   +  LLIA N+DE  L+ ++FLEF  SLS +C + + +++    I      T VT  +  E  + + +  EI   + +   +T P + + L     I NP+++ ++  +YLK IDS+NTRG+K+ RKI+ INEF RL E+  +RFRL+    E+E L  IY  QAI LGYD FHL++R + FE A K EGAE  KP LY+S++QDDDS +DK+ P     AI+E+D V  G F+      +++ LESKG+ENL ++LK+Q CHKNA+A+GV LC+ CRPS+Y + KE+ L           +S+     + +++PISAQ+GPTPLALDS RA      D++PEA FS+QLEK P RD+ +N ++KKF      S V++EK KRD +  + + F+DRI   +L++QII YYNSII+ L  VP +
Sbjct:  366 EKWGLDTYTKCVLKPANWLPYIKLKPKTHLTVVKYITRLRADNKIDELLRAAARFISLTNCDRVQDALRHHALLVQHPPVIHSAAVISHRQGINISEIFKKIY----MNQELFNPSNPTKNDSSSINETHDNYEFNQTMQMLGLDDSNETKDDPSSVQGAYLSYLHLRHLKIRDLQRTCLSILNYFRSVERTIVINDQGLSLNNGVGDRSYQNHRSGSSIPGHQGGGGNIGSHGYLFNTPREFRINENDFMQFAEVENHDDFYFHEDGRIHVRDQTGHWIIYDVAVSDFEKLEHDLLLIASVFIGKNKTLRSASLFKRKRQRLEESQSGDFDIGQYAHHEVDRFGVLFDIWTNHTALLECKKKILDIYMEAYNNTFNRDERRLMSQSMVNLMYKKPRIDVESAYFVTAYRLECTILRMQADIFRTLLNKQIDNQREYIKMIGDNVQDFGLPLPVVEKLLIAVNADESVLKNIYFLEFHESLSIICHVTESLEWCFKEILYNCKPTTVTHEILLEKKMYEIMQVEIDSMDSLGVSYT-PQVQRDLFSGFFIENPIMLTQLADEYLKNIDSRNTRGDKRSRKIKLINEFGRLYEIITLRFRLLDATWESEVLAKIYQRQAIDLGYDEFHLYLRPIQFEAAKKKEGAELAKPLLYISTIQDDDSAMDKFTPSALPLAINEVDEVGMGKFSFKGRTSVMEMLESKGVENLMIVLKIQLCHKNALAAGVSLCNACRPSLY-TLKERDLDACNPTDLRSEKSTTTGANSNFSVPISAQAGPTPLALDSKRADSFNQKDAHPEAFFSIQLEKSPCRDRAMNIYIKKFSGTGKTSGVEVEKVKRDLVLSYIDDFFDRIQQASLRSQIIYYYNSIIHVLKLVPTV 1235          

HSP 2 Score: 505.753 bits (1301), Expect = 0.000e+0
Identity = 318/970 (32.78%), Postives = 541/970 (55.77%), Query Frame = 2
Query: 3728 FFQFGKAFNPAKSTVDANCNLDKNPKKLHNRCRKVIDDDGQKLINIWYIPHFSEILFLYRQTEDAKANLILYNFLRLVMAFHDIIQYVVGFWKFGFNSTRVPEKMKMK-INKIYNLPTDTNSQNIVHHLH-CDEVADLSYFTDYNTTNTYQLRKEFVDLEIQIEHLPNPYDLEQVIDLLNIRRKYHFYYFEICATLLLKELFLSTDNIHCYKKLMNGIQSSIPTIRNVRYTKHISEGLCIPSLISETDPEIDKLFPWRSMMLKSGPVFINFDCTMNICDYLQLCFICIPQKYRFLIYNQFYNLNLSLEDMLVEQETMTTNPSINNDNXXXXXXXXXXXXXXXXXXXXXATEHVKKDDLESTIIEEKKSLSLRENPIQTYEHLLTFLYVLRQLYVLRDIYSFKVSQIKKIDSYESFLTVSKQYKLSILFPVLRKLSYDINVPNFYFYGPLKAEDVVTYPKGIPEVSIYNLLIKALINKIEKQQINLLRSKITQKIDHVIKQRHYESETI--DMEKSPYLIFKNSLKNPNLVADLIKKFEAPFQLAXXXXXXXXXXXXXXXXXDGKENEKEIENDNLVYSKMYVNKCLQYLANTLLRIHRETYESFAMYFENLLKHQQQLLLFRNREYYGLKEEFHEKEQSLSVERQFILANKVSERILEINYLRGKVKEDKQNIQNKENTLRRQTSLSFKFLIRNLYNLGFEQMTRIKVSRFKLHCDVYQRINATRLNAFYEMNKIKERSGAKYTTDDEIALRNLILTKKMSDARAVNFSLFQFIARMKSLFNWIYNYTVCDWENMLNENMNRTDRVKGLVFLVTVNAQQKVKLIKCEFKRLKVIISDTEKELSELKNTLNKEITQQTQKRQKAKLKHLSLXXXXXXXXXXXSDLMNQLQEMNGQIATMKMKFESHIKNNKSVTVTSHNQVEKLSTILTDERRKKLNAFNKVDDLIAQVYEFEAGFAMV--NTQSEASRGR 6619
            FFQFG AF       D   N + +P+KL  R R+++ ++G K +N+W+IPHF+EILFLYRQ +D +    L N + +V  FHDI+ ++VGF +   +S ++  ++K + ++   ++    +SQ ++      +E  +++   DY+     QL  E ++++ QI HL +P +++ VI+LL+ RR   F  FE C +  L E FL+T N+  +K +   ++     + NV+    IS  L +P  +   D    +L+P+RS++ + GP  I  D   NI + +QL    +    R  ++ +F +LNL LED+L E     +      +   F     + KK  K+  + +A   V     + +  ++ K L++  +PIQ Y+ +  ++ + ++L +L++ +  +   ++ I++ + F   +K YK+  L+P+++ L     +P+    GP    D+   PKGIPE+ +    +  +I   E   I  LR +I ++ D V+K+R+ E   +  D+ K P +    S+K P +  D + +      L                      +EK + +D L ++K ++NKCLQ LA ++L + +E+YE++AMY+EN LKHQ QLL  R RE   +K++  +KE +  V+ QF LA++    +LE+N LR KV E +++   +E T+R +    +  +++NL+++ FEQ T+I V R  LH    +RI   R  A  EMNK+KE+SGAK T DDE+A RNL L+K+++     N  L Q ++RMKSLFNW + +  C+++  + +     D+ K  V +V +N++QKV+++  E  RLK  ++ TEKEL++L+ TL+KE+ ++  K+  A+ K  + K+  + KQ  I  LM+++ E N  IATM      ++K++K+V   S  +V+ L   L +ER+ K +AF KVDDLI+QVYEFEA FA+V  NT      G+
Sbjct: 1239 FFQFGDAFEKKNDPEDNMSNEEIDPRKLRKRARRILSENGSKFLNLWFIPHFTEILFLYRQRDDERTTENLKNLVNIVGNFHDILHFLVGFSRLQISSAKISTELKAENVDVNDSIEHSLSSQFVIQIAQGAEEGIEINRPRDYDGGVMSQLSTELIEIDHQISHLMDPTEVKAVIELLSTRRNVTFLKFEYCISHALLETFLATRNVKAFKAVSANMKFPFEELTNVQRATTISFRLNVPEPLEARDQRARELYPYRSIINQLGPYLIMHDFWKNIQENIQLVLAGLSDVDRPTVHGEFVSLNLCLEDVLAEGNLPESRAGRKLNMNDFENVLLLGKKFHKKDKKEVALVPVDNLGNQPSSDDKNKKLNIITHPIQCYKLMRNYIILSKRLNLLKNFWGARKLGLEAIENPDDFNMFNKIYKIEKLYPLMKSLCIQYRLPDLAHQGPFADTDIFVTPKGIPEIVVKQRQLGKMIETFESTMIGDLRKRIIRQTDQVMKERNREEGNLPLDLWKKPAMKEAISVKRPVIAEDFVSELMQNTDL---------------------NDEKTLISDTLTFTKEHLNKCLQNLAISVLHMQKESYENYAMYYENQLKHQHQLLYAREREIEDMKQQLLQKELATIVDVQFQLADQAHSLLLEVNALRAKVAEMREDSLQQEQTIREEVRQEYNSMVQNLFSVAFEQKTQIDVYREYLHDATLKRIQEVRTEAAIEMNKVKEKSGAKVTADDELAERNLKLSKELTSLHQQNIHLKQMMSRMKSLFNWHHTFIKCNFQKAIAKIEKDRDKYKNSVTVVEMNSEQKVQIMGEELDRLKHYLTSTEKELNDLRKTLDKEMKEKMDKKHAAERKAATDKQMALVKQMHIDQLMSEITEKNSNIATMSRVLNENMKSHKTVADKSVREVDALRKSLREERKMKQSAFTKVDDLISQVYEFEAAFAIVKGNTPINGVTGK 2187          

