NEK8-1

Overview
NameNEK8-1 (AKN21710.1)
Smed IDSMED30003066
Length (bp)2522
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NEK8-1 (SMED30003066) t-SNE clustered cells

Violin plots show distribution of expression levels for NEK8-1 (SMED30003066) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of NEK8-1 (SMED30003066) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for NEK8-1 (SMED30003066) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003066

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30003066SMESG000053193.1 dd_Smed_v4_8692_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30003066SMESG000053193.1 dd_Smed_v4_8692_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003066SMESG000053193.1 dd_Smed_v4_8692_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
photoreceptor neuronSMED30003066SMESG000053193.1 SMED30003066smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30003066SMESG000053193.1 SMED30003066smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of NEK8-1 vs. Ensembl Human
Match: NEK9 (NIMA related kinase 9 [Source:HGNC Symbol;Acc:HGNC:18591])

HSP 1 Score: 533.487 bits (1373), Expect = 1.965e-175
Identity = 285/702 (40.60%), Postives = 435/702 (61.97%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNKINEIQ---NEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSL-SNYLRQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLN-EDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIING--EFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWKGNCQSMIDQVHRTNQANSNSRPCSGDRKERSIV-SLNSEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTWSNIQGDKKLSGQLGHG-AIVYKIPKLVQSLKGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGINS-NETEMINQFE-KITVTDPIDKSPVIINQISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSGSSQKNLCYDVPFETKFKIVAVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFAGKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLGLEITVDQR----CVLHPRALFGTLQKCADIQSFGWQTIMITERILETSTISANSTAI 2196
            Y+ +RVLG+GA+G+A LYR   D+SLVVWKE+D+ +    E +   NEI IL++L H NI+AYYNHF+   T+ IE+EY N G+L    LRQ  +   E  V+WY FQ++ A+  IHK  I+HRDIKTLNIFLT + L+K+GD+G++K LN E   A T VGTP YMSPE+ QG+ Y+ KSDIWA GCV++E+++ K+ F+ +N L+L +KI+ G    +   +  + +L+ ++   L  +P +RP+A+++L  P+ +   + M ++V   N      R  +      ++V S  SEV+VWGGGK    K++  +   SA QV AG +HF V+T EK+LYTW N+QG  KL GQLGHG    Y+ PK V+ L+G  I++VSCG++ T+C++  G+++  GS+YYG +G++     E++   +    +++P++       Q+SCG +H   +   +++ ++WGCGEYGRLGL  E++ Y P  VD+P     +  V CG D TF++ + S ++L CG N++NKLG+N   Q +SG       ++VP+ T F +   L   K+ T++ G +HTA +D   +L  FG N  GQ+G+G+ K    +N       GK++ ++SCGD FTI +T +N IF WG   +GRL +  T        C   PR +FG+L    D+   GW TI+I E++L + TI +NS+ +
Sbjct:   52 YIPIRVLGRGAFGEATLYRRTEDDSLVVWKEVDLTRLSEKERRDALNEIVILALLQHDNIIAYYNHFMDNTTLLIELEYCNGGNLYDKILRQKDKLFEEEMVVWYLFQIVSAVSCIHKAGILHRDIKTLNIFLTKANLIKLGDYGLAKKLNSEYSMAETLVGTPYYMSPELCQGVKYNFKSDIWAVGCVIFELLTLKRTFDATNPLNLCVKIVQGIRAMEVDSSQYSLELIQMVHSCLDQDPEQRPTADELLDRPLLRKRRREMEEKVTLLNAPTKRPRSSTVTEAPIAVVTSRTSEVYVWGGGKSTPQKLDVIKSGCSARQVCAGNTHFAVVTVEKELYTWVNMQGGTKLHGQLGHGDKASYRQPKHVEKLQGKAIRQVSCGDDFTVCVTDEGQLYAFGSDYYGCMGVDKVAGPEVLEPMQLNFFLSNPVE-------QVSCGDNHVVVLTRNKEV-YSWGCGEYGRLGLDSEEDYYTPQKVDVP-KALIIVAVQCGCDGTFLLTQ-SGKVLACGLNEFNKLGLN---QCMSGIINHEAYHEVPYTTSFTLAKQLSFYKIRTIAPGKTHTAAIDERGRLLTFGCNKCGQLGVGNYKKRLGINLLGGPLGGKQVIRVSCGDEFTIAATDDNHIFAWGNGGNGRLAMTPTERPHGSDICTSWPRPIFGSLHHVPDLSCRGWHTILIVEKVLNSKTIRSNSSGL 740          
BLAST of NEK8-1 vs. Ensembl Human
Match: NEK8 (NIMA related kinase 8 [Source:HGNC Symbol;Acc:HGNC:13387])

HSP 1 Score: 324.324 bits (830), Expect = 6.407e-99
Identity = 214/665 (32.18%), Postives = 337/665 (50.68%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDID---KNKINEIQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYL-RQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLL-KIGDFGISKVLNEDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWKGNCQSMIDQVH------RTNQANSNSRP-----------CSGDRK---ERSIVSLNSEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTWSNIQGDKKLSGQLGHGAIVYKIPKLVQSL----KGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGINSNETEMINQFEKITVTDPIDKSPVIINQISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSGSSQKNLCYDVPFETKFKIVAVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKV--FAGKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLG 2037
            Y ++RV+G+GA+G   L     D  LV+ K+I ++   K +    QNE  +L +L+HPN++ YY +F+    + I MEYA  G+L+ ++ ++    L E  +L +F Q++ AL ++H   I+HRD+KT NI L    ++ KIGDFGISK+L+    A T VGTP Y+SPE+ +G PY+ KSDIWA GCVLYE+ S K+ FE +N  +L +KI++G F  + +  + +L  L+  LL  EP +RP    ++  P+    C   +  +H      R  +A  +  P           C G  +     +I    S V+ WGGG    L++     +   +QVAAG +    +T    L  W          G L  GA+    P+ +        GV IK V+CG+  T CL+  G +   GS   G LG  S     +    + T+ + +    ++  Q++CG  H  A+   E  LF WG G+ GRLGLG  ++   P  V +P  + + + V CG D++ I+     + L CG+N++NKLG++  + G      + +   + F       A L    + ++  G +H+A +      Y FG N +GQ+G   T T +      KV    G K+  ++CGD FT+     +E++ WG+   GRLG
Sbjct:    4 YERIRVVGRGAFGIVHLCLRKADQKLVIIKQIPVEQMTKEERQAAQNECQVLKLLNHPNVIEYYENFLEDKALMIAMEYAPGGTLAEFIQKRCNSLLEEETILHFFVQILLALHHVHTHLILHRDLKTQNILLDKHRMVVKIGDFGISKILSSKSKAYTVVGTPCYISPELCEGKPYNQKSDIWALGCVLYELASLKRAFEAANLPALVLKIMSGTFAPISDRYSPELRQLVLSLLSLEPAQRPPLSHIMAQPL----CIRALLNLHTDVGSVRMRRAEKSVAPSNTGSRTTSVRCRGIPRGPVRPAIPPPLSSVYAWGGGLGTPLRLPMLNTE--VVQVAAGRTQKAGVTRSGRLILWEAPPLGAG-GGSLLPGAVEQPQPQFISRFLEGQSGVTIKHVACGDFFTACLTDRGIIMTFGSGSNGCLGHGS-----LTDISQPTIVEALLGYEMV--QVACGASHVLAL-STERELFAWGRGDSGRLGLGTRESHSCPQQVPMPPGQ-EAQRVVCGIDSSMIL-TVPGQALACGSNRFNKLGLDHLSLGEEPVPHQQVEEALSF--TLLGSAPLDQEPLLSIDLGTAHSAAVTASGDCYTFGSNQHGQLG---TNTRRGSRAPCKVQGLEGIKMAMVACGDAFTVAIGAESEVYSWGKGARGRLG 646          

HSP 2 Score: 58.151 bits (139), Expect = 5.367e-8
Identity = 33/99 (33.33%), Postives = 51/99 (51.52%), Query Frame = 1
Query: 1774 NVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFA--GKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLGLEITVDQRC 2064
             V +  V+CG+  TA L     +  FG  S G +G G   +  D+++ + V A  G ++ +++CG    +  +T  E+F WGR DSGRLGL       C
Sbjct:  390 GVTIKHVACGDFFTACLTDRGIIMTFGSGSNGCLGHG---SLTDISQPTIVEALLGYEMVQVACGASHVLALSTERELFAWGRGDSGRLGLGTRESHSC 485          
BLAST of NEK8-1 vs. Ensembl Human
Match: NEK8 (NIMA related kinase 8 [Source:HGNC Symbol;Acc:HGNC:13387])

HSP 1 Score: 199.519 bits (506), Expect = 2.622e-55
Identity = 109/283 (38.52%), Postives = 168/283 (59.36%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDID---KNKINEIQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYL-RQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLL-KIGDFGISKVLNEDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWKGNCQSMIDQVHRTNQANSNSRPCSGDR 969
            Y ++RV+G+GA+G   L     D  LV+ K+I ++   K +    QNE  +L +L+HPN++ YY +F+    + I MEYA  G+L+ ++ ++    L E  +L +F Q++ AL ++H   I+HRD+KT NI L    ++ KIGDFGISK+L+    A T VGTP Y+SPE+ +G PY+ KSDIWA GCVLYE+ S K+ FE +N  +L +KI++G F  + +  + +L  L+  LL  EP +RP    ++  P+    C   +  +H    +    RP  G R
Sbjct:    4 YERIRVVGRGAFGIVHLCLRKADQKLVIIKQIPVEQMTKEERQAAQNECQVLKLLNHPNVIEYYENFLEDKALMIAMEYAPGGTLAEFIQKRCNSLLEEETILHFFVQILLALHHVHTHLILHRDLKTQNILLDKHRMVVKIGDFGISKILSSKSKAYTVVGTPCYISPELCEGKPYNQKSDIWALGCVLYELASLKRAFEAANLPALVLKIMSGTFAPISDRYSPELRQLVLSLLSLEPAQRPPLSHIMAQPL----CIRALLNLHTDVGSVRMRRPVQGQR 282          
BLAST of NEK8-1 vs. Ensembl Human
Match: NEK5 (NIMA related kinase 5 [Source:HGNC Symbol;Acc:HGNC:7748])

HSP 1 Score: 176.792 bits (447), Expect = 5.855e-49
Identity = 103/254 (40.55%), Postives = 150/254 (59.06%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNKINEIQ---NEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYL-RQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLL-KIGDFGISKVLNED-EFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHP 879
            Y  ++ +G+GA+GKA L +   D+   V KEI+ +K  I E +    E+ +L  + HPNIVA++N F     +FI MEY + G L   + RQ     SE  +L +F Q+   L +IH   I+HRDIK  NIFL+ + ++ K+GDFGI++VLN   E A T +GTP Y+SPE+ Q  PY++K+DIW+ GCVLYE+ + K  FE +N   L +KI    F  +    + +L  L+ +L    P  RPS   +LK P
Sbjct:    4 YDVIKAIGQGAFGKAYLAKGKSDSKHCVIKEINFEKMPIQEKEASKKEVILLEKMKHPNIVAFFNSFQENGRLFIVMEYCDGGDLMKRINRQRGVLFSEDQILGWFVQISLGLKHIHDRKILHRDIKAQNIFLSKNGMVAKLGDFGIARVLNNSMELARTCIGTPYYLSPEICQNKPYNNKTDIWSLGCVLYELCTLKHPFEGNNLQQLVLKICQAHFAPISPGFSRELHSLISQLFQVSPRDRPSINSILKRP 257          
BLAST of NEK8-1 vs. Ensembl Human
Match: NEK3 (NIMA related kinase 3 [Source:HGNC Symbol;Acc:HGNC:7746])

HSP 1 Score: 167.933 bits (424), Expect = 7.148e-46
Identity = 92/249 (36.95%), Postives = 156/249 (62.65%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNKIN--EIQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKEDL-SESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVL-NEDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVL 870
            Y+ +R++G+G++G+A+L ++   N +   KEI + K+  N    + E  +L+ + HPNIVA+   F     ++I MEY + G L   ++Q K  L  E  +L +F Q+   +++IHK  ++HRDIK+ NIFLT +  +K+GDFG +++L N   FA T VGTP Y+ PE+ + LPY++KSDIW+ GC+LYE+ + K  F+ ++  +L +K+  G    +P+  + +L  L++++    P+ RPSA  +L
Sbjct:    4 YMVLRMIGEGSFGRALLVQHESSNQMFAMKEIRLPKSFSNTQNSRKEAVLLAKMKHPNIVAFKESFEAEGHLYIVMEYCDGGDLMQKIKQQKGKLFPEDMILNWFTQMCLGVNHIHKKRVLHRDIKSKNIFLTQNGKVKLGDFGSARLLSNPMAFACTYVGTPYYVPPEIWENLPYNNKSDIWSLGCILYELCTLKHPFQANSWKNLILKVCQGCISPLPSHYSYELQFLVKQMFKRNPSHRPSATTLL 252          
BLAST of NEK8-1 vs. Ensembl Celegans
Match: nekl-1 (NEK (NEver in mitosis Kinase) Like [Source:UniProtKB/TrEMBL;Acc:A0A061AD48])

HSP 1 Score: 287.73 bits (735), Expect = 1.202e-83
Identity = 233/766 (30.42%), Postives = 371/766 (48.43%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEI---DIDKNKINEIQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLNEDEFAN---TQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWKGNCQSMIDQVHRTNQANSNSRPCSGDRKERSIVSLNSEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTWSNIQGDKKLSGQLGHGAIV-YKIPKLVQSLKGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGINSNETEMINQFEKITVTDPIDKSPVIINQISCGHHHAAAI---GGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVY--CGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSGSSQKNLCYDVPFETKFKIVA--------VLRNV--KVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHT-KTHKDVNKSSKVFAGKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLGLEITVDQRCVLHPRALFGTLQKCADIQSFGWQTIMIT------ERILETSTISANSTAI---MDKLSLKNVNSFETEYDKDGSGD------IQTWLRKELQE-DVIYMD 2316
            Y ++R +GKGA+G AVLYR   D+SLV+ KEI   D+D ++     NE+ +LS ++HPNI+AYY+ F     + IEMEYA+ G+L+  L + +  L E  +     Q+  A+ Y+H+  ++HRD+KT N+FLT  + +KIGDFGISK++  +  A    T VGTP Y+SPE+  G+ Y+ KSD+WA GC+LYE+   KK FE  N  +L   I+   +  +    ++++  +++ LL  +P KRPSA   LK          M+      ++  S S         RS VS  + ++      I    I     + S  QVA   +H +VLT + +L+ +    GD    GQLG G     +  +LV+SLKG  I+ V  G   ++     G +   G+     LG ++ ++      E++   +        I  I CGH H  A+   G C      WG  +YG+LGL   ++ + PT + +P +K   K+VY   G D T ++      L+  G+N++NKL               NL   V F TK K           +L+    +V   S G+ H+ V+    ++ IFG N   ++GLG++ K      K  K         + CGD FT+VSTT  E++ WGR D     + I   +  V   +   GT  +  D       ++++       ++ +  S ++ +   +   +D L  K + S   E  + GS          TWLR+E ++ ++I +D
Sbjct:  133 YERIRTVGKGAFGSAVLYRRREDSSLVIIKEINMYDLDSSQRRLALNEVSLLSRIEHPNIIAYYDSFEEEGVLMIEMEYADGGTLAQMLSRTQNLLDEEQIGDMMIQMCSAVAYLHENSVLHRDLKTANVFLTRDSFVKIGDFGISKIMGTETLAQGAKTVVGTPYYISPEMCSGVSYNEKSDMWALGCILYEMCCLKKAFEGDNLPALVNSIMTCAYTPVKGPYSAEMKMVIRELLQLDPQKRPSAPQALK----------MLRPSENRHRHTSGSM--------RSSVSFTT-LYDLHVPTITLSSIPDLPSRISIKQVALSKTHTMVLTNDNELFGF----GDNS-CGQLGFGKFSKMENGRLVESLKGRDIQSVGVGNYFSVICCDRGTLLTFGTAKNLGLGKDAKDSAKPMLLEQLLREN--------IKDIYCGHDHVVAVLESGEC----LGWGSNQYGQLGLPTLEHFFAPTKIPMPSNK---KIVYGKAGKDATMLLSD-DGSLIAMGSNKHNKL---------------NLTQRVGFFTKEKKTPNDYVNKPTILQGFPERVVDFSVGSYHSGVILESGQVMIFGRNDNTELGLGNSQKMAVRCVKPVKSLLHHACTHVLCGDGFTLVSTTEQELYFWGRKDLTDEDVCIDDLEETVTEKKMKRGTTTEIFDKNVVTLPSLILRLQDERGDKGIRLSGLAVSGRKVHVAVDMLEGKRLPSALAERCRSGSAPAINDETTHTWLREEFEKAEIIPID 843          
BLAST of NEK8-1 vs. Ensembl Celegans
Match: nekl-1 (NEK (NEver in mitosis Kinase) Like [Source:UniProtKB/TrEMBL;Acc:A0A061AD48])

HSP 1 Score: 287.73 bits (735), Expect = 2.390e-83
Identity = 233/766 (30.42%), Postives = 371/766 (48.43%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEI---DIDKNKINEIQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLNEDEFAN---TQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWKGNCQSMIDQVHRTNQANSNSRPCSGDRKERSIVSLNSEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTWSNIQGDKKLSGQLGHGAIV-YKIPKLVQSLKGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGINSNETEMINQFEKITVTDPIDKSPVIINQISCGHHHAAAI---GGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVY--CGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSGSSQKNLCYDVPFETKFKIV--------AVLRNV--KVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHT-KTHKDVNKSSKVFAGKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLGLEITVDQRCVLHPRALFGTLQKCADIQSFGWQTIMIT------ERILETSTISANSTAI---MDKLSLKNVNSFETEYDKDGSGD------IQTWLRKELQE-DVIYMD 2316
            Y ++R +GKGA+G AVLYR   D+SLV+ KEI   D+D ++     NE+ +LS ++HPNI+AYY+ F     + IEMEYA+ G+L+  L + +  L E  +     Q+  A+ Y+H+  ++HRD+KT N+FLT  + +KIGDFGISK++  +  A    T VGTP Y+SPE+  G+ Y+ KSD+WA GC+LYE+   KK FE  N  +L   I+   +  +    ++++  +++ LL  +P KRPSA   LK          M+      ++  S S         RS VS  + ++      I    I     + S  QVA   +H +VLT + +L+ +    GD    GQLG G     +  +LV+SLKG  I+ V  G   ++     G +   G+     LG ++ ++      E++   +        I  I CGH H  A+   G C      WG  +YG+LGL   ++ + PT + +P +K   K+VY   G D T ++      L+  G+N++NKL               NL   V F TK K           +L+    +V   S G+ H+ V+    ++ IFG N   ++GLG++ K      K  K         + CGD FT+VSTT  E++ WGR D     + I   +  V   +   GT  +  D       ++++       ++ +  S ++ +   +   +D L  K + S   E  + GS          TWLR+E ++ ++I +D
Sbjct:  171 YERIRTVGKGAFGSAVLYRRREDSSLVIIKEINMYDLDSSQRRLALNEVSLLSRIEHPNIIAYYDSFEEEGVLMIEMEYADGGTLAQMLSRTQNLLDEEQIGDMMIQMCSAVAYLHENSVLHRDLKTANVFLTRDSFVKIGDFGISKIMGTETLAQGAKTVVGTPYYISPEMCSGVSYNEKSDMWALGCILYEMCCLKKAFEGDNLPALVNSIMTCAYTPVKGPYSAEMKMVIRELLQLDPQKRPSAPQALK----------MLRPSENRHRHTSGSM--------RSSVSFTT-LYDLHVPTITLSSIPDLPSRISIKQVALSKTHTMVLTNDNELFGF----GDNS-CGQLGFGKFSKMENGRLVESLKGRDIQSVGVGNYFSVICCDRGTLLTFGTAKNLGLGKDAKDSAKPMLLEQLLREN--------IKDIYCGHDHVVAVLESGEC----LGWGSNQYGQLGLPTLEHFFAPTKIPMPSNK---KIVYGKAGKDATMLLSD-DGSLIAMGSNKHNKL---------------NLTQRVGFFTKEKKTPNDYVNKPTILQGFPERVVDFSVGSYHSGVILESGQVMIFGRNDNTELGLGNSQKMAVRCVKPVKSLLHHACTHVLCGDGFTLVSTTEQELYFWGRKDLTDEDVCIDDLEETVTEKKMKRGTTTEIFDKNVVTLPSLILRLQDERGDKGIRLSGLAVSGRKVHVAVDMLEGKRLPSALAERCRSGSAPAINDETTHTWLREEFEKAEIIPID 881          
BLAST of NEK8-1 vs. Ensembl Celegans
Match: nekl-2 (Serine/threonine-protein kinase nekl-2 [Source:UniProtKB/Swiss-Prot;Acc:O01775])