HSP 3 Score: 278.485 bits (711), Expect = 1.119e-74
Identity = 151/362 (41.71%), Postives = 235/362 (64.92%), Query Frame = 3
Query:  108 LDELLKMDVVELKAQIEENQLIYGLNNKDPSSIYTPKDPEFYXXXXXXXXXXQIDGQCTHTGKIVADTIKLEIECCEKFEYRDKSLLLLVYQYFKNRMKVLVNMKRSQMLRYKRYCINKTLTEFIKEHYNARLNAINTEYNDVRARYNRLKAAQEGFICNSDQGLEEITMDDIFIYMKWLIQHMYNMEYITTMVKIIRWIPIKYRKNNAAKAEND-----TDSFNKSESTYKYIRSTTSILQNRESSLTARHSQRTISNTR----SDINLS-AASGGGYAVDERNLLFPLHTNDMHYLEHLLIYFCEVYGINMDVHKIRNAADEMELYSVVSRRFKTVFNMQEQMRTFKVYDKIDSRTMGYG 1163
            L++ L+ +++ELK+QIEENQL+YG+ +K  SSIY PKDP+ + ++R+L L+R +        K+ A+ ++LE+  C+  EY +KS+ LL++QYF +R++ ++  K + +LR+KRYCIN  + E I   Y  RL  I  EY D  +R +RL   +EGF+ N++QG++E+  DD+ IY++WLI H+ +++ +    +II+W PI +RK  +A   +      +D  +KSE ++  I +T     N E+ L       T  +T+    ++ NLS AA+GGG   DE+NL  PLHTND+++L   LI +C +YGI MDV  I+++ADEMELY+ V+R+FKT FN+QEQM  FK YD I S +  +G
Sbjct:   12 LEDSLRSEIIELKSQIEENQLVYGIPSKGMSSIYVPKDPDHFRRQRKLILQRTLQVTDERPIKVQAEVMRLELISCDSREYTEKSVPLLIHQYFLDRIQEMLASKYAHLLRWKRYCINTAIIESIYPEYKERLQHIMDEYLDSSSRCHRLATCREGFLSNTEQGVDELNTDDMIIYLRWLICHLQSLKLLIQTNRIIQWFPIAHRKEFSATIVDCVEIKLSDDQSKSERSFTKIPATF----NDEAPLPPPLVAATFVSTKPLKPTEFNLSLAAAGGGMVTDEKNLNLPLHTNDLNHLRSHLIVYCNMYGIEMDVVGIQSSADEMELYASVNRKFKTHFNLQEQMNIFKTYDFIVSGSEKWG 369          
BLAST of DUF4549 domain-containing protein vs. Planmine SMEST
Match: SMESG000002927.1 (SMESG000002927.1)

HSP 1 Score: 747.658 bits (1929), Expect = 0.000e+0
Identity = 398/876 (45.43%), Postives = 573/876 (65.41%), Query Frame = 1
Query: 1147 ERWGMDSAMRALLKPANWKPFNKFTPKINLLEARYLNKLRDEEIKDEFLITASLFLKKSNAEETQMNLRHHALVIQHLPVVYNTAVVTNPKGFDIADILKTIYTKCDVNLRTFTTDDKPNNDSSG---DHDNYNFTEALQLLGLDESIETKDDSSTVQGAYLSYLHLRFLKIRDMQRTCLSILNYFRSVERTLVIDEYQFTKESV---RPVKKSNPASSQDLDSSNFDNLGNHGYLQATVDDFKISIEDFMKTNEIENHDDFYLHENGRIHVQDLMGNWIMYDVALKDFEKLESDLILIGSYYITFDKEMRSSTLFNRKQSQSEHTEGSEFYILEYGHREVDRFGVLYDLWCQHTDFMEQKKKLFDLNMEVYNTVCKQEDRQHLAQTLINLMHHKPRIDLHSKYFLISYRYENMILERKFQIFKMILDKEISREREYLSKV---YKDSDYPYRHIPHLLIAPNSDECALQEVHFLEFLPSLSQVCQINKMIDYASLNIKNLSSNTPVTSMLKKELDLLDTIYKEISEYEDITRQFTDPNLIKFLSQDSVICNPLIMEEIGRKYLKIIDSKNTRGEKKRRKIRCINEFSRLIELANIRFRLIHVLHETEYLHSIYDNQAITLGYDNFHLFMRQVPFERAVKTEGAEYYKPFLYXXXXXXXXXXXXKYRPEHPYPAIHELDNVHFGLFNLITINDIIQCLESKGLENLQVMLKVQFCHKNAVASGVLLCDYCRPSVYKSHKEKSLSHI--------ESSLGQTVTTYNLPISAQSGPTPLALDSSRASIHALTDSYPEALFSLQLEKVPIRDKMLNNFLKKFPSPSTVSQVDMEKAKRDCITFFTNAFYDRIAHIALKAQIIAYYNSIINTLNAVPEI 3723
            E+WG+D+  + +LKPANW P+ K  PK +L   +Y+ +LR +   DE L  A+ F+  +N +  Q  LRHHAL++QH PV+++ AV+++ +G +I++I K IY    +N   F   +   NDSS     HDNY F + +Q+LGLD+S ETKDD S+VQGAYLSYLHLR LKIRD+QRTCLSILNYFRSVERT+VI++   +  +    R  +     SS         N+G+HGYL  T  +F+I+  DFM+  E+ENHDDFY HE+GRIHV+D  G+WI+YDVA+ DFEKLE DL+LI S +I  +K +RS++LF RK+ + E ++  +F I +Y H EVDRFGVL+D+W  HT  +E KKK+ D+ ME YN    +++R+ ++Q+++NLM+ KPRID+ S YF+ +YR E  IL  +  IF+ +L+K+I  +REY+  +    +D   P   +  LLIA N+DE  L+ ++FLEF  SLS +C + + +++    I      T VT  +  E  + + +  EI   + +   +T P + + L     I NP+++ ++  +YLK IDS+NTRG+K+ RKI+ INEF RL E+  +RFRL+    E+E L  IY  QAI LGYD FHL++R + FE A K EGAE  KP LY+S++QDDDS +DK+ P     AI+E+D V  G F+      +++ LESKG+ENL ++LK+Q CHKNA+A+GV LC+ CRPS+Y + KE+ L           +S+     + +++PISAQ+GPTPLALDS RA      D++PEA FS+QLEK P RD+ +N ++KKF      S V++EK KRD +  + + F+DRI   +L++QII YYNSII+ L  VP +
Sbjct:  366 EKWGLDTYTKCVLKPANWLPYIKLKPKTHLTVVKYITRLRADNKIDELLRAAARFISLTNCDRVQDALRHHALLVQHPPVIHSAAVISHRQGINISEIFKKIY----MNQELFNPSNPTKNDSSSINETHDNYEFNQTMQMLGLDDSNETKDDPSSVQGAYLSYLHLRHLKIRDLQRTCLSILNYFRSVERTIVINDQGLSLNNGVGDRSYQNHRSGSSIPGHQGGGGNIGSHGYLFNTPREFRINENDFMQFAEVENHDDFYFHEDGRIHVRDQTGHWIIYDVAVSDFEKLEHDLLLIASVFIGKNKTLRSASLFKRKRQRLEESQSGDFDIGQYAHHEVDRFGVLFDIWTNHTALLECKKKILDIYMEAYNNTFNRDERRLMSQSMVNLMYKKPRIDVESAYFVTAYRLECTILRMQADIFRTLLNKQIDNQREYIKMIGDNVQDFGLPLPVVEKLLIAVNADESVLKNIYFLEFHESLSIICHVTESLEWCFKEILYNCKPTTVTHEILLEKKMYEIMQVEIDSMDSLGVSYT-PQVQRDLFSGFFIENPIMLTQLADEYLKNIDSRNTRGDKRSRKIKLINEFGRLYEIITLRFRLLDATWESEVLAKIYQRQAIDLGYDEFHLYLRPIQFEAAKKKEGAELAKPLLYISTIQDDDSAMDKFTPSALPLAINEVDEVGMGKFSFKGRTSVMEMLESKGVENLMIVLKIQLCHKNALAAGVSLCNACRPSLY-TLKERDLDACNPTDLRSEKSTTTGANSNFSVPISAQAGPTPLALDSKRADSFNQKDAHPEAFFSIQLEKSPCRDRAMNIYIKKFSGTGKTSGVEVEKVKRDLVLSYIDDFFDRIQQASLRSQIIYYYNSIIHVLKLVPTV 1235          