HSP 1 Score: 155.606 bits (392), Expect = 2.704e-41
Identity = 93/263 (35.36%), Postives = 154/263 (58.56%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNS--LVVWKEID---IDKNKINEIQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQ--------LKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTT-STLLKIGDFGISKVLNEDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPV 882
            Y +VRV+G+GA+G   L R   D S   V+ K I+   + + + N IQ+E+++L  + HP I+ Y + F+  + + I M+YA  G+L   +          ++E   E  VL YF Q++ AL+++H+ +I+HRD+K  NI +    T+LK+ DFGISK L     A+T +GTP Y+SPE+ +  PY+ KSD+W+ GCVLYE++  ++ F+  N  ++ MKI   +   + +  ++D+  L++ LL     KRP    +L  P+
Sbjct:    4 YEKVRVVGRGAFGVCWLCRGKNDASHQKVIIKLINTHGMTEKEENSIQSEVNLLKKVQHPLIIGYIDSFIMDNQLGIVMQYAEGGTLERLINDQRAIKDSNMREYFPEKTVLDYFTQILIALNHMHQKNIVHRDLKPQNILMNRRKTVLKLSDFGISKELGTKSAASTVIGTPNYLSPEICESRPYNQKSDMWSLGCVLYELLQLERAFDGENLPAIVMKITRSKQNPLGDHVSNDVKMLVENLLKTHTDKRPDVSQLLSDPL 266          
BLAST of NEK8-1 vs. Ensembl Celegans
Match: nekl-3 (Serine/threonine-protein kinase nekl-3 [Source:UniProtKB/Swiss-Prot;Acc:G5EFM9])

HSP 1 Score: 134.035 bits (336), Expect = 1.995e-34
Identity = 88/262 (33.59%), Postives = 150/262 (57.25%), Query Frame = 1
Query:  121 LNVVSYVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDI----DKNKINEIQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKED---LSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLN-EDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLF--EYSNHLSLAMKIINGEFQTMP-NCNNSXXXXXXXXXXXNEPTKRPSAEDVLK 873
            L++  ++  + +GKG + +    +    +  V  K+I +    D+    +   EID+L  L+H N++ YY  F+  + + I +E A AG +S  ++  K+    + E  +  YF QL  AL ++H   I+HRDIK  N+F+T + ++K+GD G+ +  + +   A++ VGTP YMSPE IQ   Y+ KSD+W++GC+LYE+ + +  F  +  N  SL  KI N E+  +P +  ++ L DL+ R +L E +KRP   +VL+
Sbjct:   18 LSLELFIIEKKIGKGQFSEVFRAQCTWVDLHVALKKIQVFEMVDQKARQDCLKEIDLLKQLNHVNVIRYYASFIDNNQLNIVLELAEAGDMSRMIKHFKKGGRLIPEKTIWKYFVQLARALAHMHSKRIMHRDIKPANVFITGNGIVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIQESGYNFKSDLWSTGCLLYEMAALQSPFYGDKMNLYSLCKKIENCEYPPLPADIYSTQLRDLVSRCILPEASKRPETSEVLQ 279          
BLAST of NEK8-1 vs. Ensembl Celegans
Match: nekl-3 (Serine/threonine-protein kinase nekl-3 [Source:UniProtKB/Swiss-Prot;Acc:G5EFM9])

HSP 1 Score: 134.035 bits (336), Expect = 1.995e-34
Identity = 88/262 (33.59%), Postives = 150/262 (57.25%), Query Frame = 1
Query:  121 LNVVSYVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDI----DKNKINEIQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKED---LSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLN-EDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLF--EYSNHLSLAMKIINGEFQTMP-NCNNSXXXXXXXXXXXNEPTKRPSAEDVLK 873
            L++  ++  + +GKG + +    +    +  V  K+I +    D+    +   EID+L  L+H N++ YY  F+  + + I +E A AG +S  ++  K+    + E  +  YF QL  AL ++H   I+HRDIK  N+F+T + ++K+GD G+ +  + +   A++ VGTP YMSPE IQ   Y+ KSD+W++GC+LYE+ + +  F  +  N  SL  KI N E+  +P +  ++ L DL+ R +L E +KRP   +VL+
Sbjct:   18 LSLELFIIEKKIGKGQFSEVFRAQCTWVDLHVALKKIQVFEMVDQKARQDCLKEIDLLKQLNHVNVIRYYASFIDNNQLNIVLELAEAGDMSRMIKHFKKGGRLIPEKTIWKYFVQLARALAHMHSKRIMHRDIKPANVFITGNGIVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIQESGYNFKSDLWSTGCLLYEMAALQSPFYGDKMNLYSLCKKIENCEYPPLPADIYSTQLRDLVSRCILPEASKRPETSEVLQ 279          
BLAST of NEK8-1 vs. Ensembl Fly
Match: niki (gene:FBgn0045980 transcript:FBtr0084737)

HSP 1 Score: 263.077 bits (671), Expect = 2.878e-75
Identity = 206/672 (30.65%), Postives = 321/672 (47.77%), Query Frame = 1
Query:  127 VVSYVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDK---NKINEIQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYL--RQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLNEDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKH-------------------------------PVWKGNCQSMIDQVH-RTNQANSNSRPCSGDRKERSIVSLNSEVF-VWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTWSNIQGDKKLSGQLGHGAI-VYK-IPKLVQSLKGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGINSNETEMINQFEKITVTDPIDKSPVIINQISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHEDNIYK-PTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSGSSQKNLCYDVPFETKFKIVAVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKT--HKDVNKSSKVFAGKKIEKISCGDYFTIVSTTNNEIFGWG 2013
            + +Y +VRV+G+G++G A+LYR   D   +V+K+I++ +      +   NE+D+ S L HPNIV+Y   F+  +T+ IEMEYA+ G+L+  +  RQ K    E  ++  F Q+  A++Y+H  +I+HRD+KT N+FL    ++KIGDFGISK++N    A T +GTP Y SPE+ +G  Y +KSDIWA GC+L E+   KK F  SN   L  KI+ G +  +P+   S L  L+  LL  E  +RP+A +VL +                               PV      ++  ++   T Q  +     +       I+   S ++ +   G   ++   Q   K   + VA   SHFVV+  +   Y W      +   GQLG  A+  +K  P  ++S++   +     G+  TI ++  G +  CGSN +  LG    + E  N      +    D   V + Q++ G  H  A+   E  ++ WG    G LGLG+     K P  + +   K K   +YCG DT+ ++   +  L  CG+N YNKLG    A+                 T FK V +    KV+     ++H+  L     +Y  G N+ GQ G+ H  +  H  +  S K    + I K +C D  TIV++ +N I  WG
Sbjct:  102 LANYEKVRVVGQGSFGIAILYRRKSDGHQIVFKQINLSELSPPGRDLAMNEVDVFSKLHHPNIVSYLGSFIKDNTLLIEMEYADGGTLAQIIAERQGKLHFPERYIIAVFEQISSAINYMHSENILHRDLKTANVFLNRRGIVKIGDFGISKIMNTKIHAQTVLGTPYYFSPEMCEGKEYDNKSDIWALGCILGEMCCLKKTFAASNLSELVTKIMAGNYTPVPSGYTSGLRSLMSNLLQVEAPRRPTASEVLVYWIPLIFRSLGKNKGYSYEDDVGGPGSDQLTAPVPAAAYSNVSMELELPTAQTETKQLMIADTAAPHEILEKRSVLYQLKAFGTCFSMAPIQLPPKAVIVDVAMSDSHFVVVNEDGSAYAWG-----EGTHGQLGLTALEAWKHYPSRMESVRNYHVVSACAGDGFTILVTQAGSLLSCGSNAHLALG----QDEQRNYHSPKLIARLAD---VRVEQVAAGLQHVLALSR-EGAVYVWGTSTCGALGLGNYQQQQKFPQKILLSHVKTKPSKIYCGPDTSAVLF-ANGELHVCGSNDYNKLGFQRSAK----------------ITAFKKVQLPH--KVTQACFSSTHSVFLVEGGYVYTMGRNAEGQRGIRHCNSVDHPTLVDSVK---SRYIVKANCSDQCTIVASEDNIITVWG 738          

HSP 2 Score: 52.373 bits (124), Expect = 1.828e-6
Identity = 52/191 (27.23%), Postives = 84/191 (43.98%), Query Frame = 1
Query: 1477 FTWGCGEYGRLGL-GHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSGSSQKNLCYDVPFETKFKIVAVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLG-HTKTHKDVNKSSKVFAGKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLGLE 2043
            + WG G +G+LGL   E   + P+ ++   +   +    C  D   I+   +  LL CG+N +  LG +          Q+N  Y  P     K++A L +V+V  V+ G  H   L     +Y++G ++ G +GLG + +  K   K        K  KI CG   + V   N E+   G  D  +LG +
Sbjct:  474 YAWGEGTHGQLGLTALEAWKHYPSRMESVRNYHVVSA--CAGDGFTILVTQAGSLLSCGSNAHLALGQD---------EQRN--YHSP-----KLIARLADVRVEQVAAGLQHVLALSREGAVYVWGTSTCGALGLGNYQQQQKFPQKILLSHVKTKPSKIYCGPDTSAVLFANGELHVCGSNDYNKLGFQ 646          
BLAST of NEK8-1 vs. Ensembl Fly
Match: Nek2 (gene:FBgn0029970 transcript:FBtr0071142)

HSP 1 Score: 159.844 bits (403), Expect = 2.885e-40
Identity = 96/272 (35.29%), Postives = 151/272 (55.51%), Query Frame = 1
Query:  106 DFSTNLNVVSYVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEI---DIDKNKINEIQNEIDILSILDHPNIVAYYNHFVYID--TVFIEMEYANAGSLSNYL---RQLKEDLSESCVLWYFFQLIYALDYIHKL----HIIHRDIKTLNIFLTTSTLLKIGDFGISKVLNEDE-FANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPV 882
            DFS    +  Y  + V+G G++G     R+     L  WK +   ++D+ K + + +EI +L  L HPNIV YY+H V  +  +V+I ME    G L+  +   R  ++   E  +    FQL  AL   H       I+HRDIK  NIFL  +   K+GDFG++++L  D+ FA + VGTP YMSPE+++G  Y  KSD+WA GC++YE+ + +  F       L+ KI  GEF  +P   ++DL +++  +L  +  +RP  E +++HP+
Sbjct:   10 DFSQK-TLQDYEVLAVMGNGSFGTCYKVRDKSTGELFAWKGMNYDELDEAKCDALVSEISVLRQLQHPNIVQYYHHLVNREAKSVYIVMECCAGGDLAQIVQRARSQRQRFEEPYIWRVLFQLCRALQVCHNKIPNGTILHRDIKPANIFLDAAGNAKLGDFGLARMLRRDQSFAASFVGTPHYMSPELVKGRKYDRKSDVWAVGCLVYEMCALRPPFRGRAFDQLSEKIAQGEFSRIPAIYSTDLQEIIAFMLAVDHEQRPGIEVIIRHPL 280          
BLAST of NEK8-1 vs. Ensembl Fly
Match: Sik2 (gene:FBgn0025625 transcript:FBtr0070340)

HSP 1 Score: 131.339 bits (329), Expect = 9.722e-31
Identity = 83/261 (31.80%), Postives = 145/261 (55.56%), Query Frame = 1
Query:  148 RVLGKGAYGKAVLYRNAVDNSLVVWKEID---IDKNKINEIQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLNEDEFANTQVGTPVYMSPEVIQGLPYSSKS-DIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWKGNCQSMIDQV 918
            R +GKG +    L R+ +  + V  K ID   +D+  + ++  E++I+  L HP+I+  Y      + ++I  EYA+ G + +Y+ +    +SES   + F+Q+I A++Y HK  I+HRD+K  N+ L  +  +KI DFG S      E   T  G+P Y +PEV +G  Y+    DIW+ G VLY ++     F+ S   SL  ++++G F+ +P   +S+   L++R+L+ EPT+R + + + +H  W   C  +++ V
Sbjct:  145 RTIGKGNFAVVKLARHRITKNEVAIKIIDKSQLDQTNLQKVYREVEIMKRLKHPHIIKLYQVMETKNMIYIVSEYASQGEIFDYIAKYGR-MSESAARFKFWQIISAVEYCHKKGIVHRDLKAENLLLDLNMNIKIADFGFSNHFKPGELLATWCGSPPYAAPEVFEGKQYTGPEIDIWSLGVVLYVLVCGALPFDGSTLQSLRDRVLSGRFR-IPFFMSSECEHLIRRMLVLEPTRRYTIDQIKRH-RWM--CPELLEHV 400          
BLAST of NEK8-1 vs. Ensembl Fly
Match: AMPKalpha (gene:FBgn0023169 transcript:FBtr0070216)

HSP 1 Score: 121.324 bits (303), Expect = 2.621e-28
Identity = 80/252 (31.75%), Postives = 134/252 (53.17%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNK----INEIQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLNEDEFANTQVGTPVYMSPEVIQGLPYSSKS-DIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKH 876
            Y+    LG G +GK  +  + +    V  K ++  K K    + +I+ EI  L +  HP+I+  Y        +F+ MEY + G L +Y+ +    L E     +F Q+I  +DY H+  I+HRD+K  N+ L  +  +KI DFG+S ++ + EF  T  G+P Y +PEVI G  Y+    DIW+ G +LY ++     F+  +  +L  KI +G F  +P   N  +++L+ ++L  +P KR + E++ KH
Sbjct:   28 YLLGATLGTGTFGKVKIGEHQITRVKVAVKILNRQKIKSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMIMEYVSGGELFDYIVK-HGKLQEHQARRFFQQIISGVDYCHRHMIVHRDLKPENLLLDHNMHVKIADFGLSNMMLDGEFLRTSCGSPNYAAPEVISGKLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFRKIKSGIF-PIPEYLNKQVVNLVCQMLQVDPLKRANIEEIKKH 277          
BLAST of NEK8-1 vs. Ensembl Fly
Match: AMPKalpha (gene:FBgn0023169 transcript:FBtr0070217)

HSP 1 Score: 121.324 bits (303), Expect = 2.621e-28
Identity = 80/252 (31.75%), Postives = 134/252 (53.17%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNK----INEIQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLNEDEFANTQVGTPVYMSPEVIQGLPYSSKS-DIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKH 876
            Y+    LG G +GK  +  + +    V  K ++  K K    + +I+ EI  L +  HP+I+  Y        +F+ MEY + G L +Y+ +    L E     +F Q+I  +DY H+  I+HRD+K  N+ L  +  +KI DFG+S ++ + EF  T  G+P Y +PEVI G  Y+    DIW+ G +LY ++     F+  +  +L  KI +G F  +P   N  +++L+ ++L  +P KR + E++ KH
Sbjct:   28 YLLGATLGTGTFGKVKIGEHQITRVKVAVKILNRQKIKSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMIMEYVSGGELFDYIVK-HGKLQEHQARRFFQQIISGVDYCHRHMIVHRDLKPENLLLDHNMHVKIADFGLSNMMLDGEFLRTSCGSPNYAAPEVISGKLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFRKIKSGIF-PIPEYLNKQVVNLVCQMLQVDPLKRANIEEIKKH 277          
BLAST of NEK8-1 vs. Ensembl Zebrafish
Match: nek8 (NIMA-related kinase 8 [Source:NCBI gene;Acc:171094])

HSP 1 Score: 327.405 bits (838), Expect = 1.141e-99
Identity = 221/678 (32.60%), Postives = 354/678 (52.21%), Query Frame = 1
Query:  109 FSTNLNVVSYVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNKINE---IQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYL-RQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLL-KIGDFGISKVLNEDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKH-----PVWK-----GNCQ-SMIDQVHRTNQANSNSRP---CSGDRKERSIVSLN----------SEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTW---SNIQGDKKLSGQLGHGAIVYKIPKLVQSLKGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGI-NSNETEMINQFEKITVTDPIDKSPVIINQISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSGSSQKNLCYDVPFETKFKIV--AVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFAGKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLG 2037
            F  + N+  Y +++V+G+GA+G   L R   D++LV+ KEI +++   +E    QNE  +L +L HPNI+ YY +F+    + I MEYA  G+L++Y+ ++    L E  +L +F Q++ AL ++H   I+HRD+KT NI L    ++ KIGDFGISK+L     A T VGTP Y+SPE+ +G PY+ KSDIWA GCVLYE+ S K+ FE +N  +L +KI++G F  + +  + +L  L+  +L  +P+KRP   +++ H     P+       GN +   I++     QA  + RP    +  R    + SL           S V+ WG G    L++     +   +QV+ G +  + +T    L TW   S   G+  L G +      + I + ++   GV IK VSCG+  T CL+  G +   GS   G LG  N N+       E +   +        + Q+SCG  H  A+   E  +F+WG G+ GRLGL  +D+   P  V +P    + + V CG D + I+     ++L CGNN++NKLG++     +SG+ + +    V     F++V  A L   K+  +  G +H+  +    + + FG N +GQ+G  H ++ +   + S +   + I   +CGD FT+      E++ WG+   GRLG
Sbjct:   41 FGASENMEKYEKIKVVGRGAFGIVHLCRRRTDSALVILKEIPVEQMTRDERLAAQNECQVLKLLSHPNIIEYYENFLEDKALMIAMEYAPGGTLADYIQKRCNSLLDEDTILHFFVQILLALYHVHNKLILHRDLKTQNILLDKHQMIVKIGDFGISKILVSKSKAYTVVGTPCYISPELCEGKPYNQKSDIWALGCVLYELASLKRAFEAANLPALVLKIMSGTFAPISDRYSPELRQLILNMLNLDPSKRPQLNEIMAHAICIRPLLNLYTDIGNVKMRRIEKPLSNVQAGPHGRPGGWITSTRTRGGLSSLTSSKMMHPLPLSSVYTWGSGISTPLRLPMLNTE--VIQVSLGRTQKMGVTKSGRLITWEAPSVGSGEPTLPGAVEQMQPQF-ISRFLEGQSGVTIKSVSCGDLFTTCLTDRGIIMTFGSGSNGCLGHGNFNDVTQPKIVEALLGYE--------LVQVSCGASHVLAVTN-EREVFSWGRGDNGRLGLATQDSHNCPQQVSLP-ADFEAQRVLCGVDCSMIM-STQHQILACGNNRFNKLGLD----KVSGTEEPSSFCQVEEVHLFQLVQSAPLNTEKIVYIDIGTAHSVAVTEKGQCFTFGSNQHGQLGCSHRRSSRVPYQVSGL---QGITMAACGDAFTLAIGAEGEVYTWGKGARGRLG 697          

HSP 2 Score: 57.3806 bits (137), Expect = 6.633e-8
Identity = 34/98 (34.69%), Postives = 48/98 (48.98%), Query Frame = 1
Query: 1777 VKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFA--GKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLGLEITVDQRC 2064
            V + +VSCG+  T  L     +  FG  S G +G G+     DV +   V A  G ++ ++SCG    +  T   E+F WGR D+GRLGL       C
Sbjct:  444 VTIKSVSCGDLFTTCLTDRGIIMTFGSGSNGCLGHGN---FNDVTQPKIVEALLGYELVQVSCGASHVLAVTNEREVFSWGRGDNGRLGLATQDSHNC 538          
BLAST of NEK8-1 vs. Ensembl Zebrafish
Match: nek8 (NIMA-related kinase 8 [Source:NCBI gene;Acc:171094])

HSP 1 Score: 323.939 bits (829), Expect = 6.634e-99
Identity = 219/669 (32.74%), Postives = 350/669 (52.32%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNKINE---IQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYL-RQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLL-KIGDFGISKVLNEDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKH-----PVWK-----GNCQ-SMIDQVHRTNQANSNSRP---CSGDRKERSIVSLN----------SEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTW---SNIQGDKKLSGQLGHGAIVYKIPKLVQSLKGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGI-NSNETEMINQFEKITVTDPIDKSPVIINQISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSGSSQKNLCYDVPFETKFKIV--AVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFAGKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLG 2037
            Y +++V+G+GA+G   L R   D++LV+ KEI +++   +E    QNE  +L +L HPNI+ YY +F+    + I MEYA  G+L++Y+ ++    L E  +L +F Q++ AL ++H   I+HRD+KT NI L    ++ KIGDFGISK+L     A T VGTP Y+SPE+ +G PY+ KSDIWA GCVLYE+ S K+ FE +N  +L +KI++G F  + +  + +L  L+  +L  +P+KRP   +++ H     P+       GN +   I++     QA  + RP    +  R    + SL           S V+ WG G    L++     +   +QV+ G +  + +T    L TW   S   G+  L G +      + I + ++   GV IK VSCG+  T CL+  G +   GS   G LG  N N+       E +   + +        Q+SCG  H  A+   E  +F+WG G+ GRLGL  +D+   P  V +P    + + V CG D + I+     ++L CGNN++NKLG++     +SG+ + +    V     F++V  A L   K+  +  G +H+  +    + + FG N +GQ+G  H ++ +   + S +   + I   +CGD FT+      E++ WG+   GRLG
Sbjct:    4 YEKIKVVGRGAFGIVHLCRRRTDSALVILKEIPVEQMTRDERLAAQNECQVLKLLSHPNIIEYYENFLEDKALMIAMEYAPGGTLADYIQKRCNSLLDEDTILHFFVQILLALYHVHNKLILHRDLKTQNILLDKHQMIVKIGDFGISKILVSKSKAYTVVGTPCYISPELCEGKPYNQKSDIWALGCVLYELASLKRAFEAANLPALVLKIMSGTFAPISDRYSPELRQLILNMLNLDPSKRPQLNEIMAHAICIRPLLNLYTDIGNVKMRRIEKPLSNVQAGPHGRPGGWITSTRTRGGLSSLTSSKMMHPLPLSSVYTWGSGISTPLRLSMLNTE--VIQVSLGRTQKMGVTKSGRLITWEAPSVGSGEPTLPGAVEQMQPQF-ISRFLEGQSGVTIKSVSCGDLFTTCLTDRGIIMTFGSGSNGCLGHGNFNDVTQPKIVEALLGYELV--------QVSCGASHVLAVTN-EREVFSWGRGDNGRLGLATQDSHNCPQQVSLPA-DFEAQRVLCGVDCSMIM-STQHQILACGNNRFNKLGLD----KVSGTEEPSSFCQVEEVHLFQLVQSAPLNTEKIVYIDIGTAHSVAVTEKGQCFTFGSNQHGQLGCSHRRSSRVPYQVSGL---QGITMAACGDAFTLAIGAEGEVYTWGKGARGRLG 651          

HSP 2 Score: 57.3806 bits (137), Expect = 6.797e-8
Identity = 34/98 (34.69%), Postives = 48/98 (48.98%), Query Frame = 1
Query: 1777 VKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFA--GKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLGLEITVDQRC 2064
            V + +VSCG+  T  L     +  FG  S G +G G+     DV +   V A  G ++ ++SCG    +  T   E+F WGR D+GRLGL       C
Sbjct:  398 VTIKSVSCGDLFTTCLTDRGIIMTFGSGSNGCLGHGN---FNDVTQPKIVEALLGYELVQVSCGASHVLAVTNEREVFSWGRGDNGRLGLATQDSHNC 492          
BLAST of NEK8-1 vs. Ensembl Zebrafish
Match: nek1 (NIMA-related kinase 1 [Source:ZFIN;Acc:ZDB-GENE-040730-1])

HSP 1 Score: 173.326 bits (438), Expect = 4.106e-48
Identity = 99/253 (39.13%), Postives = 149/253 (58.89%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDK---NKINEIQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKEDL-SESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLNED-EFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHP 879
            Y +++ +G+G++GKA+L ++  D    V KEI I +    +  E + E+ +L+ + HPNIV Y   F     ++I M+Y   G L   +   +  L  E  +L +F Q+  AL ++H   I+HRDIK+ NIFLT    +++GDFGI++VLN   E A T +GTP Y+SPE+ +  PY++KSDIWA GCVLYE+ + K  FE  N  +L +KII G +  +    + DL  LL +L    P +RPS   +L  P
Sbjct:    4 YERLKKIGEGSFGKAILVKSRTDGRQYVIKEIGISRMSNKERQESRKEVAVLANMSHPNIVQYKESFEESGCLYIVMDYCEGGDLFKKINNQRGSLFPEEQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYEMCTLKHAFEAGNMKNLVLKIIRGSYPPVSIHYSPDLRSLLAQLFKRNPRERPSVSTILDKP 256          
BLAST of NEK8-1 vs. Ensembl Zebrafish
Match: nek12 (NIMA-related kinase 12 [Source:ZFIN;Acc:ZDB-GENE-050410-11])

HSP 1 Score: 176.407 bits (446), Expect = 4.251e-47
Identity = 103/283 (36.40%), Postives = 169/283 (59.72%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNKINEIQN----EIDILSILDHPNIVAYYNHFVYI--DTVFIEMEYANAGSLSNYLRQLK--EDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLNED-EFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWKGNCQSMI-DQVHRTNQANSNSRP 954
            Y +V  LG+G  G   L ++     L   K I +D ++  + ++    E  +L  L HP+I+ + + F     ++++I M+Y + G+L +++++ K  E  +ES ++ +F Q++ A+ YIH   I+HRDIK  N+ LT   ++K+GDFGISK++N   + A+T VGTP Y+SPE+ Q +PYS+KSDIWA GC+LYE+ + K  F+  N LSL  KII GE+  +P   + D+  L++++L   P  RPSA  +L     + +  + I +Q     + N+ SRP
Sbjct:    4 YDKVLTLGQGGAGVVSLMKHVDTKKLCAVKRIHVDSSRKTKTKDVVLQEAIVLRSLKHPHIITWIDTFFDATNESIYIVMDYCDGGTLDDHIKEQKCGEHFTESNIMDWFVQVVMAVSYIHSEKILHRDIKPSNVLLTKRGVIKLGDFGISKIMNHTLDMASTCVGTPSYLSPELCQDVPYSTKSDIWAVGCLLYELCALKPAFQAKNLLSLFYKIIKGEYIKVPEMYSEDIHTLIEKMLSLIPENRPSAASILSMTYVQEHLGNFITNQEKELTKVNAESRP 286          
BLAST of NEK8-1 vs. Ensembl Zebrafish
Match: nek12 (NIMA-related kinase 12 [Source:ZFIN;Acc:ZDB-GENE-050410-11])

HSP 1 Score: 176.407 bits (446), Expect = 4.251e-47
Identity = 103/283 (36.40%), Postives = 169/283 (59.72%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNKINEIQN----EIDILSILDHPNIVAYYNHFVYI--DTVFIEMEYANAGSLSNYLRQLK--EDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLNED-EFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWKGNCQSMI-DQVHRTNQANSNSRP 954
            Y +V  LG+G  G   L ++     L   K I +D ++  + ++    E  +L  L HP+I+ + + F     ++++I M+Y + G+L +++++ K  E  +ES ++ +F Q++ A+ YIH   I+HRDIK  N+ LT   ++K+GDFGISK++N   + A+T VGTP Y+SPE+ Q +PYS+KSDIWA GC+LYE+ + K  F+  N LSL  KII GE+  +P   + D+  L++++L   P  RPSA  +L     + +  + I +Q     + N+ SRP
Sbjct:    4 YDKVLTLGQGGAGVVSLMKHVDTKKLCAVKRIHVDSSRKTKTKDVVLQEAIVLRSLKHPHIITWIDTFFDATNESIYIVMDYCDGGTLDDHIKEQKCGEHFTESNIMDWFVQVVMAVSYIHSEKILHRDIKPSNVLLTKRGVIKLGDFGISKIMNHTLDMASTCVGTPSYLSPELCQDVPYSTKSDIWAVGCLLYELCALKPAFQAKNLLSLFYKIIKGEYIKVPEMYSEDIHTLIEKMLSLIPENRPSAASILSMTYVQEHLGNFITNQEKELTKVNAESRP 286          
BLAST of NEK8-1 vs. Ensembl Xenopus
Match: nek9 (NIMA-related kinase 9 [Source:NCBI gene;Acc:100216232])

HSP 1 Score: 534.643 bits (1376), Expect = 1.291e-176
Identity = 294/706 (41.64%), Postives = 431/706 (61.05%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNKINEIQ---NEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSL-SNYLRQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLN-EDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXX----XNEPTKRPSAEDVLKHPVWKGNCQSMIDQVHRTNQANSNSRPCSGDRKERSIV---SLNSEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTWSNIQGDKKLSGQLGHG-AIVYKIPKLVQSLKGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGINSNETEMINQFEKITVTDPIDKSPVIINQISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSGSSQKNLCYDVPFETKFKIVAVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFAGKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLGLEITVDQR------CVLHPRALFGTLQKCADIQSFGWQTIMITERILETSTISANSTAI 2196
            Y+ +RVLG GAYG+A LYR   D+SLVVWKE+ + +    E +   NEI ILS+L H NI+AYYNHF+  +T+ IE+EY N G+L    +RQ  +   E  VLWY FQ++ A+  IH+  I+HRDIKTLNIFLT + L+K+GD+G++K L+ E   A T VGT  YMSPE+ QG+ YS KSDIWA GCVLYE+++  + F+ +N L+L +KI+ G +      +NS     L  ++      +P KRP+A+++LK P+     + M ++V   N+  SN +P +G   E  I    S +SEV+VWGGGK    K++ F+    A QV AG +HF V+T EK+LYTW N+QG  KL GQLGHG    Y+ PK V+ L+G  +++VSCG + T+C+S  G+++  GS+YYG LG+N +    +   E + V D     PV   Q+SCG  H  A+   +  +++WGCGEYGRLGL  ED++Y P  V++    C +  V CG D +F++   + ++L CG N++NKLG+N +  G+          +VP+ T   +   L   K+ ++S G +HTA +D   +L  FG N  GQ+G+G  + H  +N       GK++ ++SCGD FTI +T +N IF WG   +GRL +  T ++R      C   PR +FG+L    D+   GW TI+I E++L + TI +NS+ +
Sbjct:   34 YIPIRVLGHGAYGEATLYRRTEDDSLVVWKEVGLARLSEKERRDALNEIVILSLLQHDNIIAYYNHFLDSNTLLIELEYCNGGNLFDKIVRQKAQLFQEEMVLWYLFQIVSAVSCIHRAGILHRDIKTLNIFLTKANLIKLGDYGLAKQLSSEYSMAETCVGTLYYMSPELCQGVKYSFKSDIWAVGCVLYELLTLTRTFDATNPLNLCVKIVQGNWAM--GLDNSVYSQDLIEVVHACLEQDPEKRPTADEILKMPILSWRRRDMEEKVSMLNR--SNKKPRTGTVTEAPIAVVTSRSSEVYVWGGGKTTPQKLDVFKGGCRARQVCAGDAHFAVVTVEKELYTWVNMQGGSKLHGQLGHGDRASYRQPKHVEKLQGKSVQQVSCGSDFTVCISDEGQLYSFGSDYYGCLGVNQSAGAEV--LEPLLV-DFFLNEPV--EQVSCGDSHIIALTRSK-CVYSWGCGEYGRLGLDSEDDVYSPQKVEVQRDLCIVN-VCCGSDGSFLL-TLTGKVLACGLNEHNKLGLNQYTAGII---NHEAFQEVPYTTSLTLAKQLSFYKIRSISPGRTHTAAIDERGRLLTFGSNKCGQLGVGDYRKHLGINLLGGPLGGKQVIRVSCGDEFTIAATADNHIFAWGNGGNGRLAM--TPNERPQGSDICTSWPRPIFGSLHHVTDLSCRGWHTILIVEKVLNSKTIRSNSSGL 722          
BLAST of NEK8-1 vs. Ensembl Xenopus
Match: nek9 (NIMA-related kinase 9 [Source:NCBI gene;Acc:100216232])

HSP 1 Score: 533.872 bits (1374), Expect = 3.471e-176
Identity = 294/706 (41.64%), Postives = 431/706 (61.05%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNKINEIQ---NEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSL-SNYLRQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLN-EDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXX----XNEPTKRPSAEDVLKHPVWKGNCQSMIDQVHRTNQANSNSRPCSGDRKERSIV---SLNSEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTWSNIQGDKKLSGQLGHG-AIVYKIPKLVQSLKGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGINSNETEMINQFEKITVTDPIDKSPVIINQISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSGSSQKNLCYDVPFETKFKIVAVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFAGKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLGLEITVDQR------CVLHPRALFGTLQKCADIQSFGWQTIMITERILETSTISANSTAI 2196
            Y+ +RVLG GAYG+A LYR   D+SLVVWKE+ + +    E +   NEI ILS+L H NI+AYYNHF+  +T+ IE+EY N G+L    +RQ  +   E  VLWY FQ++ A+  IH+  I+HRDIKTLNIFLT + L+K+GD+G++K L+ E   A T VGT  YMSPE+ QG+ YS KSDIWA GCVLYE+++  + F+ +N L+L +KI+ G +      +NS     L  ++      +P KRP+A+++LK P+     + M ++V   N+  SN +P +G   E  I    S +SEV+VWGGGK    K++ F+    A QV AG +HF V+T EK+LYTW N+QG  KL GQLGHG    Y+ PK V+ L+G  +++VSCG + T+C+S  G+++  GS+YYG LG+N +    +   E + V D     PV   Q+SCG  H  A+   +  +++WGCGEYGRLGL  ED++Y P  V++    C +  V CG D +F++   + ++L CG N++NKLG+N +  G+          +VP+ T   +   L   K+ ++S G +HTA +D   +L  FG N  GQ+G+G  + H  +N       GK++ ++SCGD FTI +T +N IF WG   +GRL +  T ++R      C   PR +FG+L    D+   GW TI+I E++L + TI +NS+ +
Sbjct:   34 YIPIRVLGHGAYGEATLYRRTEDDSLVVWKEVGLARLSEKERRDALNEIVILSLLQHDNIIAYYNHFLDSNTLLIELEYCNGGNLFDKIVRQKAQLFQEEMVLWYLFQIVSAVSCIHRAGILHRDIKTLNIFLTKANLIKLGDYGLAKQLSSEYSMAETCVGTLYYMSPELCQGVKYSFKSDIWAVGCVLYELLTLTRTFDATNPLNLCVKIVQGNWAM--GLDNSVYSQDLIEVVHACLEQDPEKRPTADEILKMPILSWRRRDMEEKVSMLNR--SNKKPRTGTVTEAPIAVVTSRSSEVYVWGGGKTTPQKLDVFKGGCRARQVCAGDAHFAVVTVEKELYTWVNMQGGSKLHGQLGHGDRASYRQPKHVEKLQGKSVQQVSCGSDFTVCISDEGQLYSFGSDYYGCLGVNQSAGAEV--LEPLLV-DFFLNEPV--EQVSCGDSHIIALTRSK-CVYSWGCGEYGRLGLDSEDDVYSPQKVEVQRDLCIVN-VCCGSDGSFLL-TLTGKVLACGLNEHNKLGLNQYTAGII---NHEAFQEVPYTTSLTLAKQLSFYKIRSISPGRTHTAAIDERGRLLTFGSNKCGQLGVGDYRKHLGINLLGGPLGGKQVIRVSCGDEFTIAATADNHIFAWGNGGNGRLAM--TPNERPQGSDICTSWPRPIFGSLHHVTDLSCRGWHTILIVEKVLNSKTIRSNSSGL 722          
BLAST of NEK8-1 vs. Ensembl Xenopus
Match: nek9 (NIMA-related kinase 9 [Source:NCBI gene;Acc:100216232])

HSP 1 Score: 492.271 bits (1266), Expect = 2.112e-161
Identity = 282/704 (40.06%), Postives = 414/704 (58.81%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNKINEIQ---NEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLN-EDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXX----XXXXXXXNEPTKRPSAEDVLKHPV--WKGNCQSMIDQVHRTNQANSNSRPCSGDRKERSIVSLNSEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTWSNIQGDKKLSGQLGHG-AIVYKIPKLVQSLKGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGINSNETEMINQFEKITVTDPIDKSPVIINQISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSGSSQKNLCYDVPFETKFKIVAVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFAGKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLGLEITVDQR------CVLHPRALFGTLQKCADIQSFGWQTIMITERILETSTISANSTAI 2196
            Y+ +RVLG GAYG+A LYR   D+SLVVWKE+ + +    E +   NEI ILS+L H NI+AYYNHF+  +T+ IE+EY N  SL N   Q+K+                A+  IH+  I+HRDIKTLNIFLT + L+K+GD+G++K L+ E   A T VGT  YMSPE+ QG+ YS KSDIWA GCVLYE+++  + F+ +N L+L +KI+ G +      +NS        ++   L  +P KRP+A+++LK P+  W+           R+        P +       + S +SEV+VWGGGK    K++ F+    A QV AG +HF V+T EK+LYTW N+QG  KL GQLGHG    Y+ PK V+ L+G  +++VSCG + T+C+S  G+++  GS+YYG LG+N +    +   E + V D     PV   Q+SCG  H  A+   +  +++WGCGEYGRLGL  ED++Y P  V++    C +  V CG D +F++   + ++L CG N++NKLG+N +  G+          +VP+ T   +   L   K+ ++S G +HTA +D   +L  FG N  GQ+G+G  + H  +N       GK++ ++SCGD FTI +T +N IF WG   +GRL +  T ++R      C   PR +FG+L    D+   GW TI+I E++L + TI +NS+ +
Sbjct:   34 YIPIRVLGHGAYGEATLYRRTEDDSLVVWKEVGLARLSEKERRDALNEIVILSLLQHDNIIAYYNHFLDSNTLLIELEYCNGKSLQN---QIKD----------------AVSCIHRAGILHRDIKTLNIFLTKANLIKLGDYGLAKQLSSEYSMAETCVGTLYYMSPELCQGVKYSFKSDIWAVGCVLYELLTLTRTFDATNPLNLCVKIVQGNWAM--GLDNSVYSQDLIEVVHACLEQDPEKRPTADEILKMPILSWR-----------RSLNIFYLPSPIA------VVTSRSSEVYVWGGGKTTPQKLDVFKGGCRARQVCAGDAHFAVVTVEKELYTWVNMQGGSKLHGQLGHGDRASYRQPKHVEKLQGKSVQQVSCGSDFTVCISDEGQLYSFGSDYYGCLGVNQSAGAEV--LEPLLV-DFFLNEPV--EQVSCGDSHIIALTRSK-CVYSWGCGEYGRLGLDSEDDVYSPQKVEVQRDLCIVN-VCCGSDGSFLL-TLTGKVLACGLNEHNKLGLNQYTAGIINHEAFQ---EVPYTTSLTLAKQLSFYKIRSISPGRTHTAAIDERGRLLTFGSNKCGQLGVGDYRKHLGINLLGGPLGGKQVIRVSCGDEFTIAATADNHIFAWGNGGNGRLAM--TPNERPQGSDICTSWPRPIFGSLHHVTDLSCRGWHTILIVEKVLNSKTIRSNSSGL 686          
BLAST of NEK8-1 vs. Ensembl Xenopus
Match: nek9 (NIMA-related kinase 9 [Source:NCBI gene;Acc:100216232])

HSP 1 Score: 492.271 bits (1266), Expect = 7.717e-161
Identity = 282/704 (40.06%), Postives = 414/704 (58.81%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNKINEIQ---NEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLN-EDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXX----XNEPTKRPSAEDVLKHPV--WKGNCQSMIDQVHRTNQANSNSRPCSGDRKERSIVSLNSEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTWSNIQGDKKLSGQLGHG-AIVYKIPKLVQSLKGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGINSNETEMINQFEKITVTDPIDKSPVIINQISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSGSSQKNLCYDVPFETKFKIVAVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFAGKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLGLEITVDQR------CVLHPRALFGTLQKCADIQSFGWQTIMITERILETSTISANSTAI 2196
            Y+ +RVLG GAYG+A LYR   D+SLVVWKE+ + +    E +   NEI ILS+L H NI+AYYNHF+  +T+ IE+EY N  SL N   Q+K+                A+  IH+  I+HRDIKTLNIFLT + L+K+GD+G++K L+ E   A T VGT  YMSPE+ QG+ YS KSDIWA GCVLYE+++  + F+ +N L+L +KI+ G +      +NS     L  ++      +P KRP+A+++LK P+  W+           R+        P +       + S +SEV+VWGGGK    K++ F+    A QV AG +HF V+T EK+LYTW N+QG  KL GQLGHG    Y+ PK V+ L+G  +++VSCG + T+C+S  G+++  GS+YYG LG+N +    +   E + V D     PV   Q+SCG  H  A+   +  +++WGCGEYGRLGL  ED++Y P  V++    C +  V CG D +F++   + ++L CG N++NKLG+N +  G+          +VP+ T   +   L   K+ ++S G +HTA +D   +L  FG N  GQ+G+G  + H  +N       GK++ ++SCGD FTI +T +N IF WG   +GRL +  T ++R      C   PR +FG+L    D+   GW TI+I E++L + TI +NS+ +
Sbjct:   34 YIPIRVLGHGAYGEATLYRRTEDDSLVVWKEVGLARLSEKERRDALNEIVILSLLQHDNIIAYYNHFLDSNTLLIELEYCNGKSLQN---QIKD----------------AVSCIHRAGILHRDIKTLNIFLTKANLIKLGDYGLAKQLSSEYSMAETCVGTLYYMSPELCQGVKYSFKSDIWAVGCVLYELLTLTRTFDATNPLNLCVKIVQGNWAM--GLDNSVYSQDLIEVVHACLEQDPEKRPTADEILKMPILSWR-----------RSLNIFYLPSPIA------VVTSRSSEVYVWGGGKTTPQKLDVFKGGCRARQVCAGDAHFAVVTVEKELYTWVNMQGGSKLHGQLGHGDRASYRQPKHVEKLQGKSVQQVSCGSDFTVCISDEGQLYSFGSDYYGCLGVNQSAGAEV--LEPLLV-DFFLNEPV--EQVSCGDSHIIALTRSK-CVYSWGCGEYGRLGLDSEDDVYSPQKVEVQRDLCIVN-VCCGSDGSFLL-TLTGKVLACGLNEHNKLGLNQYTAGIINHEAFQ---EVPYTTSLTLAKQLSFYKIRSISPGRTHTAAIDERGRLLTFGSNKCGQLGVGDYRKHLGINLLGGPLGGKQVIRVSCGDEFTIAATADNHIFAWGNGGNGRLAM--TPNERPQGSDICTSWPRPIFGSLHHVTDLSCRGWHTILIVEKVLNSKTIRSNSSGL 686          
BLAST of NEK8-1 vs. Ensembl Xenopus
Match: nek9 (NIMA-related kinase 9 [Source:NCBI gene;Acc:100216232])