HSP 2 Score: 544.273 bits (1401), Expect = 0.000e+0
Identity = 343/1053 (32.57%), Postives = 586/1053 (55.65%), Query Frame = 2
Query: 3728 FFQFGKAFNPAKSTVDANCNLDKNPKKLHNRCRKVIDDDGQKLINIWYIPHFSEILFLYRQTEDAKANLILYNFLRLVMAFHDIIQYVVGFWKFGFNSTRVPEKMKMK-INKIYNLPTDTNSQNIVHHLH-CDEVADLSYFTDYNTTNTYQLRKEFVDLEIQIEHLPNPYDLEQVIDLLNIRRKYHFYYFEICATLLLKELFLSTDNIHCYKKLMNGIQSSIPTIRNVRYTKHISEGLCIPSLISETDPEIDKLFPWRSMMLKSGPVFINFDCTMNICDYLQLCFICIPQKYRFLIYNQFYNLNLSLEDMLVEQETMTTNPSINNDNXXXXXXXXXXXXXXXXXXXXXATEHVKKDDLESTIIEEKKSLSLRENPIQTYEHLLTFLYVLRQLYVLRDIYSFKVSQIKKIDSYESFLTVSKQYKLSILFPVLRKLSYDINVPNFYFYGPLKAEDVVTYPKGIPEVSIYNLLIKALINKIEKQQINLLRSKITQKIDHVIKQRHYESETI--DMEKSPYLIFKNSLKNPNLVADLIKKFEAPFQLAXXXXXXXXXXXXXXXXXDGKENEKEIENDNLVYSKMYVNKCLQYLANTLLRIHRETYESFAMYFENLLKHQQQLLLFRNREYYGLKEEFHEKEQSLSVERQFILANKVSERILEINYLRGKVKEDKQNIQNKENTLRRQTSLSFKFLIRNLYNLGFEQMTRIKVSRFKLHCDVYQRINATRLNAFYEMNKIKERSGAKYTTDDEIALRNLILTKKMSDARAVNFSLFQFIARMKSLFNWIYNYTVCDWENMLNENMNRTDRVKGLVFLVTVNAQQKVKLIKCEFKRLKVIISDTEKELSELKNTLNKEITQQTQKRQKAKLKHLSLXXXXXXXXXXXSDLMNQLQEMNGQIATMKMKFESHIKNNKSVTVTSHNQVEKLSTILTDERRKKLNAFNKVDDLIAQVYEFEAGFAMV--NTQSEASRGRVEKNYK-ARLLQTKTKKVDLRGNY----PDLIL-----HQRQLTYDAIIKRHCIPYTPCHFLPFRRDRVEAHRMKMRIQNRLI 6838
            FFQFG AF       D   N + +P+KL  R R+++ ++G K +N+W+IPHF+EILFLYRQ +D +    L N + +V  FHDI+ ++VGF +   +S ++  ++K + ++   ++    +SQ ++      +E  +++   DY+     QL  E ++++ QI HL +P +++ VI+LL+ RR   F  FE C +  L E FL+T N+  +K +   ++     + NV+    IS  L +P  +   D    +L+P+RS++ + GP  I  D   NI + +QL    +    R  ++ +F +LNL LED+L E     +      +   F     + KK  K+  + +A   V     + +  ++ K L++  +PIQ Y+ +  ++ + ++L +L++ +  +   ++ I++ + F   +K YK+  L+P+++ L     +P+    GP    D+   PKGIPE+ +    +  +I   E   I  LR +I ++ D V+K+R+ E   +  D+ K P +    S+K P +  D + +      L                      +EK + +D L ++K ++NKCLQ LA ++L + +E+YE++AMY+EN LKHQ QLL  R RE   +K++  +KE +  V+ QF LA++    +LE+N LR KV E +++   +E T+R +    +  +++NL+++ FEQ T+I V R  LH    +RI   R  A  EMNK+KE+SGAK T DDE+A RNL L+K+++     N  L Q ++RMKSLFNW + +  C+++  + +     D+ K  V +V +N++QKV+++  E  RLK  ++ TEKEL++L+ TL+KE+ ++  K+  A+ K  + K+  + KQ  I  LM+++ E N  IATM      ++K++K+V   S  +V+ L   L +ER+ K +AF KVDDLI+QVYEFEA FA+V  NT      G+   +   +++ +  T   +LR  +    PD+ +       R +TY  I++R+ IPY P H+  FRRDRV  H+++ RI ++L+
Sbjct: 1239 FFQFGDAFEKKNDPEDNMSNEEIDPRKLRKRARRILSENGSKFLNLWFIPHFTEILFLYRQRDDERTTENLKNLVNIVGNFHDILHFLVGFSRLQISSAKISTELKAENVDVNDSIEHSLSSQFVIQIAQGAEEGIEINRPRDYDGGVMSQLSTELIEIDHQISHLMDPTEVKAVIELLSTRRNVTFLKFEYCISHALLETFLATRNVKAFKAVSANMKFPFEELTNVQRATTISFRLNVPEPLEARDQRARELYPYRSIINQLGPYLIMHDFWKNIQENIQLVLAGLSDVDRPTVHGEFVSLNLCLEDVLAEGNLPESRAGRKLNMNDFENVLLLGKKFHKKDKKEVALVPVDNLGNQPSSDDKNKKLNIITHPIQCYKLMRNYIILSKRLNLLKNFWGARKLGLEAIENPDDFNMFNKIYKIEKLYPLMKSLCIQYRLPDLAHQGPFADTDIFVTPKGIPEIVVKQRQLGKMIETFESTMIGDLRKRIIRQTDQVMKERNREEGNLPLDLWKKPAMKEAISVKRPVIAEDFVSELMQNTDL---------------------NDEKTLISDTLTFTKEHLNKCLQNLAISVLHMQKESYENYAMYYENQLKHQHQLLYAREREIEDMKQQLLQKELATIVDVQFQLADQAHSLLLEVNALRAKVAEMREDSLQQEQTIREEVRQEYNSMVQNLFSVAFEQKTQIDVYREYLHDATLKRIQEVRTEAAIEMNKVKEKSGAKVTADDELAERNLKLSKELTSLHQQNIHLKQMMSRMKSLFNWHHTFIKCNFQKAIAKIEKDRDKYKNSVTVVEMNSEQKVQIMGEELDRLKHYLTSTEKELNDLRKTLDKEMKEKMDKKHAAERKAATDKQMALVKQMHIDQLMSEITEKNSNIATMSRVLNENMKSHKTVADKSVREVDALRKSLREERKMKQSAFTKVDDLISQVYEFEAAFAIVKGNTPINGVTGKNSDSISCSQISRPSTGISNLRSGFKPITPDMKVSTDKSRPRPITYGDILRRYPIPYAPDHYRDFRRDRVGTHQLRKRIADQLL 2270          

HSP 3 Score: 278.1 bits (710), Expect = 1.513e-74
Identity = 151/362 (41.71%), Postives = 235/362 (64.92%), Query Frame = 3
Query:  108 LDELLKMDVVELKAQIEENQLIYGLNNKDPSSIYTPKDPEFYXXXXXXXXXXQIDGQCTHTGKIVADTIKLEIECCEKFEYRDKSLLLLVYQYFKNRMKVLVNMKRSQMLRYKRYCINKTLTEFIKEHYNARLNAINTEYNDVRARYNRLKAAQEGFICNSDQGLEEITMDDIFIYMKWLIQHMYNMEYITTMVKIIRWIPIKYRKNNAAKAEND-----TDSFNKSESTYKYIRSTTSILQNRESSLTARHSQRTISNTR----SDINLS-AASGGGYAVDERNLLFPLHTNDMHYLEHLLIYFCEVYGINMDVHKIRNAADEMELYSVVSRRFKTVFNMQEQMRTFKVYDKIDSRTMGYG 1163
            L++ L+ +++ELK+QIEENQL+YG+ +K  SSIY PKDP+ + ++R+L L+R +        K+ A+ ++LE+  C+  EY +KS+ LL++QYF +R++ ++  K + +LR+KRYCIN  + E I   Y  RL  I  EY D  +R +RL   +EGF+ N++QG++E+  DD+ IY++WLI H+ +++ +    +II+W PI +RK  +A   +      +D  +KSE ++  I +T     N E+ L       T  +T+    ++ NLS AA+GGG   DE+NL  PLHTND+++L   LI +C +YGI MDV  I+++ADEMELY+ V+R+FKT FN+QEQM  FK YD I S +  +G