HSP 1 Score: 478.404 bits (1230), Expect = 6.077e-155
Identity = 280/705 (39.72%), Postives = 412/705 (58.44%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNKINEIQ---NEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLN-EDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXX----XNEPTKRPSAEDVLKHPVWKGNCQSMIDQVHRTNQANSNSRPCSGDRKERSIV---SLNSEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTWSNIQGDKKLSGQLGHG-AIVYKIPKLVQSLKGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGINSNETEMINQFEKITVTDPIDKSPVIINQISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSGSSQKNLCYDVPFETKFKIVAVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFAGKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLGLEITVDQR------CVLHPRALFGTLQKCADIQSFGWQTIMITERILETSTISANSTAI 2196
            Y+ +RVLG GAYG+A LYR   D+SLVVWKE+ + +    E +   NEI ILS+L H NI+AYYNHF+  +T+ IE+EY N  SL N   Q+K+                A+  IH+  I+HRDIKTLNIFLT + L+K+GD+G++K L+ E   A T VGT  YMSPE+ QG+ YS KSDIWA GCVLYE+++  + F+ +N L+L +KI+ G +      +NS     L  ++      +P KRP+A+++LK P+     + M ++V   N+  SN +P +G   E  I    S +SEV+VWGGGK    K++ F+    A QV AG +HF V+T EK+LYTW N+QG  KL GQLGHG    Y+ PK V+ L+G  +++VSCG + T+C+S  G+++  GS+YYG LG+N +    +   E + V D     PV   Q+SCG  H  A+   +  +++WGCGEY  L             V++    C +  V CG D +F++   + ++L CG N++NKLG+N +  G+          +VP+ T   +   L   K+ ++S G +HTA +D   +L  FG N  GQ+G+G  + H  +N       GK++ ++SCGD FTI +T +N IF WG   +GRL +  T ++R      C   PR +FG+L    D+   GW TI+I E++L + TI +NS+ +
Sbjct:   48 YIPIRVLGHGAYGEATLYRRTEDDSLVVWKEVGLARLSEKERRDALNEIVILSLLQHDNIIAYYNHFLDSNTLLIELEYCNGKSLQN---QIKD----------------AVSCIHRAGILHRDIKTLNIFLTKANLIKLGDYGLAKQLSSEYSMAETCVGTLYYMSPELCQGVKYSFKSDIWAVGCVLYELLTLTRTFDATNPLNLCVKIVQGNWAM--GLDNSVYSQDLIEVVHACLEQDPEKRPTADEILKMPILSWRRRDMEEKVSMLNR--SNKKPRTGTVTEAPIAVVTSRSSEVYVWGGGKTTPQKLDVFKGGCRARQVCAGDAHFAVVTVEKELYTWVNMQGGSKLHGQLGHGDRASYRQPKHVEKLQGKSVQQVSCGSDFTVCISDEGQLYSFGSDYYGCLGVNQSAGAEV--LEPLLV-DFFLNEPV--EQVSCGDSHIIALTRSK-CVYSWGCGEYVSL--------LSFWQVEVQRDLCIVN-VCCGSDGSFLL-TLTGKVLACGLNEHNKLGLNQYTAGII---NHEAFQEVPYTTSLTLAKQLSFYKIRSISPGRTHTAAIDERGRLLTFGSNKCGQLGVGDYRKHLGINLLGGPLGGKQVIRVSCGDEFTIAATADNHIFAWGNGGNGRLAM--TPNERPQGSDICTSWPRPIFGSLHHVTDLSCRGWHTILIVEKVLNSKTIRSNSSGL 708          
BLAST of NEK8-1 vs. Ensembl Mouse
Match: Nek9 (NIMA (never in mitosis gene a)-related expressed kinase 9 [Source:MGI Symbol;Acc:MGI:2387995])

HSP 1 Score: 515.768 bits (1327), Expect = 8.215e-169
Identity = 286/702 (40.74%), Postives = 434/702 (61.82%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNKINEIQ---NEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSL-SNYLRQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLN-EDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIING--EFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWKGNCQSMIDQVHRTNQANSNSRPCSGDRKERSIV-SLNSEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTWSNIQGDKKLSGQLGHG-AIVYKIPKLVQSLKGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGINS-NETEMINQFE-KITVTDPIDKSPVIINQISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSGSSQKNLCYDVPFETKFKIVAVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFAGKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLGLEITVDQR----CVLHPRALFGTLQKCADIQSFGWQTIMITERILETSTISANSTAI 2196
            Y+ +RVLG+GA+G+A LYR   D+SLVVWKE+D+ +    E +   NEI IL++L H NI+AYYNHF+   T+ IE+EY N G+L    LRQ  +   E  V+WY FQ++ A+  IHK  I+HRDIKTLNIFLT + L+K+GD+G++K LN E   A T VGTP YMSPE+ QG+ Y+ KSDIWA GCV++E+++ K+ F+ +N L+L +KI+ G    +   +  + +L+ L+   L  +P +RP+A+ +L  P+ +   + M ++V   N      R  +      ++V S  SEV+VWGGGK    K++  +   SA QV AG +HF V+T EK+LYTW N+QG  KL GQLGHG    Y+ PK V+ L+G  I +VSCG++ T+C++  G+++  GS+YYG +G++  +  E++   +    +++P++       Q+SCG +H   +   +++ ++WGCGEYGRLGL  E++ Y P  VD+P     +  V CG D TF++ + S ++L CG N++NKLG+N   Q +SG       ++VP+ T F +   L   K+ T++ G +HTA +D   +L  FG N  GQ+G+G+ K    +N       GK++ ++SCGD FTI +T +N IF WG   +GRL +  T        C   PR +FG+L    D+   GW TI+I E++L + TI +NS+ +
Sbjct:   52 YIPIRVLGRGAFGEATLYRRTEDDSLVVWKEVDLTRLSEKERRDALNEIVILALLQHDNIIAYYNHFMDNTTLLIELEYCNGGNLYDKILRQKDKLFEEEMVVWYLFQIVSAVSCIHKAGILHRDIKTLNIFLTKANLIKLGDYGLAKKLNSEYSMAETLVGTPYYMSPELCQGVKYNFKSDIWAVGCVIFELLTLKRTFDATNPLNLCVKIVQGIRAMEVDSSQYSLELIQLVHACLDQDPEQRPAADALLDLPLLRTRRREMEEKVTLLNAPTKRPRSSTVTEAPIAVVTSRTSEVYVWGGGKSTPQKLDVIKSGCSARQVCAGNTHFAVVTVEKELYTWVNMQGGTKLHGQLGHGDKASYRQPKHVEKLQGKAIHQVSCGDDFTVCVTDEGQLYAFGSDYYGCMGVDKVSGPEVLEPMQLNFFLSNPVE-------QVSCGDNHVVVLTRNKEV-YSWGCGEYGRLGLDSEEDYYTPQRVDVP-KALIIVAVQCGCDGTFLLTQ-SGKVLACGLNEFNKLGLN---QCMSGIINHEAYHEVPYTTSFTLAKQLSFYKIRTIAPGKTHTAAIDERGRLLTFGCNKCGQLGVGNYKKRLGINLLGGPLGGKQVIRVSCGDEFTIAATDDNHIFAWGNGGNGRLAMTPTERPHGSDICTSWPRPIFGSLHHVPDLSCRGWHTILIVEKVLNSKTIRSNSSGL 740          
BLAST of NEK8-1 vs. Ensembl Mouse
Match: Nek8 (NIMA (never in mitosis gene a)-related expressed kinase 8 [Source:MGI Symbol;Acc:MGI:1890646])

HSP 1 Score: 294.664 bits (753), Expect = 6.948e-88
Identity = 217/673 (32.24%), Postives = 339/673 (50.37%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDID---KNKINEIQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYL-RQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLL-KIGDFGISKVLNEDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWKGNCQSMIDQVH------RTNQANSNSRP----CSGDRKERS----------------IVSLNSEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTWSNIQGDKKLSGQLGHGAIVYKIPKLVQSL----KGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGINSNETEMINQFEKITVTDPIDKSPVIINQISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSGSSQKNLCYDVPFETKFKIV--AVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKV--FAGKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLG 2037
            Y ++RV+G+GA+G   L     D  LV+ K+I ++   K +    QNE  +L +L+HPN++ YY +F+    + I MEYA  G+L+ ++ ++    L E  +L +F Q++ AL ++H   I+HRD+KT NI L    ++ KIGDFGISK+L+    A T VGTP Y+SPE+ +G PY+ KSDIWA GCVLYE+ S K+ FE +N  +L +KI++G F  + +  + +L  L+  LL  EP +RP    ++  P+    C   +  +H      R  +A  +  P     SG    R+                I    S V+ WGGG  + L++     +   +QVAAG +    +T    L  W          G L  GA+    P+ V        GV IK V+CG+  T CL+  G +   GS   G LG + N T++     + T+ + +    ++  Q++CG  H  A+   +  LF WG G+ GRLGLG  ++   P  V +   + + + V CG D++ I+     R+L CG+N++NKLG++     LS   +      V     F  +  A L    +  V  G +H+A +      Y FG N +GQ+G   T + +      +V    G K+  ++CGD FT+      E++ WG+   GRLG
Sbjct:    4 YERIRVVGRGAFGIVHLCLRKADQKLVILKQIPVEQMTKEERQAAQNECQVLKLLNHPNVIEYYENFLEDKALMIAMEYAPGGTLAEFIQKRCNSLLEEETILHFFVQILLALHHVHTHLILHRDLKTQNILLDKHRMVVKIGDFGISKILSSKSKAYTVVGTPCYISPELCEGKPYNQKSDIWALGCVLYELASLKRAFEAANLPALVLKIMSGTFAPISDRYSPELRQLVLSLLSLEPAQRPPLSHIMAQPL----CIRALLNIHTDVGSVRMRRAEKSLTPGPPIASGSTGSRATSARCRGVPRGPVRPAIPPPLSSVYAWGGGLSSPLRLPMLNTE--VVQVAAGRTQKAGVTRSGRLILWEAPPLGAG-GGTLLPGAVELPQPQFVSRFLEGQSGVTIKHVACGDLFTACLTDRGIIMTFGSGSNGCLG-HGNLTDI----SQPTIVEALLGYEMV--QVACGASHVLALS-TDGELFAWGRGDGGRLGLGTRESHNCPQQVPVAPGQ-EAQRVVCGIDSSMIL-TSPGRVLACGSNRFNKLGLD----HLSLDEEPVPYQQVEEALSFTPLGSAPLDQEPLLCVDLGTAHSAAITASGDCYTFGSNQHGQLG---TSSRRVSRAPCRVQGLEGIKMVMVACGDAFTVAVGAEGEVYSWGKGTRGRLG 652          
BLAST of NEK8-1 vs. Ensembl Mouse
Match: Nek4 (NIMA (never in mitosis gene a)-related expressed kinase 4 [Source:MGI Symbol;Acc:MGI:1344404])

HSP 1 Score: 177.563 bits (449), Expect = 1.127e-49
Identity = 98/259 (37.84%), Postives = 155/259 (59.85%), Query Frame = 1
Query:  130 VSYVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNKINE---IQNEIDILSILDHPNIVAYYNHFVYID-TVFIEMEYANAGSLSNYLRQLK-EDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVL-NEDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWK 888
             +Y  +RV+G+G+YG+  L ++  D    V K++++      E    + E  +LS L HPNIV Y   +   D  ++I M +   G L   L++ K + L ES V+ +F Q+  AL Y+H+ HI+HRD+KT N+FLT + ++K+GD GI++VL N  + A+T +GTP YMSPE+    PY+ KSD+WA GC +YE+ + K  F   +  SL  +II G+   MP   +++L +L++ +L   P +RPS   +L+ P  K
Sbjct:    4 AAYCYMRVVGRGSYGEVTLVKHRRDGKQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPNIVTYKESWEGGDGLLYIVMGFCEGGDLYRKLKEQKGQLLPESQVVEWFVQIAMALQYLHEKHILHRDLKTQNVFLTRTNIIKVGDLGIARVLENHGDMASTLIGTPYYMSPELFSNKPYNYKSDVWALGCCVYEMATLKHAFNAKDMNSLVYRIIEGKLPPMPKVYSTELAELIRTMLSRRPEERPSVRSILRQPYIK 262          
BLAST of NEK8-1 vs. Ensembl Mouse
Match: Nek4 (NIMA (never in mitosis gene a)-related expressed kinase 4 [Source:MGI Symbol;Acc:MGI:1344404])

HSP 1 Score: 178.718 bits (452), Expect = 2.742e-46
Identity = 107/298 (35.91%), Postives = 171/298 (57.38%), Query Frame = 1
Query:  130 VSYVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNKINE---IQNEIDILSILDHPNIVAYYNHFVYID-TVFIEMEYANAGSLSNYLRQLK-EDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVL-NEDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWKGNCQSMID----QVHRTNQANSNSR--PCSG--DRKERS 981
             +Y  +RV+G+G+YG+  L ++  D    V K++++      E    + E  +LS L HPNIV Y   +   D  ++I M +   G L   L++ K + L ES V+ +F Q+  AL Y+H+ HI+HRD+KT N+FLT + ++K+GD GI++VL N  + A+T +GTP YMSPE+    PY+ KSD+WA GC +YE+ + K  F   +  SL  +II G+   MP   +++L +L++ +L   P +RPS   +L+ P  K +    ++    +  + N  N +SR  P +    RKE S
Sbjct:    4 AAYCYMRVVGRGSYGEVTLVKHRRDGKQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPNIVTYKESWEGGDGLLYIVMGFCEGGDLYRKLKEQKGQLLPESQVVEWFVQIAMALQYLHEKHILHRDLKTQNVFLTRTNIIKVGDLGIARVLENHGDMASTLIGTPYYMSPELFSNKPYNYKSDVWALGCCVYEMATLKHAFNAKDMNSLVYRIIEGKLPPMPKVYSTELAELIRTMLSRRPEERPSVRSILRQPYIKHHISLFLEATKAKTSKNNVKNCDSRAKPVAAVVSRKEES 301          
BLAST of NEK8-1 vs. Ensembl Mouse
Match: Nek4 (NIMA (never in mitosis gene a)-related expressed kinase 4 [Source:MGI Symbol;Acc:MGI:1344404])

HSP 1 Score: 178.333 bits (451), Expect = 5.408e-46
Identity = 98/259 (37.84%), Postives = 155/259 (59.85%), Query Frame = 1
Query:  130 VSYVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNKINE---IQNEIDILSILDHPNIVAYYNHFVYID-TVFIEMEYANAGSLSNYLRQLK-EDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVL-NEDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWK 888
             +Y  +RV+G+G+YG+  L ++  D    V K++++      E    + E  +LS L HPNIV Y   +   D  ++I M +   G L   L++ K + L ES V+ +F Q+  AL Y+H+ HI+HRD+KT N+FLT + ++K+GD GI++VL N  + A+T +GTP YMSPE+    PY+ KSD+WA GC +YE+ + K  F   +  SL  +II G+   MP   +++L +L++ +L   P +RPS   +L+ P  K
Sbjct:    4 AAYCYMRVVGRGSYGEVTLVKHRRDGKQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPNIVTYKESWEGGDGLLYIVMGFCEGGDLYRKLKEQKGQLLPESQVVEWFVQIAMALQYLHEKHILHRDLKTQNVFLTRTNIIKVGDLGIARVLENHGDMASTLIGTPYYMSPELFSNKPYNYKSDVWALGCCVYEMATLKHAFNAKDMNSLVYRIIEGKLPPMPKVYSTELAELIRTMLSRRPEERPSVRSILRQPYIK 262          
BLAST of NEK8-1 vs. UniProt/SwissProt
Match: sp|Q8TD19|NEK9_HUMAN (Serine/threonine-protein kinase Nek9 OS=Homo sapiens OX=9606 GN=NEK9 PE=1 SV=2)

HSP 1 Score: 533.487 bits (1373), Expect = 9.438e-175
Identity = 285/702 (40.60%), Postives = 435/702 (61.97%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNKINEIQ---NEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSL-SNYLRQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLN-EDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIING--EFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWKGNCQSMIDQVHRTNQANSNSRPCSGDRKERSIV-SLNSEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTWSNIQGDKKLSGQLGHG-AIVYKIPKLVQSLKGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGINS-NETEMINQFE-KITVTDPIDKSPVIINQISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSGSSQKNLCYDVPFETKFKIVAVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFAGKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLGLEITVDQR----CVLHPRALFGTLQKCADIQSFGWQTIMITERILETSTISANSTAI 2196
            Y+ +RVLG+GA+G+A LYR   D+SLVVWKE+D+ +    E +   NEI IL++L H NI+AYYNHF+   T+ IE+EY N G+L    LRQ  +   E  V+WY FQ++ A+  IHK  I+HRDIKTLNIFLT + L+K+GD+G++K LN E   A T VGTP YMSPE+ QG+ Y+ KSDIWA GCV++E+++ K+ F+ +N L+L +KI+ G    +   +  + +L+ ++   L  +P +RP+A+++L  P+ +   + M ++V   N      R  +      ++V S  SEV+VWGGGK    K++  +   SA QV AG +HF V+T EK+LYTW N+QG  KL GQLGHG    Y+ PK V+ L+G  I++VSCG++ T+C++  G+++  GS+YYG +G++     E++   +    +++P++       Q+SCG +H   +   +++ ++WGCGEYGRLGL  E++ Y P  VD+P     +  V CG D TF++ + S ++L CG N++NKLG+N   Q +SG       ++VP+ T F +   L   K+ T++ G +HTA +D   +L  FG N  GQ+G+G+ K    +N       GK++ ++SCGD FTI +T +N IF WG   +GRL +  T        C   PR +FG+L    D+   GW TI+I E++L + TI +NS+ +
Sbjct:   52 YIPIRVLGRGAFGEATLYRRTEDDSLVVWKEVDLTRLSEKERRDALNEIVILALLQHDNIIAYYNHFMDNTTLLIELEYCNGGNLYDKILRQKDKLFEEEMVVWYLFQIVSAVSCIHKAGILHRDIKTLNIFLTKANLIKLGDYGLAKKLNSEYSMAETLVGTPYYMSPELCQGVKYNFKSDIWAVGCVIFELLTLKRTFDATNPLNLCVKIVQGIRAMEVDSSQYSLELIQMVHSCLDQDPEQRPTADELLDRPLLRKRRREMEEKVTLLNAPTKRPRSSTVTEAPIAVVTSRTSEVYVWGGGKSTPQKLDVIKSGCSARQVCAGNTHFAVVTVEKELYTWVNMQGGTKLHGQLGHGDKASYRQPKHVEKLQGKAIRQVSCGDDFTVCVTDEGQLYAFGSDYYGCMGVDKVAGPEVLEPMQLNFFLSNPVE-------QVSCGDNHVVVLTRNKEV-YSWGCGEYGRLGLDSEEDYYTPQKVDVP-KALIIVAVQCGCDGTFLLTQ-SGKVLACGLNEFNKLGLN---QCMSGIINHEAYHEVPYTTSFTLAKQLSFYKIRTIAPGKTHTAAIDERGRLLTFGCNKCGQLGVGNYKKRLGINLLGGPLGGKQVIRVSCGDEFTIAATDDNHIFAWGNGGNGRLAMTPTERPHGSDICTSWPRPIFGSLHHVPDLSCRGWHTILIVEKVLNSKTIRSNSSGL 740          
BLAST of NEK8-1 vs. UniProt/SwissProt
Match: sp|Q7ZZC8|NEK9_XENLA (Serine/threonine-protein kinase Nek9 OS=Xenopus laevis OX=8355 GN=nek9 PE=2 SV=1)

HSP 1 Score: 530.02 bits (1364), Expect = 6.578e-174
Identity = 291/706 (41.22%), Postives = 431/706 (61.05%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNKINEIQ---NEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKEDL-SESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLN-EDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXX----XNEPTKRPSAEDVLKHPVWKGNCQSMIDQVHRTNQANSNSRPCSGDRKERSIV---SLNSEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTWSNIQGDKKLSGQLGHG-AIVYKIPKLVQSLKGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGINSNETEMINQFEKITVTDPIDKSPVIINQISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSGSSQKNLCYDVPFETKFKIVAVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFAGKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLGLEITVDQR------CVLHPRALFGTLQKCADIQSFGWQTIMITERILETSTISANSTAI 2196
            Y+ +RVLG GAYG+A LYR   D+SLVVWKE+ + +    E +   NEI ILS+L H NI+AYYNHF+  +T+ IE+EY N G+L + +   K  L  E  VLWY FQ++ A+  IHK  I+HRDIKTLNIFLT + L+K+GD+G++K L+ E   A T VGT  YMSPE+ QG+ YS KSDIWA GCVLYE+++  + F+ +N L+L +KI+ G +      +N+     L  ++      +P KRP+A+++L+ P+     + M ++V   N+  SN +P +G   E  I    S +SEV+VWGGGK    K++ F+    A QV AG +HF V+T EK+LYTW N+QG  KL GQLGHG    Y+ PK V+ L+G  +++VSCG + T+C++  G+++  GS+YYG LG+N +    +   E + V D     PV  +Q+SCG  H  A+   + + ++WGCGEYGRLGL  ED++Y P  V++    C +  V CG D +F++   + ++L CG N++NKLG+N +  G+          +VP+ T   +   L   K+ ++S G +HTA +D   +L  FG N  GQ+G+G  + H  +N       GK++ ++SCGD FT  +T +N IF WG   +GRL +  T ++R      C   PR +FG+L    D+   GW TI+I E++L + TI +NS+ +
Sbjct:   34 YIPIRVLGHGAYGEATLYRRTEDDSLVVWKEVGLARLSEKERRDALNEIVILSLLQHDNIIAYYNHFLDSNTLLIELEYCNGGNLFDKIVHQKAQLFQEETVLWYLFQIVSAVSCIHKAGILHRDIKTLNIFLTKANLIKLGDYGLAKQLSSEYSMAETCVGTLYYMSPEICQGVKYSFKSDIWAVGCVLYELLTLTRTFDATNPLNLCVKIVQGNWAV--GLDNTVYTQELIEVVHACLEQDPEKRPTADEILERPILSWRRRDMEEKVSMLNR--SNKKPRTGTVTEAPIAVVTSRSSEVYVWGGGKTTPQKLDVFKGGWRARQVCAGDAHFAVVTVEKELYTWVNMQGGSKLHGQLGHGDRASYRQPKHVEKLQGKSVQKVSCGSDFTVCITDEGQLYSFGSDYYGCLGVNQSAGSEV--LEPLLV-DFFLNEPV--DQVSCGDSHIMALTRSKSV-YSWGCGEYGRLGLDSEDDVYSPQKVEVQRGLCIVN-VCCGSDGSFLL-TLTGKVLACGLNEHNKLGLNQYTAGII---NHEAFQEVPYTTSLTLAKQLSFYKIRSISPGRTHTAAIDERGRLLTFGSNKCGQLGVGDYRKHLGINLLGGPLGGKQVIRVSCGDEFTTAATADNHIFAWGNGGNGRLAM--TPNERPQGSDICTSWPRPIFGSLHHVTDLSCRGWHTILIVEKVLNSKTIRSNSSGL 722          
BLAST of NEK8-1 vs. UniProt/SwissProt
Match: sp|Q8K1R7|NEK9_MOUSE (Serine/threonine-protein kinase Nek9 OS=Mus musculus OX=10090 GN=Nek9 PE=1 SV=2)

HSP 1 Score: 515.768 bits (1327), Expect = 5.746e-168
Identity = 286/702 (40.74%), Postives = 434/702 (61.82%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNKINEIQ---NEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSL-SNYLRQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLN-EDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIING--EFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWKGNCQSMIDQVHRTNQANSNSRPCSGDRKERSIV-SLNSEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTWSNIQGDKKLSGQLGHG-AIVYKIPKLVQSLKGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGINS-NETEMINQFE-KITVTDPIDKSPVIINQISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSGSSQKNLCYDVPFETKFKIVAVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFAGKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLGLEITVDQR----CVLHPRALFGTLQKCADIQSFGWQTIMITERILETSTISANSTAI 2196
            Y+ +RVLG+GA+G+A LYR   D+SLVVWKE+D+ +    E +   NEI IL++L H NI+AYYNHF+   T+ IE+EY N G+L    LRQ  +   E  V+WY FQ++ A+  IHK  I+HRDIKTLNIFLT + L+K+GD+G++K LN E   A T VGTP YMSPE+ QG+ Y+ KSDIWA GCV++E+++ K+ F+ +N L+L +KI+ G    +   +  + +L+ L+   L  +P +RP+A+ +L  P+ +   + M ++V   N      R  +      ++V S  SEV+VWGGGK    K++  +   SA QV AG +HF V+T EK+LYTW N+QG  KL GQLGHG    Y+ PK V+ L+G  I +VSCG++ T+C++  G+++  GS+YYG +G++  +  E++   +    +++P++       Q+SCG +H   +   +++ ++WGCGEYGRLGL  E++ Y P  VD+P     +  V CG D TF++ + S ++L CG N++NKLG+N   Q +SG       ++VP+ T F +   L   K+ T++ G +HTA +D   +L  FG N  GQ+G+G+ K    +N       GK++ ++SCGD FTI +T +N IF WG   +GRL +  T        C   PR +FG+L    D+   GW TI+I E++L + TI +NS+ +
Sbjct:   52 YIPIRVLGRGAFGEATLYRRTEDDSLVVWKEVDLTRLSEKERRDALNEIVILALLQHDNIIAYYNHFMDNTTLLIELEYCNGGNLYDKILRQKDKLFEEEMVVWYLFQIVSAVSCIHKAGILHRDIKTLNIFLTKANLIKLGDYGLAKKLNSEYSMAETLVGTPYYMSPELCQGVKYNFKSDIWAVGCVIFELLTLKRTFDATNPLNLCVKIVQGIRAMEVDSSQYSLELIQLVHACLDQDPEQRPAADALLDLPLLRTRRREMEEKVTLLNAPTKRPRSSTVTEAPIAVVTSRTSEVYVWGGGKSTPQKLDVIKSGCSARQVCAGNTHFAVVTVEKELYTWVNMQGGTKLHGQLGHGDKASYRQPKHVEKLQGKAIHQVSCGDDFTVCVTDEGQLYAFGSDYYGCMGVDKVSGPEVLEPMQLNFFLSNPVE-------QVSCGDNHVVVLTRNKEV-YSWGCGEYGRLGLDSEEDYYTPQRVDVP-KALIIVAVQCGCDGTFLLTQ-SGKVLACGLNEFNKLGLN---QCMSGIINHEAYHEVPYTTSFTLAKQLSFYKIRTIAPGKTHTAAIDERGRLLTFGCNKCGQLGVGNYKKRLGINLLGGPLGGKQVIRVSCGDEFTIAATDDNHIFAWGNGGNGRLAMTPTERPHGSDICTSWPRPIFGSLHHVPDLSCRGWHTILIVEKVLNSKTIRSNSSGL 740          
BLAST of NEK8-1 vs. UniProt/SwissProt
Match: sp|Q86SG6|NEK8_HUMAN (Serine/threonine-protein kinase Nek8 OS=Homo sapiens OX=9606 GN=NEK8 PE=1 SV=1)

HSP 1 Score: 324.324 bits (830), Expect = 3.077e-98
Identity = 214/665 (32.18%), Postives = 337/665 (50.68%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDID---KNKINEIQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYL-RQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLL-KIGDFGISKVLNEDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWKGNCQSMIDQVH------RTNQANSNSRP-----------CSGDRK---ERSIVSLNSEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTWSNIQGDKKLSGQLGHGAIVYKIPKLVQSL----KGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGINSNETEMINQFEKITVTDPIDKSPVIINQISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSGSSQKNLCYDVPFETKFKIVAVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKV--FAGKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLG 2037
            Y ++RV+G+GA+G   L     D  LV+ K+I ++   K +    QNE  +L +L+HPN++ YY +F+    + I MEYA  G+L+ ++ ++    L E  +L +F Q++ AL ++H   I+HRD+KT NI L    ++ KIGDFGISK+L+    A T VGTP Y+SPE+ +G PY+ KSDIWA GCVLYE+ S K+ FE +N  +L +KI++G F  + +  + +L  L+  LL  EP +RP    ++  P+    C   +  +H      R  +A  +  P           C G  +     +I    S V+ WGGG    L++     +   +QVAAG +    +T    L  W          G L  GA+    P+ +        GV IK V+CG+  T CL+  G +   GS   G LG  S     +    + T+ + +    ++  Q++CG  H  A+   E  LF WG G+ GRLGLG  ++   P  V +P  + + + V CG D++ I+     + L CG+N++NKLG++  + G      + +   + F       A L    + ++  G +H+A +      Y FG N +GQ+G   T T +      KV    G K+  ++CGD FT+     +E++ WG+   GRLG
Sbjct:    4 YERIRVVGRGAFGIVHLCLRKADQKLVIIKQIPVEQMTKEERQAAQNECQVLKLLNHPNVIEYYENFLEDKALMIAMEYAPGGTLAEFIQKRCNSLLEEETILHFFVQILLALHHVHTHLILHRDLKTQNILLDKHRMVVKIGDFGISKILSSKSKAYTVVGTPCYISPELCEGKPYNQKSDIWALGCVLYELASLKRAFEAANLPALVLKIMSGTFAPISDRYSPELRQLVLSLLSLEPAQRPPLSHIMAQPL----CIRALLNLHTDVGSVRMRRAEKSVAPSNTGSRTTSVRCRGIPRGPVRPAIPPPLSSVYAWGGGLGTPLRLPMLNTE--VVQVAAGRTQKAGVTRSGRLILWEAPPLGAG-GGSLLPGAVEQPQPQFISRFLEGQSGVTIKHVACGDFFTACLTDRGIIMTFGSGSNGCLGHGS-----LTDISQPTIVEALLGYEMV--QVACGASHVLAL-STERELFAWGRGDSGRLGLGTRESHSCPQQVPMPPGQ-EAQRVVCGIDSSMIL-TVPGQALACGSNRFNKLGLDHLSLGEEPVPHQQVEEALSF--TLLGSAPLDQEPLLSIDLGTAHSAAVTASGDCYTFGSNQHGQLG---TNTRRGSRAPCKVQGLEGIKMAMVACGDAFTVAIGAESEVYSWGKGARGRLG 646          

HSP 2 Score: 58.151 bits (139), Expect = 2.578e-7
Identity = 33/99 (33.33%), Postives = 51/99 (51.52%), Query Frame = 1
Query: 1774 NVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFA--GKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLGLEITVDQRC 2064
             V +  V+CG+  TA L     +  FG  S G +G G   +  D+++ + V A  G ++ +++CG    +  +T  E+F WGR DSGRLGL       C
Sbjct:  390 GVTIKHVACGDFFTACLTDRGIIMTFGSGSNGCLGHG---SLTDISQPTIVEALLGYEMVQVACGASHVLALSTERELFAWGRGDSGRLGLGTRESHSC 485          
BLAST of NEK8-1 vs. UniProt/SwissProt
Match: sp|Q90XC2|NEK8_DANRE (Serine/threonine-protein kinase Nek8 OS=Danio rerio OX=7955 GN=nek8 PE=2 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 8.068e-97
Identity = 219/669 (32.74%), Postives = 348/669 (52.02%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNKINE---IQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYL-RQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLL-KIGDFGISKVLNEDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKH-----PVWK-----GNCQ-SMIDQVHRTNQANSNSRP---CSGDRKERSIVSLNS----------EVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTW---SNIQGDKKLSGQLGHGAIVYKIPKLVQSLKGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGI-NSNETEMINQFEKITVTDPIDKSPVIINQISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSGSSQKNLCYDVPFETKFKIV--AVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFAGKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLG 2037
            Y + +V+G+GA+G   L R   D++LV+ KEI +++   +E    QNE  +L +L HPNI+ YY +F+    + I MEYA  G+L++Y+ ++    L E  +L  F Q++ AL ++H   I+HRD+KT NI L    ++ KIGDFGISK+L     A T VGTP Y+SPE+ +G PY+ KSDIWA GCVLYE+ S K+ FE +N  +L +KI++G F  + +  + +L  L+  +L  +P+KRP   +++ H     P+       GN +   I++     QA  + RP    +  R    + SL S           V+ WG G    L++     +   +QV+ G +  + +T    L TW   S   G+  L G +      + I + ++   GV IK VSCG+  T CL+  G +   GS   G LG  N N+       E +   + +        Q+SCG  H  A+   E  +F+WG G+ GRLGL  +D+   P  V +P    + + V CG D + I+     ++L CGNN++NKLG++     +SG+ + +    V     F++V  A L   K+  +  G +H+  +    + + FG N +GQ+G  H ++ +   + S +   + I   +CGD FT+      E++ WG+   GRLG
Sbjct:    4 YEKTKVVGRGAFGIVHLCRRRTDSALVILKEIPVEQMTRDERLAAQNECQVLKLLSHPNIIEYYENFLEDKALMIAMEYAPGGTLADYIQKRCNSLLDEDTILHSFVQILLALYHVHNKLILHRDLKTQNILLDKHQMIVKIGDFGISKILVSKSKAYTVVGTPCYISPELCEGKPYNQKSDIWALGCVLYELASLKRAFEAANLPALVLKIMSGTFAPISDRYSPELRQLILNMLNLDPSKRPQLNEIMAHAICIRPLLNLYTDIGNVKMRRIEKPLSNVQAGPHGRPGGWITSTRTRGGLSSLTSSKMMHPLPLFSVYTWGSGISTPLRLPMLNTE--VIQVSLGRTQKMGVTKSGRLITWEAPSVGSGEPTLPGAVEQMQPQF-ISRFLEGQSGVTIKSVSCGDLFTTCLTDRGIIMTFGSGSNGCLGHGNFNDVTQPKIVEALLGYELV--------QVSCGASHVLAVTN-EREVFSWGRGDNGRLGLATQDSHNCPQQVSLPA-DFEAQRVLCGVDCSMIM-STQHQILACGNNRFNKLGLD----KVSGTEEPSSFCQVEEVHLFQLVQSAPLNTEKIVYIDIGTAHSVAVTEKGQCFTFGSNQHGQLGCSHRRSSRVPYQVSGL---QGITMAACGDAFTLAIGAEGEVYTWGKGARGRLG 651          

HSP 2 Score: 57.3806 bits (137), Expect = 5.044e-7
Identity = 34/98 (34.69%), Postives = 48/98 (48.98%), Query Frame = 1
Query: 1777 VKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFA--GKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLGLEITVDQRC 2064
            V + +VSCG+  T  L     +  FG  S G +G G+     DV +   V A  G ++ ++SCG    +  T   E+F WGR D+GRLGL       C
Sbjct:  398 VTIKSVSCGDLFTTCLTDRGIIMTFGSGSNGCLGHGN---FNDVTQPKIVEALLGYELVQVSCGASHVLAVTNEREVFSWGRGDNGRLGLATQDSHNC 492          
BLAST of NEK8-1 vs. TrEMBL
Match: A0A0H3YFE5 (NEK8-1 OS=Schmidtea mediterranea OX=79327 GN=NEK8-1 PE=2 SV=1)

HSP 1 Score: 1603.19 bits (4150), Expect = 0.000e+0
Identity = 803/803 (100.00%), Postives = 803/803 (100.00%), Query Frame = 1
Query:   67 MDNCRDNEVLSNRDFSTNLNVVSYVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNKINEIQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLNEDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWKGNCQSMIDQVHRTNQANSNSRPCSGDRKERSIVSLNSEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTWSNIQGDKKLSGQLGHGAIVYKIPKLVQSLKGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGINSNETEMINQFEKITVTDPIDKSPVIINQISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSGSSQKNLCYDVPFETKFKIVAVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFAGKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLGLEITVDQRCVLHPRALFGTLQKCADIQSFGWQTIMITERILETSTISANSTAIMDKLSLKNVNSFETEYDKDGSGDIQTWLRKELQEDVIYMDQVSVNLHXXXXXXXXXXXXXELYSCECGCQKCQNYIKFLENRIRLLCDKNILQ 2475
            MDNCRDNEVLSNRDFSTNLNVVSYVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNKINEIQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLNEDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSDLLDLLQRLLLNEPTKRPSAEDVLKHPVWKGNCQSMIDQVHRTNQANSNSRPCSGDRKERSIVSLNSEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTWSNIQGDKKLSGQLGHGAIVYKIPKLVQSLKGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGINSNETEMINQFEKITVTDPIDKSPVIINQISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSGSSQKNLCYDVPFETKFKIVAVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFAGKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLGLEITVDQRCVLHPRALFGTLQKCADIQSFGWQTIMITERILETSTISANSTAIMDKLSLKNVNSFETEYDKDGSGDIQTWLRKELQEDVIYMDQVSVNLHSINVNSYSSNNSNELYSCECGCQKCQNYIKFLENRIRLLCDKNILQ
Sbjct:    1 MDNCRDNEVLSNRDFSTNLNVVSYVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNKINEIQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLNEDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSDLLDLLQRLLLNEPTKRPSAEDVLKHPVWKGNCQSMIDQVHRTNQANSNSRPCSGDRKERSIVSLNSEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTWSNIQGDKKLSGQLGHGAIVYKIPKLVQSLKGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGINSNETEMINQFEKITVTDPIDKSPVIINQISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSGSSQKNLCYDVPFETKFKIVAVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFAGKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLGLEITVDQRCVLHPRALFGTLQKCADIQSFGWQTIMITERILETSTISANSTAIMDKLSLKNVNSFETEYDKDGSGDIQTWLRKELQEDVIYMDQVSVNLHSINVNSYSSNNSNELYSCECGCQKCQNYIKFLENRIRLLCDKNILQ 803          
BLAST of NEK8-1 vs. TrEMBL
Match: A0A1I8HFL4 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 577.4 bits (1487), Expect = 0.000e+0
Identity = 303/704 (43.04%), Postives = 432/704 (61.36%), Query Frame = 1
Query:  133 SYVQVRVLGKGAYGKAVLYRNAVDNS--LVVWKEIDI---DKNKINEIQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLNEDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGE--FQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWKGNCQSMIDQVHRTNQANSNSRPCSGDRKERSIV-SLNSEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTWSNIQGDKKLSGQLGHGAIV-YKIPKLVQSLKGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGINSNETEMINQFEKITVTDPIDKSPVIIN----QISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSGSSQKNLCYDVPFETKFKIVAVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFAGKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLGLEI----------TVDQRCVLHPRALFGTLQKCADIQSFGWQTIMITERILETSTI 2175
            SY+ +  LGKGA+G+A LYR   +N   LVVWK I++   D+ +  E QNEID+L +LDHPNIVAYYNHF   + + IEMEYAN GSL  ++ Q    L E  ++WYFFQ+  A+ +IH+  I+HRDIKTLNIFLT + L+K+GDFGI+KVL  DE A T  GTP YMSPE++QG  Y+ KSDIWA GCVL+E+++ K+ F+ +N L LA  I++ E     +    +  L  LL   L  EP  RPSA ++L + ++  + + M  +V    Q +  +RP S       +V S  +EVF WGGGK   +KIEQF+ ++SALQVA G  H  V+T E++++TW N+QG  KL GQLGHG +  Y+ PK V+ L GV I+E  CG+E T+  +  G+++ CGSNY+G LG+   + E     +     +P+   P  +N    +++CG  H  A+   +  +F WGCGE+GRLGL  EDN   P  V +P+ +  +    CG D +F++     R+L CG+N++NKLG N  A+GL+ ++     +D P    FK+V  L   +V  +SCG SHTA +D  N+L +FG N  G++GLG  +    V    +   GK+  +++CGD FT+  TT+N I+ WGRAD+GRLG+E+           +   CV  PR +FG+L   ADI S  W ++MI ER+LE  T+
Sbjct:  285 SYIPINCLGKGAFGEAWLYRKTEENEEQLVVWKMINLTGLDERRRREAQNEIDVLHMLDHPNIVAYYNHFFDGNILLIEMEYANGGSLYQFIGQCNSLLKEETIIWYFFQMTMAIRHIHEASILHRDIKTLNIFLTKAGLIKLGDFGIAKVLGSDEMAETCQGTPYYMSPELVQGKRYNYKSDIWALGCVLFELLTLKRAFDATNQLKLAQNIVHTEISLSLVDESYSVQLKALLGATLSKEPEARPSASEILINKLFS-DGERMQSRVRELQQQSRLARPSSAGTDTTPVVTSKTTEVFYWGGGKQTPIKIEQFERQNSALQVATGSHHMAVVTIEREVFTWCNVQGCAKLCGQLGHGDLASYRTPKKVEKLNGVPIEEARCGDEFTVLRTVEGQLYACGSNYHGCLGVPREQLEE-ETGDSDQALEPV-PVPFFLNLEVKRVACGDAHVLAVTR-QSEVFAWGCGEFGRLGLNGEDNYDTPQPVSLPVKRQLIVGACCGSDGSFLLTD-GGRVLACGSNEHNKLGFNSVAKGLT-AANSTCSFDTPCVHTFKVVKPLTKYRVRQLSCGRSHTAAIDDCNQLLMFGSNRMGELGLGEMRHRNGVFNIGRACGGKRFLRVACGDGFTVACTTDNHIYSWGRADNGRLGIELQAASLLNMNKALASACVSTPRPMFGSLHLVADISSRHWHSLMIAERVLEQRTV 982          
BLAST of NEK8-1 vs. TrEMBL
Match: A0A267F6Z2 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022512g2 PE=4 SV=1)

HSP 1 Score: 576.63 bits (1485), Expect = 0.000e+0
Identity = 303/704 (43.04%), Postives = 432/704 (61.36%), Query Frame = 1
Query:  133 SYVQVRVLGKGAYGKAVLYRNAVDNS--LVVWKEIDI---DKNKINEIQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLNEDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGE--FQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWKGNCQSMIDQVHRTNQANSNSRPCSGDRKERSIV-SLNSEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTWSNIQGDKKLSGQLGHGAIV-YKIPKLVQSLKGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGINSNETEMINQFEKITVTDPIDKSPVIIN----QISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSGSSQKNLCYDVPFETKFKIVAVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFAGKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLGLEI----------TVDQRCVLHPRALFGTLQKCADIQSFGWQTIMITERILETSTI 2175
            SY+ +  LGKGA+G+A LYR   +N   LVVWK I++   D+ +  E QNEID+L +LDHPNIVAYYNHF   + + IEMEYAN GSL  ++ Q    L E  ++WYFFQ+  A+ +IH+  I+HRDIKTLNIFLT + L+K+GDFGI+KVL  DE A T  GTP YMSPE++QG  Y+ KSDIWA GCVL+E+++ K+ F+ +N L LA  I++ E     +    +  L  LL   L  EP  RPSA ++L + ++  + + M  +V    Q +  +RP S       +V S  +EVF WGGGK   +KIEQF+ ++SALQVA G  H  V+T E++++TW N+QG  KL GQLGHG +  Y+ PK V+ L GV I+E  CG+E T+  +  G+++ CGSNY+G LG+   + E     +     +P+   P  +N    +++CG  H  A+   +  +F WGCGE+GRLGL  EDN   P  V +P+ +  +    CG D +F++     R+L CG+N++NKLG N  A+GL+ ++     +D P    FK+V  L   +V  +SCG SHTA +D  N+L +FG N  G++GLG  +    V    +   GK+  +++CGD FT+  TT+N I+ WGRAD+GRLG+E+           +   CV  PR +FG+L   ADI S  W ++MI ER+LE  T+
Sbjct:   28 SYIPINCLGKGAFGEAWLYRKTEENEEQLVVWKMINLTGLDERRRREAQNEIDVLHMLDHPNIVAYYNHFFDGNILLIEMEYANGGSLYQFIGQCNSLLKEETIIWYFFQMTMAIRHIHEASILHRDIKTLNIFLTKAGLIKLGDFGIAKVLGSDEMAETCQGTPYYMSPELVQGKRYNYKSDIWALGCVLFELLTLKRAFDATNQLKLAQNIVHTEISLSLVDESYSVQLKALLGATLSKEPEARPSASEILINKLFS-DGERMQSRVRELQQQSRLARPSSAGTDTTPVVTSKTTEVFYWGGGKQTPIKIEQFERQNSALQVATGSHHMAVVTIEREVFTWCNVQGCAKLCGQLGHGDLASYRTPKKVEKLNGVPIEEARCGDEFTVLRTVEGQLYACGSNYHGYLGVPREQLEE-ETGDSDQALEPV-PVPFFLNLEVKRVACGDAHVLAVTR-QSEVFAWGCGEFGRLGLNGEDNYDTPQPVSLPVKRQLIVGACCGSDGSFLLTD-GGRVLACGSNEHNKLGFNSVAKGLT-AANSTCSFDTPCVHTFKVVKPLTKYRVRQLSCGRSHTAAIDDCNQLLMFGSNRMGELGLGEMRHRNGVFNIGRACGGKRFLRVACGDGFTVACTTDNHIYSWGRADNGRLGIELQAASLLNMNKALASACVSTPRPMFGSLHLVADISSRHWHSLMIAERVLEQRTV 725          
BLAST of NEK8-1 vs. TrEMBL
Match: A0A267EN97 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022512g3 PE=4 SV=1)