Sbjct:   12 LEDSLRSEIIELKSQIEENQLVYGIPSKGMSSIYVPKDPDHFRRQRKLILQRTLQVTDERPIKVQAEVMRLELISCDSREYTEKSVPLLIHQYFLDRIQEMLASKYAHLLRWKRYCINTAIIESIYPEYKERLQHIMDEYLDSSSRCHRLATCREGFLSNTEQGVDELNTDDMIIYLRWLICHLQSLKLLIQTNRIIQWFPIAHRKEFSATIVDCVEIKLSDDQSKSERSFTKIPATF----NDEAPLPPPLVAATFVSTKPLKPTEFNLSLAAAGGGMVTDEKNLNLPLHTNDLNHLRSHLIVYCNMYGIEMDVVGIQSSADEMELYASVNRKFKTHFNLQEQMNIFKTYDFIVSGSEKWG 369          
BLAST of DUF4549 domain-containing protein vs. Planmine SMEST
Match: SMESG000002927.1 (SMESG000002927.1)

HSP 1 Score: 746.888 bits (1927), Expect = 0.000e+0
Identity = 398/876 (45.43%), Postives = 573/876 (65.41%), Query Frame = 1
Query: 1147 ERWGMDSAMRALLKPANWKPFNKFTPKINLLEARYLNKLRDEEIKDEFLITASLFLKKSNAEETQMNLRHHALVIQHLPVVYNTAVVTNPKGFDIADILKTIYTKCDVNLRTFTTDDKPNNDSSG---DHDNYNFTEALQLLGLDESIETKDDSSTVQGAYLSYLHLRFLKIRDMQRTCLSILNYFRSVERTLVIDEYQFTKESV---RPVKKSNPASSQDLDSSNFDNLGNHGYLQATVDDFKISIEDFMKTNEIENHDDFYLHENGRIHVQDLMGNWIMYDVALKDFEKLESDLILIGSYYITFDKEMRSSTLFNRKQSQSEHTEGSEFYILEYGHREVDRFGVLYDLWCQHTDFMEQKKKLFDLNMEVYNTVCKQEDRQHLAQTLINLMHHKPRIDLHSKYFLISYRYENMILERKFQIFKMILDKEISREREYLSKV---YKDSDYPYRHIPHLLIAPNSDECALQEVHFLEFLPSLSQVCQINKMIDYASLNIKNLSSNTPVTSMLKKELDLLDTIYKEISEYEDITRQFTDPNLIKFLSQDSVICNPLIMEEIGRKYLKIIDSKNTRGEKKRRKIRCINEFSRLIELANIRFRLIHVLHETEYLHSIYDNQAITLGYDNFHLFMRQVPFERAVKTEGAEYYKPFLYXXXXXXXXXXXXKYRPEHPYPAIHELDNVHFGLFNLITINDIIQCLESKGLENLQVMLKVQFCHKNAVASGVLLCDYCRPSVYKSHKEKSLSHI--------ESSLGQTVTTYNLPISAQSGPTPLALDSSRASIHALTDSYPEALFSLQLEKVPIRDKMLNNFLKKFPSPSTVSQVDMEKAKRDCITFFTNAFYDRIAHIALKAQIIAYYNSIINTLNAVPEI 3723
            E+WG+D+  + +LKPANW P+ K  PK +L   +Y+ +LR +   DE L  A+ F+  +N +  Q  LRHHAL++QH PV+++ AV+++ +G +I++I K IY    +N   F   +   NDSS     HDNY F + +Q+LGLD+S ETKDD S+VQGAYLSYLHLR LKIRD+QRTCLSILNYFRSVERT+VI++   +  +    R  +     SS         N+G+HGYL  T  +F+I+  DFM+  E+ENHDDFY HE+GRIHV+D  G+WI+YDVA+ DFEKLE DL+LI S +I  +K +RS++LF RK+ + E ++  +F I +Y H EVDRFGVL+D+W  HT  +E KKK+ D+ ME YN    +++R+ ++Q+++NLM+ KPRID+ S YF+ +YR E  IL  +  IF+ +L+K+I  +REY+  +    +D   P   +  LLIA N+DE  L+ ++FLEF  SLS +C + + +++    I      T VT  +  E  + + +  EI   + +   +T P + + L     I NP+++ ++  +YLK IDS+NTRG+K+ RKI+ INEF RL E+  +RFRL+    E+E L  IY  QAI LGYD FHL++R + FE A K EGAE  KP LY+S++QDDDS +DK+ P     AI+E+D V  G F+      +++ LESKG+ENL ++LK+Q CHKNA+A+GV LC+ CRPS+Y + KE+ L           +S+     + +++PISAQ+GPTPLALDS RA      D++PEA FS+QLEK P RD+ +N ++KKF      S V++EK KRD +  + + F+DRI   +L++QII YYNSII+ L  VP +
Sbjct:  366 EKWGLDTYTKCVLKPANWLPYIKLKPKTHLTVVKYITRLRADNKIDELLRAAARFISLTNCDRVQDALRHHALLVQHPPVIHSAAVISHRQGINISEIFKKIY----MNQELFNPSNPTKNDSSSINETHDNYEFNQTMQMLGLDDSNETKDDPSSVQGAYLSYLHLRHLKIRDLQRTCLSILNYFRSVERTIVINDQGLSLNNGVGDRSYQNHRSGSSIPGHQGGGGNIGSHGYLFNTPREFRINENDFMQFAEVENHDDFYFHEDGRIHVRDQTGHWIIYDVAVSDFEKLEHDLLLIASVFIGKNKTLRSASLFKRKRQRLEESQSGDFDIGQYAHHEVDRFGVLFDIWTNHTALLECKKKILDIYMEAYNNTFNRDERRLMSQSMVNLMYKKPRIDVESAYFVTAYRLECTILRMQADIFRTLLNKQIDNQREYIKMIGDNVQDFGLPLPVVEKLLIAVNADESVLKNIYFLEFHESLSIICHVTESLEWCFKEILYNCKPTTVTHEILLEKKMYEIMQVEIDSMDSLGVSYT-PQVQRDLFSGFFIENPIMLTQLADEYLKNIDSRNTRGDKRSRKIKLINEFGRLYEIITLRFRLLDATWESEVLAKIYQRQAIDLGYDEFHLYLRPIQFEAAKKKEGAELAKPLLYISTIQDDDSAMDKFTPSALPLAINEVDEVGMGKFSFKGRTSVMEMLESKGVENLMIVLKIQLCHKNALAAGVSLCNACRPSLY-TLKERDLDACNPTDLRSEKSTTTGANSNFSVPISAQAGPTPLALDSKRADSFNQKDAHPEAFFSIQLEKSPCRDRAMNIYIKKFSGTGKTSGVEVEKVKRDLVLSYIDDFFDRIQQASLRSQIIYYYNSIIHVLKLVPTV 1235          

HSP 2 Score: 533.487 bits (1373), Expect = 0.000e+0
Identity = 342/1051 (32.54%), Postives = 575/1051 (54.71%), Query Frame = 2
Query: 3728 FFQFGKAFNPAKSTVDANCNLDKNPKKLHNRCRKVIDDDGQKLINIWYIPHFSEILFLYRQTEDAKANLILYNFLRLVMAFHDIIQYVVGFWKFGFNSTRVPEKMKMKINKIYNLPTDTNSQNIVHHLHCDEVADLSYFTDYNTTNTYQLRKEFVDLEIQIEHLPNPYDLEQVIDLLNIRRKYHFYYFEICATLLLKELFLSTDNIHCYKKLMNGIQSSIPTIRNVRYTKHISEGLCIPSLISETDPEIDKLFPWRSMMLKSGPVFINFDCTMNICDYLQLCFICIPQKYRFLIYNQFYNLNLSLEDMLVEQETMTTNPSINNDNXXXXXXXXXXXXXXXXXXXXXATEHVKKDDLESTIIEEKKSLSLRENPIQTYEHLLTFLYVLRQLYVLRDIYSFKVSQIKKIDSYESFLTVSKQYKLSILFPVLRKLSYDINVPNFYFYGPLKAEDVVTYPKGIPEVSIYNLLIKALINKIEKQQINLLRSKITQKIDHVIKQRHYESETI--DMEKSPYLIFKNSLKNPNLVADLIKKFEAPFQLAXXXXXXXXXXXXXXXXXDGKENEKEIENDNLVYSKMYVNKCLQYLANTLLRIHRETYESFAMYFENLLKHQQQLLLFRNREYYGLKEEFHEKEQSLSVERQFILANKVSERILEINYLRGKVKEDKQNIQNKENTLRRQTSLSFKFLIRNLYNLGFEQMTRIKVSRFKLHCDVYQRINATRLNAFYEMNKIKERSGAKYTTDDEIALRNLILTKKMSDARAVNFSLFQFIARMKSLFNWIYNYTVCDWENMLNENMNRTDRVKGLVFLVTVNAQQKVKLIKCEFKRLKVIISDTEKELSELKNTLNKEITQQTQKRQKAKLKHLSLXXXXXXXXXXXSDLMNQLQEMNGQIATMKMKFESHIKNNKSVTVTSHNQVEKLSTILTDERRKKLNAFNKVDDLIAQVYEFEAGFAMV--NTQSEASRGRVEKNYK-ARLLQTKTKKVDLRGNY----PDLIL-----HQRQLTYDAIIKRHCIPYTPCHFLPFRRDRVEAHRMKMRIQNRLI 6838