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 303/704 (43.04%), Postives = 431/704 (61.22%), Query Frame = 1
Query:  133 SYVQVRVLGKGAYGKAVLYRNAVDNS--LVVWKEIDI---DKNKINEIQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLNEDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGE--FQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWKGNCQSMIDQVHRTNQANSNSRPCSGDRKERSIV-SLNSEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTWSNIQGDKKLSGQLGHGAIV-YKIPKLVQSLKGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGINSNETEMINQFEKITVTDPIDKSPVIIN----QISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSGSSQKNLCYDVPFETKFKIVAVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFAGKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLGLEITV----------DQRCVLHPRALFGTLQKCADIQSFGWQTIMITERILETSTI 2175
            SY+ +  LGKGA+G+A LYR   +N   LVVWK I++   D+ +  E QNEID+L +LDHPNIVAYYNHF   + + IEMEYAN GSL  ++ Q    L E  ++WYFFQ+  A+ +IH+  I+HRDIKTLNIFLT + L+K+GDFGI+KVL  DE A T  GTP YMSPE++QG  Y+ KSDIWA GCVL+E+++ K+ F+ +N L LA  I++ E     +    +  L  LL   L  EP  RPSA ++L + ++  + + M  +V    Q +  +RP S       +V S  +EVF WGGGK   +KIEQF+ ++SALQVA G  H  V+T E++++TW N+QG  KL GQLGHG +  Y+ PK V+ L GV I+E  CG+E T+  +  G+++ CGSNY+G LG+   + E     +     +P+   P  +N    +++CG  H  A+   +  +F WGCGE+GRLGL  EDN   P  V +P+ +  +    CG D +F++     R+L CG+N++NKLG N  A+GL+ ++     +D P    FK+V  L   +V  +SCG SHTA +D  N+L +FG N  G++GLG  +    V    +   GK+  +++CGD FT+  TT+N I+ WGRAD+GRLG+E+               CV  PR +FG+L   ADI S  W ++MI ER+LE  T+
Sbjct:   28 SYIPINCLGKGAFGEAWLYRKTEENEEQLVVWKMINLTGLDERRRREAQNEIDVLHMLDHPNIVAYYNHFFDGNILLIEMEYANGGSLYQFIGQCNSLLKEETIIWYFFQMTMAIRHIHEASILHRDIKTLNIFLTKAGLIKLGDFGIAKVLGSDEMAETCQGTPYYMSPELVQGKRYNYKSDIWALGCVLFELLTLKRAFDATNQLKLAQNIVHTEISLSLVDESYSVQLKALLGATLSKEPEARPSASEILINKLFS-DGERMQSRVRELQQQSRLARPSSAGTDTTPVVTSKTTEVFYWGGGKQTPIKIEQFERQNSALQVATGSHHMAVVTIEREVFTWCNVQGCAKLCGQLGHGDLASYRTPKKVEKLNGVPIEEARCGDEFTVLRTVEGQLYACGSNYHGCLGVPREQLEE-ETGDSDQALEPV-PVPFFLNLEVKRVACGDAHVLAVTR-QSEVFAWGCGEFGRLGLNGEDNYDTPQPVSLPVKRQLIVGACCGSDGSFLLTD-GGRVLACGSNEHNKLGFNSVAKGLT-AANSTCSFDTPCVHTFKVVKPLTKYRVRQLSCGRSHTAAIDDCNQLLMFGSNRMGELGLGEMRHRNGVFNIGRACGGKRFLRVACGDGFTVACTTDNHIYSWGRADNGRLGIELQAASLLNMNKASASACVSTPRPMFGSLHLVADISSRHWHSLMIAERVLEQRTV 725          
BLAST of NEK8-1 vs. TrEMBL
Match: A0A1I8HNF1 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022512g1 PE=4 SV=1)

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 303/704 (43.04%), Postives = 431/704 (61.22%), Query Frame = 1
Query:  133 SYVQVRVLGKGAYGKAVLYRNAVDNS--LVVWKEIDI---DKNKINEIQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLNEDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGE--FQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWKGNCQSMIDQVHRTNQANSNSRPCSGDRKERSIV-SLNSEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTWSNIQGDKKLSGQLGHGAIV-YKIPKLVQSLKGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGINSNETEMINQFEKITVTDPIDKSPVIIN----QISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSGSSQKNLCYDVPFETKFKIVAVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFAGKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLGLEITV----------DQRCVLHPRALFGTLQKCADIQSFGWQTIMITERILETSTI 2175
            SY+ +  LGKGA+G+A LYR   +N   LVVWK I++   D+ +  E QNEID+L +LDHPNIVAYYNHF   + + IEMEYAN GSL  ++ Q    L E  ++WYFFQ+  A+ +IH+  I+HRDIKTLNIFLT + L+K+GDFGI+KVL  DE A T  GTP YMSPE++QG  Y+ KSDIWA GCVL+E+++ K+ F+ +N L LA  I++ E     +    +  L  LL   L  EP  RPSA ++L + ++  + + M  +V    Q +  +RP S       +V S  +EVF WGGGK   +KIEQF+ ++SALQVA G  H  V+T E++++TW N+QG  KL GQLGHG +  Y+ PK V+ L GV I+E  CG+E T+  +  G+++ CGSNY+G LG+   + E     +     +P+   P  +N    +++CG  H  A+   +  +F WGCGE+GRLGL  EDN   P  V +P+ +  +    CG D +F++     R+L CG+N++NKLG N  A+GL+ ++     +D P    FK+V  L   +V  +SCG SHTA +D  N+L +FG N  G++GLG  +    V    +   GK+  +++CGD FT+  TT+N I+ WGRAD+GRLG+E+               CV  PR +FG+L   ADI S  W ++MI ER+LE  T+
Sbjct:   28 SYIPINCLGKGAFGEAWLYRKTEENEEQLVVWKMINLTGLDERRRREAQNEIDVLHMLDHPNIVAYYNHFFDGNILLIEMEYANGGSLYQFIGQCNSLLKEETIIWYFFQMTMAIRHIHEASILHRDIKTLNIFLTKAGLIKLGDFGIAKVLGSDEMAETCQGTPYYMSPELVQGKRYNYKSDIWALGCVLFELLTLKRAFDATNQLKLAQNIVHTEISLSLVDESYSVQLKALLGATLSKEPEARPSASEILINKLFS-DGERMQSRVRELQQQSRLARPSSAGTDTTPVVTSKTTEVFYWGGGKQTPIKIEQFERQNSALQVATGSHHMAVVTIEREVFTWCNVQGCAKLCGQLGHGDLASYRTPKKVEKLNGVPIEEARCGDEFTVLRTVEGQLYACGSNYHGCLGVPREQLEE-ETGDSDQALEPV-PVPFFLNLEVKRVACGDAHVLAVTR-QSEVFAWGCGEFGRLGLNGEDNYDTPQPVSLPVKRQLIVGACCGSDGSFLLTD-GGRVLACGSNEHNKLGFNSVAKGLT-AANSTCSFDTPCVHTFKVVKPLTKYRVRQLSCGRSHTAAIDDCNQLLMFGSNRMGELGLGEMRHRNGVFNIGRACGGKRFLRVACGDGFTVACTTDNHIYSWGRADNGRLGIELQAASLLNMNKASASACVSTPRPMFGSLHLVADISSRHWHSLMIAERVLEQRTV 725          
BLAST of NEK8-1 vs. Ensembl Cavefish
Match: NEK9 (NIMA related kinase 9 [Source:NCBI gene;Acc:103037873])

HSP 1 Score: 547.354 bits (1409), Expect = 0.000e+0
Identity = 292/701 (41.65%), Postives = 439/701 (62.62%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDK---NKINEIQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKEDL-SESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLN-EDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCN--NSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWKGNCQSMIDQVHRTNQANSNSRPCSGDRKERSIVSLNS-EVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTWSNIQGDKKLSGQLGHG-AIVYKIPKLVQSLKGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGINSNETEMINQFEKITVTDPIDKSPVIINQISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSGSSQ--KNLCYDVPFETKFKIVAVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFAGKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLGLEITV---DQRCVLHPRALFGTLQKCADIQSFGWQTIMITERILETSTISANSTAI 2196
            Y+ +RVLGKGA+G+A LYR   DNSLVVWKEID++     K  ++ NEI ILSIL H NI+AY+NHF+  +T+ IE+EY N G+L + + Q K  L +E  V+WY +Q+  A+ +IHK  ++HRDIKTLNIFLT + L+K+GD+G++K L+ E   A T VGTP YMSPE+ QG+ Y+ KSDIWA GCVLYE+++  + F+ +N L+L +KI+ G +    N +  +S+L+ ++   L  +P KRP+++ +L  P+     Q + D+V   N A    +  +      +IV+  S EV+ WGGGK    K++ F+  +SA QV +G +HF V+T EK+LYTW+++QG  K+ GQLGHG    Y+ P+ V+ L+G  I++V+CG + T C++   +M+  GS+YYG +G+   E EM  +  +  + +  ++ PV   Q+SCG +H   +    D+ ++WGCGE+GRLGL  ED+   P LV++P     +  VYCG D TF + + S ++L CGNN  NKLG+N   QG++G     +    ++P+ T   +V  L   K+  ++ G +HTA +D   +L  FG N YGQ+G+   K H+ V      F GK + K+SCGD FTI +T +N+IF WG A +GRLG+        + C   PR +FG+L    D+   GW TI+I E++L + TI +NS+ +
Sbjct:   39 YIPIRVLGKGAFGEATLYRRTEDNSLVVWKEIDLNNLSDKKRRDVMNEISILSILQHHNIIAYFNHFMDKNTLLIELEYCNGGNLYDKIIQQKGKLFTEEIVIWYLYQIASAVAHIHKAGVLHRDIKTLNIFLTKTNLIKLGDYGLAKKLDSEYSMAETCVGTPYYMSPELCQGVKYNFKSDIWAMGCVLYELLTLTRTFDATNPLNLCVKIVQGNWTMEVNSDVYSSELIKIVYACLDQDPEKRPTSDQILDQPIISRVRQELEDRVAVLNSAIRKPKLSTVSETPVAIVTTRSREVYFWGGGKFTPQKLDMFKGGNSAQQVCSGETHFAVVTVEKELYTWASVQGGAKMVGQLGHGDQASYRQPRKVERLQGKAIRQVACGADFTACVTDEDQMYMFGSDYYGCIGV---ENEMGMEVLEPVLLEFFEERPV--RQVSCGDNHVVVLTHSGDI-YSWGCGEHGRLGLDCEDDFASPMLVEVP-KGASIDSVYCGSDGTFFLTE-SGKVLACGNNDLNKLGLN---QGITGIKNHFREGSQEIPYTTTLTLVKQLARFKIQIIAPGKTHTAAIDERGRLMTFGCNKYGQLGVKDFKRHQGVQILLGPFGGKVVSKVSCGDGFTIAATEDNQIFAWGNAGNGRLGMPADRGFGSEVCPALPRPIFGSLHHVPDLSCRGWHTILIMEKVLNSKTIRSNSSGL 728          
BLAST of NEK8-1 vs. Ensembl Cavefish
Match: nek8 (NIMA related kinase 8 [Source:NCBI gene;Acc:103024333])

HSP 1 Score: 330.872 bits (847), Expect = 6.546e-102
Identity = 216/646 (33.44%), Postives = 346/646 (53.56%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNKINE---IQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYL-RQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLL-KIGDFGISKVLNEDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWKGNCQSMIDQVHRTNQANSNSRPCSGDRKERSIVSLN-SEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTW---SNIQGDKKLSGQLGHGAIVYKIPKLVQSLKGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGI-NSNETEMINQFEKITVTDPIDKSPVIINQISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSGSSQKNLCYDVPFETKFKIV--AVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFAGKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLG 2037
            Y +++V+G+GA+G   L R  VD +LV+ KEI +++   +E    QNE  +L +L+HPNI+ YY +F+    + I MEYA  G+L++Y+ ++    L E  +L +F Q++ AL ++H   I+HRD+KT NI L    ++ KIGDFGISK+L     A T VGTP Y+SPE+ +G PY+ KSDIWA GCVLYE+ S K+ FE +N  +L +KI++G F  + +  + +L  L+  +L  +P+KRP   +++  P+    C   +  ++ T+  N   R  S     + + SL  S V+ WG G    L++     +   LQV+ G +  + +T    L TW   S   G+  L G +      + I + ++   GV IK VSCG+  T C++  G +   GS   G LG  N N+       E +   + +        Q+SCG  H  A+   E  +F+WG G+ GRLGLG +D    P  VD+P  + + + V CG D + I+     ++L CG+N++NKLG++     ++ + +   C  V     F+ V  A L   K+  +  G +H+A +    + + FG N +GQ+G    ++ +       V   + +   +CGD FT+   T  E++ WG+   GRLG
Sbjct:    4 YEKIKVVGRGAFGIVHLCRRRVDGALVILKEIPVEQMTRDERLAAQNECQVLKLLNHPNIIEYYENFLEDKALMIAMEYAPGGTLADYIQKRCNSLLDEDTILHFFVQILLALYHVHNKLILHRDLKTQNILLDKHQMIVKIGDFGISKILVSKSKAYTVVGTPCYISPELCEGKPYNQKSDIWALGCVLYELASLKRAFEAANLPALVLKIMSGTFAPISDRYSPELRQLILTMLNLDPSKRPQLNEIMALPI----CIRPLLNLY-TDIGNVKMRGLSSLSSTKMMHSLPLSSVYTWGSGISTPLRLPMLNTE--VLQVSLGRTQKMGVTKSGRLITWEAPSVGSGEPSLPGAVEQMQPQF-ISRFLEGQSGVTIKSVSCGDLFTTCMTDRGIIMTFGSGSNGCLGHGNFNDVTQPKIVEALLGYELV--------QVSCGASHVLAVTN-EREVFSWGRGDNGRLGLGTQDTHNAPQQVDVP-AEFEAQRVLCGVDCSMII-STQHQILACGSNRFNKLGLD----KIADTEEPPSCCQVEEVQTFQPVQSAPLNVEKIVYIDIGTAHSAAVTEKGQCFTFGSNQHGQLGCSSRRSSR---VPYPVPGLQGVTTAACGDAFTLAIGTEGEVYTWGKGARGRLG 623          

HSP 2 Score: 56.225 bits (134), Expect = 1.383e-7
Identity = 32/90 (35.56%), Postives = 47/90 (52.22%), Query Frame = 1
Query: 1777 VKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFA--GKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLGL 2040
            V + +VSCG+  T  +     +  FG  S G +G G+     DV +   V A  G ++ ++SCG    +  T   E+F WGR D+GRLGL
Sbjct:  370 VTIKSVSCGDLFTTCMTDRGIIMTFGSGSNGCLGHGN---FNDVTQPKIVEALLGYELVQVSCGASHVLAVTNEREVFSWGRGDNGRLGL 456          
BLAST of NEK8-1 vs. Ensembl Cavefish
Match: nek8 (NIMA related kinase 8 [Source:NCBI gene;Acc:103024333])

HSP 1 Score: 326.25 bits (835), Expect = 6.996e-100
Identity = 218/669 (32.59%), Postives = 350/669 (52.32%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNKINE---IQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYL-RQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLL-KIGDFGISKVLNEDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVW----------KGNCQ-SMIDQVHRTNQANSNSRP---CSGDRKERSIVSLN----------SEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTW---SNIQGDKKLSGQLGHGAIVYKIPKLVQSLKGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGI-NSNETEMINQFEKITVTDPIDKSPVIINQISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSGSSQKNLCYDVPFETKFKIV--AVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFAGKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLG 2037
            Y +++V+G+GA+G   L R  VD +LV+ KEI +++   +E    QNE  +L +L+HPNI+ YY +F+    + I MEYA  G+L++Y+ ++    L E  +L +F Q++ AL ++H   I+HRD+KT NI L    ++ KIGDFGISK+L     A T VGTP Y+SPE+ +G PY+ KSDIWA GCVLYE+ S K+ FE +N  +L +KI++G F  + +  + +L  L+  +L  +P+KRP   +++  P+            GN +   I++   + Q   + R     +G R    + SL+          S V+ WG G    L++     +   LQV+ G +  + +T    L TW   S   G+  L G +      + I + ++   GV IK VSCG+  T C++  G +   GS   G LG  N N+       E +   +        + Q+SCG  H  A+   E  +F+WG G+ GRLGLG +D    P  VD+P  + + + V CG D + I+     ++L CG+N++NKLG++     ++ + +   C  V     F+ V  A L   K+  +  G +H+A +    + + FG N +GQ+G    ++ +       V   + +   +CGD FT+   T  E++ WG+   GRLG
Sbjct:    4 YEKIKVVGRGAFGIVHLCRRRVDGALVILKEIPVEQMTRDERLAAQNECQVLKLLNHPNIIEYYENFLEDKALMIAMEYAPGGTLADYIQKRCNSLLDEDTILHFFVQILLALYHVHNKLILHRDLKTQNILLDKHQMIVKIGDFGISKILVSKSKAYTVVGTPCYISPELCEGKPYNQKSDIWALGCVLYELASLKRAFEAANLPALVLKIMSGTFAPISDRYSPELRQLILTMLNLDPSKRPQLNEIMALPICIRPLLNLYTDIGNVKMRRIEKQLSSVQTGPHGRAGGRVTGTRTRGGLSSLSSTKMMHSLPLSSVYTWGSGISTPLRLPMLNTE--VLQVSLGRTQKMGVTKSGRLITWEAPSVGSGEPSLPGAVEQMQPQF-ISRFLEGQSGVTIKSVSCGDLFTTCMTDRGIIMTFGSGSNGCLGHGNFNDVTQPKIVEALLGYE--------LVQVSCGASHVLAVTN-EREVFSWGRGDNGRLGLGTQDTHNAPQQVDVP-AEFEAQRVLCGVDCSMII-STQHQILACGSNRFNKLGLD----KIADTEEPPSCCQVEEVQTFQPVQSAPLNVEKIVYIDIGTAHSAAVTEKGQCFTFGSNQHGQLGCSSRRSSR---VPYPVPGLQGVTTAACGDAFTLAIGTEGEVYTWGKGARGRLG 651          

HSP 2 Score: 55.8398 bits (133), Expect = 1.542e-7
Identity = 32/90 (35.56%), Postives = 47/90 (52.22%), Query Frame = 1
Query: 1777 VKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFA--GKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLGL 2040
            V + +VSCG+  T  +     +  FG  S G +G G+     DV +   V A  G ++ ++SCG    +  T   E+F WGR D+GRLGL
Sbjct:  398 VTIKSVSCGDLFTTCMTDRGIIMTFGSGSNGCLGHGN---FNDVTQPKIVEALLGYELVQVSCGASHVLAVTNEREVFSWGRGDNGRLGL 484          
BLAST of NEK8-1 vs. Ensembl Cavefish
Match: nek12 (serine/threonine-protein kinase Nek4-like [Source:NCBI gene;Acc:103035324])

HSP 1 Score: 182.185 bits (461), Expect = 2.217e-49
Identity = 112/286 (39.16%), Postives = 166/286 (58.04%), Query Frame = 1
Query:  133 SYVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDID---KNKINE-IQNEIDILSILDHPNIVAYYNHFVYIDT----VFIEMEYANAGSLSNYLRQLKED--LSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLNED-EFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWKGNCQSMID-QVHRTNQANSNSRP 954
            +Y Q+  LG G  G  +L R+   N L   K I +D   K K  E +  E +IL  L HP+IV +   + + DT    ++I M+Y + G+L + ++  K D   SE   + +F Q++ A+ YIH   I+HRDIKT NI LT   ++K+GDFGISK+++   + A+T VGTP Y+SPE+ Q +PYS+KSDIWA GC+LYE+ + K  F   N L+L  KI+ GE+   P+  + DL  L++++L   P  RPSA  +L  P  + +    I+ Q     + N  SRP
Sbjct:    3 TYEQILTLGSGGAGVVLLMRHKETNKLYAVKRIQVDNSRKTKTKEAVLQEAEILRNLKHPHIVTW--SYTFYDTANELIYIAMDYCDGGTLDDQIKGRKPDEYFSEHVTMKWFVQVLMAVSYIHSKKILHRDIKTSNILLTKRGMIKLGDFGISKIMSHTLDMASTCVGTPCYLSPELCQDIPYSTKSDIWALGCLLYELCTLKPAFWARNLLNLFYKILKGEYSPAPDQYSKDLHSLIEKMLCLVPENRPSASSILGMPYVQEHLSQFIEHQETELTKVNVESRP 286          
BLAST of NEK8-1 vs. Ensembl Cavefish
Match: nek12 (serine/threonine-protein kinase Nek4-like [Source:NCBI gene;Acc:103035324])