            FFQFG AF       D   N + +P+KL  R R+++ ++G K +N+W+IPHF+EILFLYRQ +D +    L N + +V  FHDI+ ++VGF +   +S ++  ++K +         D N  +I H L    V+                  E ++++ QI HL +P +++ VI+LL+ RR   F  FE C +  L E FL+T N+  +K +   ++     + NV+    IS  L +P  +   D    +L+P+RS++ + GP  I  D   NI + +QL    +    R  ++ +F +LNL LED+L E     +      +   F     + KK  K+  + +A   V     + +  ++ K L++  +PIQ Y+ +  ++ + ++L +L++ +  +   ++ I++ + F   +K YK+  L+P+++ L     +P+    GP    D+   PKGIPE+ +    +  +I   E   I  LR +I ++ D V+K+R+ E   +  D+ K P +    S+K P +  D + +      L                      +EK + +D L ++K ++NKCLQ LA ++L + +E+YE++AMY+EN LKHQ QLL  R RE   +K++  +KE +  V+ QF LA++    +LE+N LR KV E +++   +E T+R +    +  +++NL+++ FEQ T+I V R  LH    +RI   R  A  EMNK+KE+SGAK T DDE+A RNL L+K+++     N  L Q ++RMKSLFNW + +  C+++  + +     D+ K  V +V +N++QKV+++  E  RLK  ++ TEKEL++L+ TL+KE+ ++  K+  A+ K  + K+  + KQ  I  LM+++ E N  IATM      ++K++K+V   S  +V+ L   L +ER+ K +AF KVDDLI+QVYEFEA FA+V  NT      G+   +   +++ +  T   +LR  +    PD+ +       R +TY  I++R+ IPY P H+  FRRDRV  H+++ RI ++L+
Sbjct: 1239 FFQFGDAFEKKNDPEDNMSNEEIDPRKLRKRARRILSENGSKFLNLWFIPHFTEILFLYRQRDDERTTENLKNLVNIVGNFHDILHFLVGFSRLQISSAKISTELKAE-------NVDVND-SIEHSLSSQFVS-----------------TELIEIDHQISHLMDPTEVKAVIELLSTRRNVTFLKFEYCISHALLETFLATRNVKAFKAVSANMKFPFEELTNVQRATTISFRLNVPEPLEARDQRARELYPYRSIINQLGPYLIMHDFWKNIQENIQLVLAGLSDVDRPTVHGEFVSLNLCLEDVLAEGNLPESRAGRKLNMNDFENVLLLGKKFHKKDKKEVALVPVDNLGNQPSSDDKNKKLNIITHPIQCYKLMRNYIILSKRLNLLKNFWGARKLGLEAIENPDDFNMFNKIYKIEKLYPLMKSLCIQYRLPDLAHQGPFADTDIFVTPKGIPEIVVKQRQLGKMIETFESTMIGDLRKRIIRQTDQVMKERNREEGNLPLDLWKKPAMKEAISVKRPVIAEDFVSELMQNTDL---------------------NDEKTLISDTLTFTKEHLNKCLQNLAISVLHMQKESYENYAMYYENQLKHQHQLLYAREREIEDMKQQLLQKELATIVDVQFQLADQAHSLLLEVNALRAKVAEMREDSLQQEQTIREEVRQEYNSMVQNLFSVAFEQKTQIDVYREYLHDATLKRIQEVRTEAAIEMNKVKEKSGAKVTADDELAERNLKLSKELTSLHQQNIHLKQMMSRMKSLFNWHHTFIKCNFQKAIAKIEKDRDKYKNSVTVVEMNSEQKVQIMGEELDRLKHYLTSTEKELNDLRKTLDKEMKEKMDKKHAAERKAATDKQMALVKQMHIDQLMSEITEKNSNIATMSRVLNENMKSHKTVADKSVREVDALRKSLREERKMKQSAFTKVDDLISQVYEFEAAFAIVKGNTPINGVTGKNSDSISCSQISRPSTGISNLRSGFKPITPDMKVSTDKSRPRPITYGDILRRYPIPYAPDHYRDFRRDRVGTHQLRKRIADQLL 2243          

HSP 3 Score: 278.1 bits (710), Expect = 1.452e-74
Identity = 151/362 (41.71%), Postives = 235/362 (64.92%), Query Frame = 3
Query:  108 LDELLKMDVVELKAQIEENQLIYGLNNKDPSSIYTPKDPEFYXXXXXXXXXXQIDGQCTHTGKIVADTIKLEIECCEKFEYRDKSLLLLVYQYFKNRMKVLVNMKRSQMLRYKRYCINKTLTEFIKEHYNARLNAINTEYNDVRARYNRLKAAQEGFICNSDQGLEEITMDDIFIYMKWLIQHMYNMEYITTMVKIIRWIPIKYRKNNAAKAEND-----TDSFNKSESTYKYIRSTTSILQNRESSLTARHSQRTISNTR----SDINLS-AASGGGYAVDERNLLFPLHTNDMHYLEHLLIYFCEVYGINMDVHKIRNAADEMELYSVVSRRFKTVFNMQEQMRTFKVYDKIDSRTMGYG 1163
            L++ L+ +++ELK+QIEENQL+YG+ +K  SSIY PKDP+ + ++R+L L+R +        K+ A+ ++LE+  C+  EY +KS+ LL++QYF +R++ ++  K + +LR+KRYCIN  + E I   Y  RL  I  EY D  +R +RL   +EGF+ N++QG++E+  DD+ IY++WLI H+ +++ +    +II+W PI +RK  +A   +      +D  +KSE ++  I +T     N E+ L       T  +T+    ++ NLS AA+GGG   DE+NL  PLHTND+++L   LI +C +YGI MDV  I+++ADEMELY+ V+R+FKT FN+QEQM  FK YD I S +  +G
Sbjct:   12 LEDSLRSEIIELKSQIEENQLVYGIPSKGMSSIYVPKDPDHFRRQRKLILQRTLQVTDERPIKVQAEVMRLELISCDSREYTEKSVPLLIHQYFLDRIQEMLASKYAHLLRWKRYCINTAIIESIYPEYKERLQHIMDEYLDSSSRCHRLATCREGFLSNTEQGVDELNTDDMIIYLRWLICHLQSLKLLIQTNRIIQWFPIAHRKEFSATIVDCVEIKLSDDQSKSERSFTKIPATF----NDEAPLPPPLVAATFVSTKPLKPTEFNLSLAAAGGGMVTDEKNLNLPLHTNDLNHLRSHLIVYCNMYGIEMDVVGIQSSADEMELYASVNRKFKTHFNLQEQMNIFKTYDFIVSGSEKWG 369          
The following BLAST results are available for this feature:
BLAST of DUF4549 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4549 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4549 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4549 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch73-242m19.14.763e-13629.27si:ch73-242m19.1 [Source:ZFIN;Acc:ZDB-GENE-131121-... [more]
back to top