HSP 1 Score: 182.185 bits (461), Expect = 5.249e-49
Identity = 112/286 (39.16%), Postives = 166/286 (58.04%), Query Frame = 1
Query:  133 SYVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDID---KNKINE-IQNEIDILSILDHPNIVAYYNHFVYIDT----VFIEMEYANAGSLSNYLRQLKED--LSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLNED-EFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWKGNCQSMID-QVHRTNQANSNSRP 954
            +Y Q+  LG G  G  +L R+   N L   K I +D   K K  E +  E +IL  L HP+IV +   + + DT    ++I M+Y + G+L + ++  K D   SE   + +F Q++ A+ YIH   I+HRDIKT NI LT   ++K+GDFGISK+++   + A+T VGTP Y+SPE+ Q +PYS+KSDIWA GC+LYE+ + K  F   N L+L  KI+ GE+   P+  + DL  L++++L   P  RPSA  +L  P  + +    I+ Q     + N  SRP
Sbjct:    3 TYEQILTLGSGGAGVVLLMRHKETNKLYAVKRIQVDNSRKTKTKEAVLQEAEILRNLKHPHIVTW--SYTFYDTANELIYIAMDYCDGGTLDDQIKGRKPDEYFSEHVTMKWFVQVLMAVSYIHSKKILHRDIKTSNILLTKRGMIKLGDFGISKIMSHTLDMASTCVGTPCYLSPELCQDIPYSTKSDIWALGCLLYELCTLKPAFWARNLLNLFYKILKGEYSPAPDQYSKDLHSLIEKMLCLVPENRPSASSILGMPYVQEHLSQFIEHQETELTKVNVESRP 286          
BLAST of NEK8-1 vs. Ensembl Sea Lamprey
Match: NEK9 (NIMA related kinase 9 [Source:HGNC Symbol;Acc:HGNC:18591])

HSP 1 Score: 513.072 bits (1320), Expect = 5.800e-171
Identity = 302/768 (39.32%), Postives = 451/768 (58.72%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDI----DKNKINEIQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSL-SNYLRQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLN-EDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQT-MPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWKGNCQSMIDQVHRTNQANSNSRPCSGDRKER--SIVSLNSEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTWSNIQGDKKLSGQLGH-GAIVYKIPKLVQSLKGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGINSNETEMINQFEKITVTDPIDKSPVIIN---QISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSGSSQKNLCYDVPFETKFKIVAVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFAGKKIEKISCGDYFTIVST-TNNEIFGWGRADSGRLGL---EITVDQRCVLHPRALFGTLQKCADIQSFGWQTIMITERILETSTI-SANSTAIMDKLSLKNVNSF-----------ETEYDKDGS------------------GDIQTWLRKELQE 2298
            Y+ VRVLG+GA+G+A LYR   DNSLVVWKEID+    DK +  + QNEIDILS+L+H NI++YYNHF+  + + IE+EY N G+L    ++Q      E  ++WYF+QL+ A++ IH   I+HRDIKTLNIFLT S L+K+GDFGISK+L+   + A + VGTP YMSPE+I+G  Y++KSDIWA GCVLYE+++  + F+ +N L L  +II+G+ Q  + +  + ++ +++Q+ L  +  +RP+AED+L+    K   + M   V R N+    +R    D  E    + + +S+V+ WGGGK     ++QF+   SAL+V A  +HF  +T EK+LYTW+N+QG  K+ GQLGH     Y+ PK V  L G+ +++V+CG+E T+CL+  GE+F  GS+YYG +G N            + V +P+      IN   QISCG  H  A+      ++ WGCGEYGRLGL  +   + P  V +  ++ K+  V CG D TF +     ++L CGNN++NKLG+N    GL  + + ++ ++V  +    +V  L   K+ ++S G +H+AV+D+  +L  FG N +GQ+G G  K H  +        GK I  +SCGD FTI +T  +N I+ WG  D+GRLG+   E   +    L PR +FG+L   +D+   GW TI+I E++L + TI S  + +     +L N  +F           E+ YD+D +                       WLR+EL+E
Sbjct:   36 YIPVRVLGRGAFGEAALYRRNEDNSLVVWKEIDLTRLSDKER-RDSQNEIDILSLLEHANIISYYNHFLDGNVLLIELEYCNGGTLYEKIIKQHGAFFPEKDIVWYFYQLVSAVEQIHNFKILHRDIKTLNIFLTKSDLIKVGDFGISKILDSRSQMAESYVGTPYYMSPELIRGDKYNTKSDIWAMGCVLYELLTLTRTFDATNPLKLCYEIIHGKKQVEIDDQYSKEIKEVVQKCLQQDAEQRPTAEDLLELSPIKTRRREMEKNVWRLNEP---ARRIRSDNAEAVPVVTARSSDVYYWGGGKRTPQMLDQFRGGYSALRVCASNTHFAAVTVEKELYTWANVQGGTKMVGQLGHKDKASYRQPKRVDKLLGLAVRQVACGDEFTVCLTEQGEVFSFGSDYYGCMGCNGE--------LGVEVLEPMPVQFFNINPVTQISCGDCHVMALTR-SGAVYAWGCGEYGRLGLETDATEFYPKRVPLS-NRWKITEVCCGTDGTFFL-TAQGKVLACGNNEFNKLGLNQCTSGLR-NRETSVFHEVIMKLMPTLVKQLSIYKIRSISGGKTHSAVIDVCGRLLTFGHNKHGQLGTGDFKKHLGIVLHKGPLVGKLITMVSCGDGFTIAATEADNHIYAWGNTDNGRLGVMPSEKPGNSPLAL-PRPIFGSLHVVSDLSCRGWHTILIAEKVLTSKTIRSGGNFSARSSFTLSNNKTFFPRSSLGETEDESGYDEDSAKSQFDPPTYEESESSTAGSSCPEWLRRELEE 786          
BLAST of NEK8-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001750.1 (pep scaffold:Pmarinus_7.0:GL481695:1137:12922:1 gene:ENSPMAG00000001576.1 transcript:ENSPMAT00000001750.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 276.559 bits (706), Expect = 6.703e-83
Identity = 198/611 (32.41%), Postives = 295/611 (48.28%), Query Frame = 1
Query:  370 AGSLSNYLRQLKEDL-SESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFL-TTSTLLKIGDFGISKVLNEDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWKGNCQSMI-------------------DQVHRTNQANSNSRPCSGDRKERSIVSLN-------SEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTW---SNIQGDKKLSGQLGHGAIVYKIPKLVQSLKGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGINS-NETEMINQFEKITVTDPIDKSPVIINQISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHED--NIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNN-QYNKLGINIHAQGLSGSSQKNLCYDVPFETKFKIVAV----LRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFAGKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLGLEITVDQRCVLHPRAL 2085
             G+L+ Y+++    L  E  +L +F Q+  AL ++H  HI+HRD+KT NI L    T++KIGDFGISK+L+    A T VGTP Y+SPE+ +G PY+ KSDIWA GC+LYE+ S K+ FE  N  +L +KI++G F  + +  + +L  L+  LL  +P+KRP   +VL HPV    C S +                   + +  +  A+  + P SGD                 S V++WG G +  +K+         LQVA G +    +T    L  W       GD  L G +G       + + ++   GV I+ VSCG+  T CL+  G +   GS   G LG  S ++       E +   +        I Q+SCG  H  A+   E  +F WG G+ GRLGLG+++     +P  V  P   C     +CG D + +    S +LL CG+N +YNKLG++     +S       C     E    +  V    L   +V  V+ G +H+A +      Y FG N +GQ+G G  +T     +      G K+ +++CGD FT+      ++F WG+A  GRLG   T  + CV  P  L
Sbjct:    1 GGTLAEYIQKRGGSLLDEDTILHFFVQIALALHHVHSNHILHRDLKTHNILLDKRQTVVKIGDFGISKILSSKSKAYTVVGTPCYISPELCEGKPYNQKSDIWALGCILYELASLKRAFEAENLPALVLKIMSGNFAPVSDRYSGELRQLVVSLLNLDPSKRPQLSEVLSHPV----CMSAMIRLYMDIGRVPARFVSGEPELISPSVSASRPTAPVSGDGAPAGSAGRAGAAPPPLSSVYMWGSGTLAPVKLA--MPNTEVLQVAVGRTQRAGVTRSGRLIVWEASPGTVGDAALPGSVGS-VQPQLVSRFLEGQSGVTIQHVSCGDLFTACLTDRGILMTYGSGSSGCLGHGSYSDVAQPKIVEALLGYE--------ITQMSCGMSHVLAVSN-EQEVFAWGRGDNGRLGLGNQELHLCPQPVAVPPPYEPCT---AHCGIDCSMVTS--SGKLLACGSNRRYNKLGLD----KISHDGDDAACPAEQTEESLVLSPVQSSPLDGARVVHVALGTAHSAAVTDTGTCYTFGSNQHGQLG-GGARTSSRAPQPVDGLGGVKVVQVTCGDAFTVAVAEGGQVFTWGKAARGRLGR--TDGEACVPGPVQL 583          
BLAST of NEK8-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007414.1 (pep scaffold:Pmarinus_7.0:GL476981:230882:244405:1 gene:ENSPMAG00000006689.1 transcript:ENSPMAT00000007414.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 182.57 bits (462), Expect = 8.974e-52
Identity = 102/263 (38.78%), Postives = 155/263 (58.94%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDK---NKINEIQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKEDL-SESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLNED-EFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWKGNCQSMI 909
            Y  V  +G+G++GKA+L ++  D  L V KEI+I +    + +E + E+ +L+ + HPNIV+Y   F     ++I M+Y   G L   +   K  L SE  +L +  QL  AL ++H   I+HRDIK+ NIFLT + ++++GDFGI++VLN   E A T +GTP Y+SPE+ +  PY+ KSD+WA GCVLYE+ + +  FE  N  +L +KII G F  +    +S+L   L  LL  +P  RP    +L  P+     Q ++
Sbjct:    4 YTMVSQIGEGSFGKAMLVKSKADGHLYVIKEINISRMSPKERDEARKEVCVLANMRHPNIVSYKESFEERGNLYIVMDYCEGGDLFKRINAQKGVLFSEDQILDWLVQLCLALKHVHDRKILHRDIKSQNIFLTKAGIVQLGDFGIARVLNSTTELARTCIGTPYYLSPEICENKPYNHKSDMWALGCVLYEMCTLRHAFEAGNMKNLVLKIIRGSFPPVSAHYSSELRSTLSGLLRRDPRARPPVAVLLSRPLLMARAQRLM 266          
BLAST of NEK8-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000555.1 (pep scaffold:Pmarinus_7.0:GL477093:35206:42652:1 gene:ENSPMAG00000000500.1 transcript:ENSPMAT00000000555.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 134.806 bits (338), Expect = 1.093e-36
Identity = 75/165 (45.45%), Postives = 104/165 (63.03%), Query Frame = 1
Query:  403 KEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLNED-EFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSN-----HLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHP 879
            K+ ++++ V+ +F Q+  A+ YIH + I+HRDIKT N+FLT +  +K+GDFGISK +    + A T VGTP Y+SPE+ Q LPYSSKSD+WA GC+LYE+ + +  FE SN       SL  KI+ GE   +    + D+  L+  LL   P  RPSA  VL  P
Sbjct:    2 KQIITKTNVMQWFVQVCMAVQYIHSVKILHRDIKTSNVFLTKAGTVKVGDFGISKAMEGTLDMAVTCVGTPYYLSPEMCQDLPYSSKSDVWALGCLLYELCALRPAFEASNIIRLTRRSLFYKIMRGEPDPLDESYSRDVRALVALLLSRSPEDRPSASAVLASP 166          
BLAST of NEK8-1 vs. Ensembl Sea Lamprey
Match: nek2 (NIMA-related kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-752])

HSP 1 Score: 139.813 bits (351), Expect = 9.908e-36
Identity = 78/205 (38.05%), Postives = 116/205 (56.59%), Query Frame = 1
Query:  211 LVVWKEIDIDKNKINEIQ---NEIDILSILDHPNIVAYYNHFVYID--TVFIEMEYANAGSLSNYLRQLKED---LSESCVLWYFFQLIYALDYIHKLH-----IIHRDIKTLNIFLTTSTLLKIGDFGISKVLNED-EFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMP 783
            ++VWK +D       E Q   +E+++L  L HPNIV Y++  +     T++I MEY   G L++ + + + D   L E  VL    QL+ AL   H+       ++HRD+K  N+FL     +K+GDFG++++L  D  FA T VGTP YMSPE    + Y+ KSDIW+ GC+LYE+ +    F   N   LA KI  G+F+ +P
Sbjct:    2 VLVWKVLDYGTMSEPEKQMLVSEVNLLRELKHPNIVRYFDRIIDRSNTTLYIVMEYCECGDLASLISRCRRDRRFLEEEFVLRVLAQLVLALRECHRRTAGGRTVLHRDLKPANVFLDARHNVKLGDFGLARILQHDTSFAKTFVGTPYYMSPEQFSRMSYNEKSDIWSLGCLLYELCALVPPFTAMNQKQLAEKIKEGKFRRIP 206          
BLAST of NEK8-1 vs. Ensembl Yeast
Match: GIN4 (Protein kinase involved in bud growth and assembly of the septin ring; proposed to have kinase-dependent and kinase-independent activities; undergoes autophosphorylation; similar to Hsl1p; GIN4 has a paralog, KCC4, that arose from the whole genome duplication [Source:SGD;Acc:S000002915])

HSP 1 Score: 122.479 bits (306), Expect = 7.766e-29
Identity = 71/215 (33.02%), Postives = 127/215 (59.07%), Query Frame = 1
Query:  259 IQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLNEDEFANTQVGTPVYMSPEVIQGLPYSS-KSDIWASGCVLYEIISRKKLF--EYSNHLSLAMKIINGEFQTMPNCN--NSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWK 888
            I+ EI I+ +L+HPN++  Y+ +     +++ +EYA  G L N L + +  L E   + +F Q+I  + Y H L I+HRD+K  N+ L     +KI DFG++ +  E +   T  G+P Y +PE++ G+PY    SD+W+ G +L+ +++ +  F  E  N  +L +K+  GEF+ MP+ +  + +  DL++++L  +P +R    D+LKHP+ +
Sbjct:   78 IEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVE-RGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFE-MPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQ 290          
BLAST of NEK8-1 vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 113.62 bits (283), Expect = 2.297e-27
Identity = 69/235 (29.36%), Postives = 119/235 (50.64%), Query Frame = 1
Query:   91 VLSNRDFSTNLNVVSYVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEID----IDKNKINEIQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLNEDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMP 783
            +L  RD S   ++  +  +R LG G++G+  L R+  +      K +     +   ++    +E  +LSI+ HP I+  +  F     VF+ M+Y   G L + LR+  +        +Y  ++  AL+Y+H   II+RD+K  NI L  +  +KI DFG +K + +  +  T  GTP Y++PEV+   PY+   D W+ G ++YE+++    F  SN +     I+N E +  P
Sbjct:   73 MLQYRDTSGKYSLSDFQILRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRK-SQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTY--TLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYNSNTMKTYENILNAELKFPP 304          
BLAST of NEK8-1 vs. Ensembl Yeast
Match: SNF1 (AMP-activated S/T protein kinase; forms a complex with Snf4p and members of the Sip1p/Sip2p/Gal83p family; required for transcription of glucose-repressed genes, thermotolerance, sporulation, and peroxisome biogenesis; regulates nucleocytoplasmic shuttling of Hxk2p; regulates filamentous growth and acts as a non-canonical GEF, activating Arf3p during invasive growth; SUMOylation by Mms21p inhibits its function and targets Snf1p for destruction via the Slx5-Slx8 Ub ligase [Source:SGD;Acc:S000002885])

HSP 1 Score: 115.931 bits (289), Expect = 2.945e-27
Identity = 73/221 (33.03%), Postives = 121/221 (54.75%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEID---IDKNKIN-EIQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLNEDEFANTQVGTPVYMSPEVIQGLPYSSKS-DIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMP 783
            Y  V+ LG+G++GK  L  +      V  K I+   + K+ +   I+ EI  L +L HP+I+  Y+     D + + +EYA    L +Y+ Q ++ +SE     +F Q+I A++Y H+  I+HRD+K  N+ L     +KI DFG+S ++ +  F  T  G+P Y +PEVI G  Y+    D+W+ G +LY ++ R+  F+  +   L   I NG + T+P
Sbjct:   55 YQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQ-RDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVY-TLP 272          
BLAST of NEK8-1 vs. Ensembl Yeast
Match: TPK1 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; phosphorylates and inhibits Whi3p to promote G1/S phase passage; partially redundant with Tpk2p and Tpk3p; phosphorylates pre-Tom40p, which impairs its import into mitochondria under non-respiratory conditions; TPK1 has a paralog, TPK3, that arose from the whole genome duplication [Source:SGD;Acc:S000003700])

HSP 1 Score: 113.235 bits (282), Expect = 2.990e-27
Identity = 69/220 (31.36%), Postives = 116/220 (52.73%), Query Frame = 1
Query:  145 VRVLGKGAYGKAVLYRNAVDNSL----VVWKEIDIDKNKINEIQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLNEDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCN 792
            +R LG G++G+  L R+  +       V+ KEI +   ++    +E  +LSI+ HP I+  +  F     +F+ M+Y   G L + LR+  +        +Y  ++  AL+Y+H   II+RD+K  NI L  +  +KI DFG +K + +  +  T  GTP Y++PEV+   PY+   D W+ G ++YE+++    F  SN +    KI+N E +  P  N
Sbjct:   90 LRTLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTNDERLMLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRK-SQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTY--TLCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFYDSNTMKTYEKILNAELRFPPFFN 306          
BLAST of NEK8-1 vs. Ensembl Yeast
Match: KCC4 (Protein kinase of the bud neck involved in the septin checkpoint; associates with septin proteins, negatively regulates Swe1p by phosphorylation, shows structural homology to bud neck kinases Gin4p and Hsl1p; KCC4 has a paralog, GIN4, that arose from the whole genome duplication [Source:SGD;Acc:S000000529])

HSP 1 Score: 115.161 bits (287), Expect = 1.071e-26
Identity = 72/215 (33.49%), Postives = 123/215 (57.21%), Query Frame = 1
Query:  259 IQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLNEDEFANTQVGTPVYMSPEVIQGLPYSS-KSDIWASGCVLYEIISRKKLF--EYSNHLSLAMKIINGEFQTMPNCN--NSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWK 888
            I+ EI I+ +L HPN+++ Y+ +   + +++ +EYA  G L N L      L E   +  F Q+I  + Y H L I+HRD+K  N+ L +   +KI DFG++ +  + +   T  G+P Y +PE++ GLPY    SD+W+ G +L+ +++ +  F  E  N   L +K+  G+F+ MPN    + D  DL+ ++L+ +P +R    D+L HP+ K
Sbjct:   74 IEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVD-HGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFE-MPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286          
BLAST of NEK8-1 vs. Ensembl Nematostella
Match: EDO35699 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKU3])

HSP 1 Score: 473.781 bits (1218), Expect = 1.340e-157
Identity = 248/624 (39.74%), Postives = 392/624 (62.82%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDI----DKNKINEIQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLNEDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWKGNCQSMIDQVHRTNQANSNSRPCSGDRKERSIV-SLNSEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTWSNIQGDKKLSGQLGHGAIV-YKIPKLVQSLKGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGINSNETEMINQFEKITVTDPIDKSPVIINQISCGHHHAAAIGGCED-LLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSGSSQKNLCYDVPFETKFKIVAVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFAGKKIEKISCGDYFTIVST 1986
            Y+ VR LG+GA+G+AVLYR   DN LVVWKE+++    D+ + + ++ EIDILS+L+H NIV Y+NHF+   ++FIEMEY N G+L + +    E   E  V+WYFFQ+  A+ +IH+  I+HRDIKT+NIFLT S L+K+GDFGISK+L+ +  A++ VGTP YMSPE++QG  Y+ KSD+WA GCVLYE+++ K++F+ SN L L   I+ G ++ +      ++  L+ +LL   P  RPS +++L+ P+     + M  +V + N +   +R  +   +   ++ S   EV+ WG GK    K++ F   ++A QVAAG SHF ++T EK+++TW+N  G K +SGQLGHG +  Y+ PK V +L G+ IK+V+CG+E T C++ +G ++  GS+Y+G +G ++   E +    K+T  +  DK    +  ISCG  H   +  C +  +++WGCGE+GRLGLG ED+   P  + +P   CK+K +YCG ++TF++   + R+L CGNN  N+LG++     L    ++++   VP     K+V  L    ++ V+ G +H+A +D+Y +L   G N YGQ+G+   + H    +       K++ + +CG+ FT+V+T
Sbjct:   17 YIPVRTLGRGAFGEAVLYRKIEDNMLVVWKEVNLSRASDRERADALK-EIDILSLLNHTNIVTYFNHFIDGTSLFIEMEYCNGGTLHDKICVQNELFPEEVVIWYFFQICAAVGHIHENGIVHRDIKTMNIFLTKSGLVKLGDFGISKILDSEGMADSIVGTPYYMSPEIVQGKKYNQKSDMWAVGCVLYEVLTLKRVFDASNPLRLVSDIVKGHYEEIDERYTEEMNSLVNKLLSQNPDDRPSVQELLEMPILATLGKEMEKKVWQLNSSTRRARLVTHSSETVPVITSKTCEVYFWGAGKQTPQKVDTFVLGNTATQVAAGHSHFAIVTVEKEMFTWANAHGGKGMSGQLGHGDVACYRNPKRVDALFGIPIKKVACGDEFTACITDDGALYTFGSDYFGCIGCSNELDEEVLLPHKVTFFN--DKP---VEDISCGDCHVVVM--CANKAIYSWGCGEHGRLGLGSEDDFAFPQKIPLPT-SCKVKRIYCGPESTFLL-TVTGRVLACGNNDENQLGLDT----LHSLRKRSIKGHVPSANSPKLVQSLNRYTIAIVAPGKTHSAFVDVYGRLVTVGSNKYGQLGVNDYQHHPSPCQVKGELVSKQVVEAACGEEFTVVAT 626          