BLAST of DUF4549 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000038343.12.257e-1219.90pep primary_assembly:Xenopus_tropicalis_v9.1:5:748... [more]
back to top
BLAST of DUF4549 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Ccdc1628.236e-14730.50coiled-coil domain containing 162 [Source:MGI Symb... [more]
Ccdc1621.646e-5527.49coiled-coil domain containing 162 [Source:MGI Symb... [more]
Ccdc1623.048e-1321.04coiled-coil domain containing 162 [Source:MGI Symb... [more]
Ccdc1623.261e-1321.04coiled-coil domain containing 162 [Source:MGI Symb... [more]
back to top
BLAST of DUF4549 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q0VG85|CC162_MOUSE2.281e-1221.04Coiled-coil domain-containing protein 162 OS=Mus m... [more]
back to top
BLAST of DUF4549 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4V3SDX32.919e-3238.56DUF4549 domain-containing protein OS=Opisthorchis ... [more]
A0A4S2LFV12.950e-3238.56DUF4549 domain-containing protein OS=Opisthorchis ... [more]
A0A504Y5J31.147e-3438.39Coiled-coil domain-containing protein OS=Fasciola ... [more]
A0A074ZYC62.586e-2738.45DUF4549 domain-containing protein OS=Opisthorchis ... [more]
A0A1S8X9702.721e-2737.54DUF4549 domain-containing protein OS=Opisthorchis ... [more]
back to top
BLAST of DUF4549 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSAMXT00000000633.24.702e-5521.38pep primary_assembly:Astyanax_mexicanus-2.0:9:2459... [more]
ccdc1624.241e-829.63coiled-coil domain containing 162 [Source:ZFIN;Acc... [more]
back to top
BLAST of DUF4549 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000009936.12.226e-2123.78pep scaffold:Pmarinus_7.0:GL484636:314:10512:1 gen... [more]
back to top
BLAST of DUF4549 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4549 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO394534.136e-14031.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DUF4549 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4549 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078557.10.000e+0100.00SMESG000078557.1[more]
SMESG000078557.10.000e+0100.00SMESG000078557.1[more]
SMESG000002927.11.119e-7445.43SMESG000002927.1[more]
SMESG000002927.11.513e-7445.43SMESG000002927.1[more]
SMESG000002927.11.452e-7445.43SMESG000002927.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003073 ID=SMED30003073|Name=DUF4549 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=7001bp
TTTTTTGTTTTAACTCATAAACAATCAATATTCAAATTATTTTTCGTGTT
TTCGTTAAAGCTGTACTTTAATAAATGGATATACCAAAAAACCATGAAAT
AAACCAATTAGATGAACTATTAAAAATGGATGTCGTAGAATTGAAAGCAC
AAATAGAAGAAAATCAACTGATTTACGGATTAAACAATAAAGACCCAAGC
TCAATTTATACTCCTAAAGATCCTGAATTTTATCTGAAAAAACGACGATT
GAAATTAAAGAGACAAATTGACGGCCAGTGTACTCATACTGGTAAAATAG
TGGCAGATACGATCAAGTTGGAGATAGAATGCTGTGAGAAGTTTGAGTAT
CGAGACAAGTCGCTCTTGTTACTGGTTTACCAATACTTCAAGAACCGAAT
GAAGGTGCTAGTTAATATGAAAAGATCACAAATGTTGCGGTATAAGAGGT
ATTGTATCAATAAGACATTGACCGAATTCATCAAAGAACATTATAATGCA
AGATTAAATGCAATAAATACCGAATATAATGACGTTAGAGCTCGTTATAA
CAGATTGAAAGCCGCACAAGAAGGTTTCATCTGCAACTCTGACCAAGGAC
TGGAAGAAATTACAATGGACGACATTTTCATATACATGAAATGGTTGATT
CAGCACATGTATAATATGGAATACATTACAACTATGGTTAAAATAATCCG
ATGGATTCCTATCAAATACCGCAAAAATAATGCTGCAAAAGCAGAAAATG
ATACTGATTCTTTCAACAAATCCGAAAGTACATACAAATATATCAGATCA
ACTACATCTATTTTACAAAACCGTGAATCGTCCCTTACAGCGCGACACAG
TCAAAGAACAATATCAAACACAAGATCTGATATTAACCTTTCGGCAGCTA
GTGGAGGCGGCTACGCGGTTGATGAAAGGAATTTACTATTCCCATTGCAT
ACGAATGATATGCACTATTTAGAGCATTTGTTAATTTATTTTTGTGAGGT
ATATGGGATAAATATGGATGTGCACAAAATTCGCAATGCAGCTGATGAAA
TGGAGCTGTATAGTGTTGTCAGCAGACGATTTAAAACCGTTTTCAACATG
CAAGAACAAATGAGAACTTTCAAAGTTTACGATAAAATAGATTCAAGAAC
GATGGGGTATGGATAGTGCTATGCGGGCGCTATTGAAACCAGCCAATTGG
AAGCCGTTTAATAAATTTACACCGAAAATCAATCTGCTAGAAGCTCGGTA
TTTGAATAAACTTAGAGACGAAGAAATCAAAGATGAATTTCTCATTACAG
CTTCTTTATTTCTTAAAAAATCCAATGCCGAGGAAACTCAGATGAATTTA
AGGCATCACGCTTTGGTAATTCAGCATTTGCCAGTCGTCTACAACACAGC
AGTCGTCACTAATCCCAAAGGGTTTGACATTGCCGATATTTTGAAAACAA
TATATACAAAATGTGATGTAAATTTAAGAACTTTTACAACTGATGATAAG
CCTAATAATGATTCATCAGGAGATCACGATAATTATAATTTTACAGAAGC
TCTTCAGCTTCTTGGTCTCGATGAATCAATTGAAACTAAGGATGATTCTT
CAACGGTTCAAGGAGCGTATTTGTCGTATTTGCATTTACGATTTTTAAAA
ATTCGTGATATGCAGAGGACGTGCCTTTCAATTTTAAATTATTTTCGATC
TGTCGAAAGAACACTTGTTATCGACGAATATCAGTTCACCAAAGAGTCTG
TTAGACCAGTAAAGAAAAGCAATCCAGCTTCTTCGCAGGATTTAGATTCT
TCGAACTTTGACAATCTTGGCAATCACGGCTATCTACAAGCAACAGTGGA
TGATTTTAAGATATCAATTGAAGATTTCATGAAGACAAATGAAATAGAAA
ATCATGATGACTTTTATTTGCATGAAAATGGTCGAATACATGTTCAAGAT
TTAATGGGTAATTGGATCATGTACGACGTGGCTCTGAAGGATTTTGAGAA
ATTAGAATCTGATCTAATTCTTATTGGAAGTTATTACATCACTTTTGACA
AAGAAATGCGTTCGTCAACTTTATTTAATCGCAAACAATCCCAATCCGAG
CACACTGAAGGCAGTGAATTCTATATATTAGAATATGGTCACAGGGAAGT
CGACAGATTTGGTGTTTTGTATGACTTGTGGTGTCAACATACGGATTTTA
TGGAACAAAAGAAAAAGCTATTTGACCTAAATATGGAAGTTTATAATACA
GTCTGTAAACAAGAAGATAGGCAGCACTTGGCTCAAACCTTAATCAACCT
CATGCACCATAAGCCTAGGATTGATTTACACAGCAAATATTTCCTCATTT
CCTATCGATATGAAAATATGATTTTAGAGCGCAAATTTCAAATTTTTAAA
ATGATTCTTGACAAGGAGATCTCAAGAGAACGAGAATATTTATCAAAAGT
TTATAAGGATTCCGATTATCCCTATCGCCACATTCCGCATTTGTTAATCG
CTCCAAATTCTGACGAATGTGCTTTGCAAGAGGTTCATTTTCTAGAATTT
CTGCCATCCCTGTCTCAAGTTTGTCAAATTAATAAAATGATTGACTATGC
CTCTTTGAATATTAAAAACCTCTCTTCGAATACTCCAGTGACAAGTATGT
TGAAAAAAGAGCTGGATCTATTGGACACGATCTACAAGGAAATTTCAGAA
TATGAAGATATAACTAGACAATTTACAGATCCAAATCTCATCAAATTTCT
CAGTCAAGACTCAGTGATTTGCAATCCTCTGATTATGGAAGAAATCGGCA
GAAAGTATTTAAAAATCATAGATTCCAAAAATACAAGAGGTGAAAAAAAG
CGGAGGAAAATTAGGTGCATTAATGAATTTTCCCGGCTCATCGAATTGGC
AAACATCAGATTTCGTTTAATTCATGTGCTCCATGAAACGGAATATTTGC
ATTCGATTTATGACAACCAAGCTATAACTTTGGGATATGATAATTTCCAT
TTATTCATGCGACAAGTTCCTTTTGAGCGAGCCGTCAAAACTGAAGGAGC
GGAATATTATAAACCTTTTCTATACGTTTCTAGTGTACAGGACGATGACT
CTGTTGTTGACAAATATCGGCCAGAACATCCTTACCCGGCTATTCATGAG
TTGGACAATGTCCACTTCGGCCTATTTAACCTCATAACAATAAATGATAT
AATCCAATGTTTAGAAAGCAAAGGACTAGAGAACTTACAAGTGATGTTAA
AGGTTCAATTTTGCCACAAAAATGCAGTTGCATCAGGAGTTTTGCTCTGT
GATTATTGCCGTCCATCTGTTTACAAATCCCATAAAGAAAAATCCTTGTC
GCATATCGAGAGTTCTTTAGGACAAACTGTTACAACTTATAACTTGCCGA
TTTCTGCACAAAGTGGGCCGACCCCTCTAGCTTTAGATTCCAGCAGAGCA
AGTATTCATGCATTGACTGATTCCTATCCAGAAGCATTATTCTCTTTACA
ATTAGAAAAAGTGCCGATACGTGATAAAATGCTCAACAATTTCTTGAAGA
AATTCCCCTCGCCTAGCACCGTTTCTCAAGTAGATATGGAAAAAGCCAAA
CGAGATTGCATTACATTTTTCACGAATGCATTTTACGACAGAATCGCGCA
TATAGCTCTCAAGGCACAAATTATAGCATATTATAACTCAATAATCAACA
CTTTAAATGCGGTTCCCGAAATTGTAATTTTTCCAATTTGGAAAGGCATT
TAATCCAGCAAAAAGCACCGTAGATGCCAATTGCAATTTAGATAAGAATC
CCAAGAAATTGCACAATCGGTGTCGCAAAGTCATTGATGATGATGGCCAG
AAGCTTATCAACATTTGGTATATTCCTCATTTTTCGGAGATTCTATTTCT
CTATCGTCAAACCGAGGATGCAAAAGCTAATTTGATTCTTTACAATTTCT
TAAGATTGGTAATGGCATTTCATGATATTATTCAATATGTTGTTGGATTT
TGGAAATTTGGGTTCAACTCTACTCGGGTACCTGAGAAAATGAAAATGAA
AATTAATAAAATTTACAATTTGCCTACTGACACCAATTCTCAAAACATCG
TTCATCATTTACATTGTGACGAGGTGGCGGACCTGAGCTATTTTACGGAT
TATAATACTACTAATACATATCAGCTAAGAAAAGAATTCGTTGACTTGGA
GATTCAAATTGAACATTTACCTAATCCCTACGATCTTGAACAAGTGATAG
ACCTTCTCAATATTCGACGGAAATATCATTTTTATTATTTCGAAATTTGT
GCAACCTTGTTATTGAAAGAGTTATTCCTATCCACGGATAACATTCACTG
TTACAAAAAGTTAATGAACGGGATCCAATCATCAATTCCAACAATTAGAA
ATGTTCGATATACCAAGCACATTAGTGAAGGTTTATGTATCCCATCCCTT
ATTTCCGAAACTGATCCGGAAATTGACAAGCTCTTTCCATGGCGATCTAT
GATGCTGAAGAGTGGACCAGTTTTTATCAACTTCGATTGCACTATGAATA
TTTGCGACTATTTACAATTATGTTTCATTTGCATTCCACAGAAATACAGA
TTCCTGATTTATAATCAGTTCTATAATTTAAATTTGTCTTTGGAAGACAT
GTTAGTGGAACAAGAAACAATGACAACAAATCCCTCAATAAATAATGATA
ATGAAAAATTTTTATTATCAAAGAAAATGCATAAAAAAGAGAAAAAGGAA
GGTCATCAGCATCTTGCTACAGAGCACGTGAAAAAGGATGATTTGGAGTC
TACTATAATAGAAGAAAAGAAAAGTTTATCTCTTCGTGAAAATCCAATTC
AGACTTATGAACATCTTTTAACTTTTTTATATGTATTACGTCAATTATAT
GTTTTGAGGGACATTTACAGTTTCAAGGTTTCACAAATTAAAAAAATTGA
TTCCTACGAATCATTTTTAACAGTTTCAAAGCAATACAAATTGTCAATTT
TGTTTCCCGTTCTGAGAAAACTTAGCTATGACATCAATGTACCAAATTTT
TATTTTTACGGCCCATTAAAGGCAGAAGACGTAGTTACATATCCTAAAGG
TATACCAGAGGTTTCAATTTACAATTTATTGATAAAGGCATTGATAAACA
AAATTGAAAAGCAACAAATTAATCTTTTGCGATCGAAAATAACTCAGAAA
ATTGACCACGTAATCAAACAGAGACACTACGAGAGTGAAACAATTGATAT
GGAAAAATCCCCGTATTTAATTTTTAAGAATTCGCTGAAAAATCCAAATT
TAGTTGCAGATTTAATTAAAAAATTTGAAGCTCCCTTTCAATTAGCCGAA
AAGAAAGAGGAAGAAAAAGCAGAGGGAACAAAAGAAAATGAAAGTGAAGA
TGGAAAAGAAAACGAAAAAGAAATAGAAAATGACAATTTAGTATATAGTA
AAATGTACGTCAACAAATGTTTGCAATATTTAGCAAACACATTGCTAAGA
ATACATCGAGAAACATATGAAAGCTTTGCTATGTATTTTGAAAATTTATT
GAAACATCAACAACAACTTTTACTGTTTCGCAACCGAGAATATTATGGTC
TCAAAGAAGAATTTCACGAGAAAGAACAATCGTTATCTGTGGAAAGACAG
TTTATATTAGCAAACAAAGTGTCTGAGCGGATATTGGAGATCAATTATCT
TCGCGGAAAAGTGAAAGAAGATAAACAGAATATCCAGAATAAAGAAAATA
CACTTAGAAGACAAACTTCTCTCTCTTTCAAGTTTCTTATTAGAAATCTT
TATAATTTAGGATTTGAACAAATGACCAGAATCAAAGTCTCGAGATTTAA
ATTGCATTGTGATGTTTATCAGCGAATCAATGCTACAAGACTAAATGCTT
TTTATGAGATGAATAAGATCAAAGAAAGAAGTGGAGCAAAATACACAACA
GATGACGAGATAGCTCTGAGAAATCTCATACTTACCAAAAAAATGTCAGA
TGCAAGAGCAGTAAACTTTTCGCTTTTTCAATTCATTGCCCGCATGAAAT
CTTTATTCAACTGGATTTATAATTACACAGTTTGTGATTGGGAAAATATG
CTCAATGAGAACATGAACAGGACCGACAGGGTGAAAGGATTAGTATTTTT
GGTCACTGTTAACGCACAACAAAAGGTGAAACTGATAAAATGCGAATTTA
AACGGTTGAAAGTCATTATATCCGACACTGAAAAGGAGTTGAGTGAACTA
AAAAATACTCTGAATAAAGAAATAACACAACAAACTCAAAAGCGCCAAAA
AGCAAAACTGAAGCACTTGAGCCTGAAAAAAACAACTATACAAAAACAAA
AGCAAATATCTGATTTGATGAATCAGTTACAAGAAATGAATGGGCAAATA
GCAACAATGAAAATGAAGTTTGAAAGTCACATTAAAAATAATAAATCTGT
CACTGTTACTTCACATAATCAAGTAGAAAAACTGTCAACTATATTGACAG
ATGAACGCAGAAAGAAATTGAATGCGTTTAATAAGGTGGATGATTTGATT
GCACAAGTTTATGAATTTGAAGCAGGATTCGCAATGGTAAATACTCAATC
TGAGGCTTCAAGAGGAAGAGTAGAAAAGAACTACAAAGCTCGACTTCTTC
AAACTAAGACCAAAAAAGTTGATTTAAGAGGGAATTATCCTGATTTAATA
TTGCATCAACGGCAGCTAACCTATGATGCCATTATCAAAAGACATTGCAT
TCCATACACTCCGTGTCATTTTCTGCCATTCCGAAGAGATAGAGTAGAGG
CACATAGGATGAAAATGAGAATTCAGAACAGGCTCATTAAAAAGGAGCCG
GACAGTAAGGTACATAGTCTCCCTAAACTGAGGAAAACTGGGAATTTGGT
AAAGTTTCAGAAAAATTAAAACAGAAGTTCTCATGGATTCAATAATGGAT
ATTAAATTGTGTTCATAGAATAATCTAGGAATCTTAAAAATTGTAAAATT
G
back to top

protein sequence of SMED30003073-orf-1

>SMED30003073-orf-1 ID=SMED30003073-orf-1|Name=SMED30003073-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=364bp
MDIPKNHEINQLDELLKMDVVELKAQIEENQLIYGLNNKDPSSIYTPKDP
EFYLKKRRLKLKRQIDGQCTHTGKIVADTIKLEIECCEKFEYRDKSLLLL
VYQYFKNRMKVLVNMKRSQMLRYKRYCINKTLTEFIKEHYNARLNAINTE
YNDVRARYNRLKAAQEGFICNSDQGLEEITMDDIFIYMKWLIQHMYNMEY
ITTMVKIIRWIPIKYRKNNAAKAENDTDSFNKSESTYKYIRSTTSILQNR
ESSLTARHSQRTISNTRSDINLSAASGGGYAVDERNLLFPLHTNDMHYLE
HLLIYFCEVYGINMDVHKIRNAADEMELYSVVSRRFKTVFNMQEQMRTFK
VYDKIDSRTMGYG*
back to top

protein sequence of SMED30003073-orf-2

>SMED30003073-orf-2 ID=SMED30003073-orf-2|Name=SMED30003073-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=986bp
MAFHDIIQYVVGFWKFGFNSTRVPEKMKMKINKIYNLPTDTNSQNIVHHL
HCDEVADLSYFTDYNTTNTYQLRKEFVDLEIQIEHLPNPYDLEQVIDLLN
IRRKYHFYYFEICATLLLKELFLSTDNIHCYKKLMNGIQSSIPTIRNVRY
TKHISEGLCIPSLISETDPEIDKLFPWRSMMLKSGPVFINFDCTMNICDY
LQLCFICIPQKYRFLIYNQFYNLNLSLEDMLVEQETMTTNPSINNDNEKF
LLSKKMHKKEKKEGHQHLATEHVKKDDLESTIIEEKKSLSLRENPIQTYE
HLLTFLYVLRQLYVLRDIYSFKVSQIKKIDSYESFLTVSKQYKLSILFPV
LRKLSYDINVPNFYFYGPLKAEDVVTYPKGIPEVSIYNLLIKALINKIEK
QQINLLRSKITQKIDHVIKQRHYESETIDMEKSPYLIFKNSLKNPNLVAD
LIKKFEAPFQLAEKKEEEKAEGTKENESEDGKENEKEIENDNLVYSKMYV
NKCLQYLANTLLRIHRETYESFAMYFENLLKHQQQLLLFRNREYYGLKEE
FHEKEQSLSVERQFILANKVSERILEINYLRGKVKEDKQNIQNKENTLRR
QTSLSFKFLIRNLYNLGFEQMTRIKVSRFKLHCDVYQRINATRLNAFYEM
NKIKERSGAKYTTDDEIALRNLILTKKMSDARAVNFSLFQFIARMKSLFN
WIYNYTVCDWENMLNENMNRTDRVKGLVFLVTVNAQQKVKLIKCEFKRLK
VIISDTEKELSELKNTLNKEITQQTQKRQKAKLKHLSLKKTTIQKQKQIS
DLMNQLQEMNGQIATMKMKFESHIKNNKSVTVTSHNQVEKLSTILTDERR
KKLNAFNKVDDLIAQVYEFEAGFAMVNTQSEASRGRVEKNYKARLLQTKT
KKVDLRGNYPDLILHQRQLTYDAIIKRHCIPYTPCHFLPFRRDRVEAHRM
KMRIQNRLIKKEPDSKVHSLPKLRKTGNLVKFQKN*
back to top

protein sequence of SMED30003073-orf-3

>SMED30003073-orf-3 ID=SMED30003073-orf-3|Name=SMED30003073-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=865bp
MDSAMRALLKPANWKPFNKFTPKINLLEARYLNKLRDEEIKDEFLITASL
FLKKSNAEETQMNLRHHALVIQHLPVVYNTAVVTNPKGFDIADILKTIYT
KCDVNLRTFTTDDKPNNDSSGDHDNYNFTEALQLLGLDESIETKDDSSTV
QGAYLSYLHLRFLKIRDMQRTCLSILNYFRSVERTLVIDEYQFTKESVRP
VKKSNPASSQDLDSSNFDNLGNHGYLQATVDDFKISIEDFMKTNEIENHD
DFYLHENGRIHVQDLMGNWIMYDVALKDFEKLESDLILIGSYYITFDKEM
RSSTLFNRKQSQSEHTEGSEFYILEYGHREVDRFGVLYDLWCQHTDFMEQ
KKKLFDLNMEVYNTVCKQEDRQHLAQTLINLMHHKPRIDLHSKYFLISYR
YENMILERKFQIFKMILDKEISREREYLSKVYKDSDYPYRHIPHLLIAPN
SDECALQEVHFLEFLPSLSQVCQINKMIDYASLNIKNLSSNTPVTSMLKK
ELDLLDTIYKEISEYEDITRQFTDPNLIKFLSQDSVICNPLIMEEIGRKY
LKIIDSKNTRGEKKRRKIRCINEFSRLIELANIRFRLIHVLHETEYLHSI
YDNQAITLGYDNFHLFMRQVPFERAVKTEGAEYYKPFLYVSSVQDDDSVV
DKYRPEHPYPAIHELDNVHFGLFNLITINDIIQCLESKGLENLQVMLKVQ
FCHKNAVASGVLLCDYCRPSVYKSHKEKSLSHIESSLGQTVTTYNLPISA
QSGPTPLALDSSRASIHALTDSYPEALFSLQLEKVPIRDKMLNNFLKKFP
SPSTVSQVDMEKAKRDCITFFTNAFYDRIAHIALKAQIIAYYNSIINTLN
AVPEIVIFPIWKGI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR040401CCDC162
IPR029376DUF4549
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 983..985
NoneNo IPR availableCOILSCoilCoilcoord: 584..604
NoneNo IPR availableCOILSCoilCoilcoord: 799..819
NoneNo IPR availableCOILSCoilCoilcoord: 746..784
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 464..487
IPR040401Coiled-coil domain-containing protein 162PANTHERPTHR33331FAMILY NOT NAMEDcoord: 93..887