HSP 2 Score: 61.2326 bits (147), Expect = 1.377e-9
Identity = 39/108 (36.11%), Postives = 54/108 (50.00%), Query Frame = 1
Query: 1723 CYDVPFETKFKIVAVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKV--FAGKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLGL 2040
            CY  P     K V  L  + +  V+CG+  TA +     LY FG + +G IG  + +  ++V    KV  F  K +E ISCGD   +V   N  I+ WG  + GRLGL
Sbjct:  374 CYRNP-----KRVDALFGIPIKKVACGDEFTACITDDGALYTFGSDYFGCIGCSN-ELDEEVLLPHKVTFFNDKPVEDISCGDCHVVVMCANKAIYSWGCGEHGRLGL 475          

HSP 3 Score: 52.7582 bits (125), Expect = 4.672e-7
Identity = 55/215 (25.58%), Postives = 90/215 (41.86%), Query Frame = 1
Query: 1420 QISCGHHHAAAIGGCEDLLFTW-----GCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSGSSQKNLCYDVPFETKFKIVAVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFAGK--KIEKISCGDYFTIVSTTNNEIFGWGRADSGRLGLE 2043
            Q++ GH H A +   E  +FTW     G G  G+LG G       P  VD  L    +K V CG + T  +      L   G++ +  +G          S++ +    +P +  F       +  V  +SCG+ H  V+     +Y +G   +G++GLG   +  D     K+      K+++I CG   T + T    +   G  D  +LGL+
Sbjct:  334 QVAAGHSHFAIVT-VEKEMFTWANAHGGKGMSGQLGHGDVACYRNPKRVD-ALFGIPIKKVACGDEFTACITD-DGALYTFGSDYFGCIGC---------SNELDEEVLLPHKVTF-----FNDKPVEDISCGDCHVVVMCANKAIYSWGCGEHGRLGLG---SEDDFAFPQKIPLPTSCKVKRIYCGPESTFLLTVTGRVLACGNNDENQLGLD 528          
BLAST of NEK8-1 vs. Ensembl Nematostella
Match: EDO46185 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQY7])

HSP 1 Score: 344.739 bits (883), Expect = 1.771e-107
Identity = 229/690 (33.19%), Postives = 356/690 (51.59%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNKINEIQ---NEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKEDL-SESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTST-LLKIGDFGISKVLNEDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWKGNCQSMIDQVHRTN---------------QANSNSRPCSGDRKERSIVSLNSE-----VFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTWSNIQGDKKLSGQLGHGAIVYK---IPKLVQSLKGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGINSNETEMINQFEKITVTDPIDKSPVIINQISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSGSSQKNLCYDVPFETKFKIVAVLRNVKV--------STVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFAG-KKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLGLEITVDQR---CVLHPRAL 2085
            Y +VR++G+GAYG   L R  VDN LV+ K+I +++    E Q   NE+ +LS+  HPNI+ YY+ FV    + I MEYA  G++ +YL+Q    L  E  +L  F Q++ AL ++HK  I+HRD+KT NI L     ++KIGDFGISK+L+    ANT +G+P Y+SPE+ +G PY+ KSD+W+ GCVLYE+ + K+ FE SN  +L +KI+ G F  +P   + +L  L+  +L+ +PTKRP  ++++  PV       +   V R                 + +S S    G  +   + ++  +     V+ WGGG      +   Q     +QV+ G +    +TA   +  W       K SG +  G    K   +P+ ++   G+ I +VSCG+  T CL+  G +   GS  YG LG     T  ++Q + +      D     +  ISCG  H  A+    + +F WG G+ GRLG G +   + P  + +P    + + V+CG D +F +    ++LL CG+N+ NKL ++                D P E     VAVLR V V        S+V+ G SHT VL    KLY FG NS+GQ+G       + V++  ++      +  ++CGD F++  ++++E+F WG+   GRLG +   D R   C+  P A+
Sbjct:    4 YEKVRIVGRGAYGTVYLCRRLVDNFLVIIKQIPVEEMTKEERQSALNEVKVLSMFQHPNIIRYYDSFVQEKALMIVMEYAQGGTIYDYLQQRGGKLMDEDEILRLFVQILLALRHVHKGQILHRDLKTQNILLNKKRKVVKIGDFGISKILSSKSKANTVIGSPCYISPELCEGKPYNQKSDVWSLGCVLYELTTLKRAFEASNLPALVLKIMRGYFSPIPERYSEELRKLILDMLVLDPTKRPGIKEIMAQPVIVNALFDLPTDVGRVPCTRFPRTGAGIAGMYEESSASTILEGLPENLGVFAMKPQEPQHMVYHWGGGITYPNPLPLPQHDSGVVQVSCGRTLMTGVTANGRMILWEG----SKSSGLMSSGGKNEKTVWVPRFLEGQSGITITKVSCGDLFTACLTDRGILMTFGSGTYGCLG--HGTTNYVSQAKIVE-----DLLGFEVEDISCGSSHIMAVTADHE-VFAWGRGDNGRLGTGSQQEYWSPKAISLP-EGMRARSVHCGVDCSFAI-TLENKLLACGSNRCNKLALDNE--------------DGPVEE----VAVLRQVSVPDFNSVGTSSVAMGTSHTLVLLQNGKLYSFGSNSFGQLGY----VREGVSRFPQLVESLNDVSYVACGDTFSVAVSSDSEVFVWGKGARGRLGNKADEDVREPVCLSLPAAV 657          
BLAST of NEK8-1 vs. Ensembl Nematostella
Match: EDO49822 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG20])

HSP 1 Score: 182.57 bits (462), Expect = 5.280e-52
Identity = 104/251 (41.43%), Postives = 156/251 (62.15%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNKINEIQ---NEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLR-QLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLNED-EFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLK 873
            YV+V+ +G+G++GKA+L +   D    V KEI+I + K  E +    E+ +LS L HPNIV+Y   F     ++I M+Y + G L   +  Q     SE  V+ +F Q+   L ++H   I+HRDIK+ NIFLT   ++K+GDFGI++VL+   E A T +GTP Y+SPE+++  PY++KSDIW+ GCVLYE+++ K  FE  N  +L +KII G +  +P   ++D+  L+ +LL   P  RPS   VLK
Sbjct:    4 YVRVKKIGEGSFGKALLVKKRNDGKHYVIKEINICRMKPREREESRKEVKVLSQLKHPNIVSYQESFEESGNLYIVMDYCDGGDLYKKINGQRGIAFSEDQVMDWFVQICLGLKHVHDRKILHRDIKSQNIFLTRHGIIKMGDFGIARVLHSTVELARTCIGTPYYLSPEIVENRPYNNKSDIWSLGCVLYEMLTLKHAFEAGNMKNLVLKIIRGSYPPIPLRYSADIRMLVAQLLKRNPHDRPSVNTVLK 254          
BLAST of NEK8-1 vs. Ensembl Nematostella
Match: EDO49690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG02])

HSP 1 Score: 180.259 bits (456), Expect = 5.109e-51
Identity = 102/263 (38.78%), Postives = 159/263 (60.46%), Query Frame = 1
Query:  121 LNVVSYVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNKINEIQN---EIDILSILDHPNIVAYYNHFVYIDT--VFIEMEYANAGSLSNYLRQLKE-DLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVL-NEDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWK 888
            +++  Y   + +GKG+YG+  L ++  D    V K++D+ K  + E +    E  +LS L HPNIV+Y   F   DT  ++I M +   G L + L+  K   L E+ ++ +F Q+  AL Y+H+ HI+HRD+KT NIFLT S ++K+GD GI++VL +  + A T +GTP YMSPE+    PY+ KSD+WA GC LYE+ + +  F   +  SL  KI+ G+   +P   ++DL  +++ +L  +P KRPSA  +L+HP  K
Sbjct:    1 MSLDRYTIGKCIGKGSYGEVFLSKHKKDKKQYVLKKVDLQKASVRERKAAELEAKLLSQLRHPNIVSYRESFQ-DDTGFLYIAMNFCEGGDLYSRLKAQKGIPLDENQIVEWFVQIAMALQYMHEKHILHRDLKTQNIFLTKSKIIKVGDLGIARVLESSSDMATTLIGTPYYMSPELFSNKPYNHKSDVWALGCCLYEMCTLRHAFNAKDMSSLVYKILKGKTPPLPKQYSTDLCSIIKSMLDQDPDKRPSASRLLRHPYIK 262          
BLAST of NEK8-1 vs. Ensembl Nematostella
Match: EDO49138 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH03])

HSP 1 Score: 175.637 bits (444), Expect = 1.038e-49
Identity = 101/252 (40.08%), Postives = 146/252 (57.94%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNKINEIQ---NEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLNED-EFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHP 879
            Y ++ ++GKG +G A L  +     L   KE++       +     NE+ ILS L H NIV Y + F      +I MEYA  G L   ++Q  E  S   +L +  QL+ AL +IH  +I+HRD+KT NIFLT   ++KIGDFGI+++L+   + A T VGTP Y+SPE+ Q  PY++KSDIWA GCVLYE+ +R   F   N  +L +KI++G +  +P      L DL+  +L   P  RPSA+ ++  P
Sbjct:    4 YQKIDIIGKGTFGSAWLVESRQSKRLYALKELNATAMPSEDRHLALNEVKILSTLKHRNIVRYRDAFEETGRFYIVMEYAEGGDLHTKIKQAVEPFSSERILNWLAQLLLALKHIHGQNILHRDLKTQNIFLTKDDVVKIGDFGIARILDSTCDHARTTVGTPYYLSPEICQRQPYNNKSDIWALGCVLYELTTRTHPFTADNLTNLVVKILHGNYPPIPRFYGPLLEDLVAVMLKINPADRPSAKQLIYVP 255          
BLAST of NEK8-1 vs. Ensembl Medaka
Match: NEK9 (NIMA related kinase 9 [Source:NCBI gene;Acc:101166349])

HSP 1 Score: 535.798 bits (1379), Expect = 5.484e-177
Identity = 292/702 (41.60%), Postives = 439/702 (62.54%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDID---KNKINEIQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKE-DLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLN-EDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEF--QTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWKGNCQSMIDQVHRTNQANSNSRPCSGDRKERSI--VSLNSEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTWSNIQGDKKLSGQLGHG-AIVYKIPKLVQSLKGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGINSNETEMINQFEKITVTDPIDKSPVIINQISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSG-SSQKNLCYD-VPFETKFKIVAVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFAGKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLGLEITV---DQRCVLHPRALFGTLQKCADIQSFGWQTIMITERILETSTISANSTAI 2196
            Y+ +R+LG+GA+G+A LYR   DNSLVVWKE+D++   + +  ++ NEI+ILS+L+H NI+AY+NHF+  +++ IE+EY N G+L + + Q K    SE  V+WY +Q+  A+ YIHK  I+HRDIKTLNIFLT + L+K+GD+G++K L+ E   A T VGTP YMSPE+ QG  Y+ KSDIWA GCVLYE+++ K+ F+ +N L+L +KI+ G +  + + +  +S LL L+   L  +P KRP+AE +L  P      Q + +QV   N  +S  RP      E SI  V+ + EV+ WGGGK    K++ F+    A  V AG +HF V+T EK+LYTW+++QG  K+ GQLGHG    Y+ PK V+ L+G  I++V+CG + T C++   +M+  GS+Y G +G+   E ++ +Q  +  + +  +  PV +  +SCG +H   +   +D +++WGCGEYGRLGL  ED    P  V +P+    +  V CG D+TF + + S ++L CGNN++NKLG+N   QG+SG  +     Y  +P+ T   +V  L   K+ ++S G +HTA +D   +L  FG N +GQ+G+   K H  V      F GK + K++CGD FTI +T +N+IF WG A +GRLG+        + C   PR +FG+L    D+   GW TI+I E++L + TI +NS+ +
Sbjct:   41 YIPIRILGRGAFGEATLYRRTEDNSLVVWKEVDLNSLSEKERRDVMNEINILSVLEHNNIIAYFNHFMDKNSLLIELEYCNGGNLYDKIVQQKGVPFSEKVVVWYLYQIASAVAYIHKAGILHRDIKTLNIFLTKTDLIKLGDYGLAKKLDSEFSMAETCVGTPYYMSPELCQGAKYNFKSDIWAMGCVLYEVLTLKRTFDATNPLNLCVKIVQGNWTMEGVSDIYSSGLLKLVYECLHQDPAKRPTAEHILDQPSISCCRQELEEQVVLLN--SSMKRPKLNPVSESSIAVVTRSREVYYWGGGKFTPQKLDSFKAGSGAQHVCAGENHFAVVTVEKELYTWADVQGGAKMVGQLGHGDQASYRQPKRVEKLQGKAIRQVACGADFTACVTDEDQMYMFGSDYDGCIGV---EGQLGSQVLEPVLLEFFEGRPVQL--VSCGDNHVVVLTRDKD-IYSWGCGEYGRLGLESEDEFSSPMQVKVPI-GASISSVSCGSDSTFFLTE-SGKVLACGNNEFNKLGLN---QGISGIKNHPGEGYQGIPYTTAMTLVKQLSRFKIQSISPGKTHTAAIDERGRLITFGCNKFGQLGVKDFKKHAGVQVLVGPFGGKTVTKVACGDGFTIAATEDNQIFAWGNAGNGRLGMPPDKGFGSEVCPALPRPIFGSLHHVPDLSCRGWHTIIIMEKVLNSKTIRSNSSGL 729          
BLAST of NEK8-1 vs. Ensembl Medaka
Match: nek8 (NIMA related kinase 8 [Source:NCBI gene;Acc:101161178])

HSP 1 Score: 304.294 bits (778), Expect = 1.361e-91
Identity = 216/670 (32.24%), Postives = 339/670 (50.60%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNKINE---IQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYL-RQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLL-KIGDFGISKVLNEDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWK----------GNCQ-SMIDQVHRTNQANSNSRPCSGDRKERS-------------IVSLN-SEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTWSNIQGDKKLSGQLGHGAIVYK-----IPKLVQSLKGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGI-NSNETEMINQFEKITVTDPIDKSPVIINQISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSGSSQKNLCYDVPFETKFKIVAVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFAGKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLG 2037
            Y +++V+G+GA+G   L R   D + V+ KEI +++   +E    QNE  +L +L+HPNI+ YY +F+    + I MEYA  G+L+ Y+ ++    L E  +L +F Q++ AL ++H   I+HRD+KT NI L    ++ KIGDFGISK+L     A T VGTP Y+SPE+ +G PY+ KSDIWA GCVLYE+ S K+ FE +N  +L +KI++G F  + +  + +L  L+  +L  +P+KRP   +++  P+            GN +   I++     Q     RP  G R   S             + SL  S V+ WG G     ++         LQV+ G +  + +T    L TW   +     +G+LG   +V       I + ++   GV IK VSCG+  T C++  G +   GS   G LG  N N+       E +   +        + Q++CG  H  A+   E  +F WG G+ GRLGLG +D    P  V +P+   + +   CG D + I+      ++ CG+N++NKLG++    G    SQ N   +    T  + V  L   K+ +V  G SH+A +    + + FG N +GQ+G    ++ +       V   + I  ++CGD FT+      E++ WG+   GRLG
Sbjct:    4 YEKIKVVGRGAFGIVHLCRRRSDGAFVILKEIPVEQMSRDERLAAQNECQVLKLLNHPNIIEYYENFLEDKALMIAMEYAPGGTLAEYIQKRCNSLLDEDTILHFFVQILLALYHVHNKLILHRDLKTQNILLDKHQMIVKIGDFGISKILVSKSKAYTVVGTPCYISPELCEGKPYNQKSDIWALGCVLYELASLKRAFEAANLPALVLKIMSGTFAPISDRYSPELRQLILNMLNLDPSKRPQLNEIMALPICTRPLLNLYTDVGNVKMRRIEKPLSAVQLGLPGRP--GGRVSTSRLREGSFGFGSGQVHSLPLSSVYTWGSGITTPFRLP--MPNTEVLQVSLGRTQKMGVTKSGRLITW---EAPSVGAGELGPPGVVEHMQLLFISRFLEGQSGVTIKSVSCGDLFTTCMTERGIIMTFGSGSNGCLGHGNFNDVTQPKIVEALLGYE--------LVQVACGASHVVAVTN-EREVFAWGRGDNGRLGLGTQDTHNSPQQVCLPV-GFEAQRAVCGVDCSMIISS-QSSIMACGSNRFNKLGLDRITAG-EEPSQVNQVEEAHSFTPVQSVP-LNTDKIVSVDIGTSHSAAVTEGGQCFTFGSNQHGQMGCSSRRSGR---VPYLVLGLQDITMVACGDAFTLAIGAEGEVYTWGKGARGRLG 650          

HSP 2 Score: 55.4546 bits (132), Expect = 2.031e-7
Identity = 31/90 (34.44%), Postives = 47/90 (52.22%), Query Frame = 1
Query: 1777 VKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFA--GKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLGL 2040
            V + +VSCG+  T  +     +  FG  S G +G G+     DV +   V A  G ++ +++CG    +  T   E+F WGR D+GRLGL
Sbjct:  397 VTIKSVSCGDLFTTCMTERGIIMTFGSGSNGCLGHGN---FNDVTQPKIVEALLGYELVQVACGASHVVAVTNEREVFAWGRGDNGRLGL 483          
BLAST of NEK8-1 vs. Ensembl Medaka
Match: nek8 (NIMA related kinase 8 [Source:NCBI gene;Acc:101161178])

HSP 1 Score: 290.426 bits (742), Expect = 2.965e-86
Identity = 210/654 (32.11%), Postives = 327/654 (50.00%), Query Frame = 1
Query:  184 LYRNAVDNSLVVWKEIDIDKNKINE---IQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYL-RQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLL-KIGDFGISKVLNEDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWK----------GNCQ-SMIDQVHRTNQANSNSRPCSGDRKERS-------------IVSLN-SEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTWSNIQGDKKLSGQLGHGAIVYK-----IPKLVQSLKGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGI-NSNETEMINQFEKITVTDPIDKSPVIINQISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSGSSQKNLCYDVPFETKFKIVAVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFAGKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLG 2037
            L R   D + V+ KEI +++   +E    QNE  +L +L+HPNI+ YY +F+    + I MEYA  G+L+ Y+ ++    L E  +L +F Q++ AL ++H   I+HRD+KT NI L    ++ KIGDFGISK+L     A T VGTP Y+SPE+ +G PY+ KSDIWA GCVLYE+ S K+ FE +N  +L +KI++G F  + +  + +L  L+  +L  +P+KRP   +++  P+            GN +   I++     Q     RP  G R   S             + SL  S V+ WG G     ++         LQV+ G +  + +T    L TW   +     +G+LG   +V       I + ++   GV IK VSCG+  T C++  G +   GS   G LG  N N+       E +   +        + Q++CG  H  A+   E  +F WG G+ GRLGLG +D    P  V +P+   + +   CG D + I+      ++ CG+N++NKLG++    G    SQ N   +    T  + V  L   K+ +V  G SH+A +    + + FG N +GQ+G    ++ +       V   + I  ++CGD FT+      E++ WG+   GRLG
Sbjct:   36 LCRRRSDGAFVILKEIPVEQMSRDERLAAQNECQVLKLLNHPNIIEYYENFLEDKALMIAMEYAPGGTLAEYIQKRCNSLLDEDTILHFFVQILLALYHVHNKLILHRDLKTQNILLDKHQMIVKIGDFGISKILVSKSKAYTVVGTPCYISPELCEGKPYNQKSDIWALGCVLYELASLKRAFEAANLPALVLKIMSGTFAPISDRYSPELRQLILNMLNLDPSKRPQLNEIMALPICTRPLLNLYTDVGNVKMRRIEKPLSAVQLGLPGRP--GGRVSTSRLREGSFGFGSGQVHSLPLSSVYTWGSGITTPFRLP--MPNTEVLQVSLGRTQKMGVTKSGRLITW---EAPSVGAGELGPPGVVEHMQLLFISRFLEGQSGVTIKSVSCGDLFTTCMTERGIIMTFGSGSNGCLGHGNFNDVTQPKIVEALLGYE--------LVQVACGASHVVAVTN-EREVFAWGRGDNGRLGLGTQDTHNSPQQVCLPV-GFEAQRAVCGVDCSMIISS-QSSIMACGSNRFNKLGLDRITAG-EEPSQVNQVEEAHSFTPVQSVP-LNTDKIVSVDIGTSHSAAVTEGGQCFTFGSNQHGQMGCSSRRSGR---VPYLVLGLQDITMVACGDAFTLAIGAEGEVYTWGKGARGRLG 666          

HSP 2 Score: 55.4546 bits (132), Expect = 1.965e-7
Identity = 31/90 (34.44%), Postives = 47/90 (52.22%), Query Frame = 1
Query: 1777 VKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFA--GKKIEKISCGDYFTIVSTTNNEIFGWGRADSGRLGL 2040
            V + +VSCG+  T  +     +  FG  S G +G G+     DV +   V A  G ++ +++CG    +  T   E+F WGR D+GRLGL
Sbjct:  413 VTIKSVSCGDLFTTCMTERGIIMTFGSGSNGCLGHGN---FNDVTQPKIVEALLGYELVQVACGASHVVAVTNEREVFAWGRGDNGRLGL 499          
BLAST of NEK8-1 vs. Ensembl Medaka
Match: nek4 (NIMA related kinase 4 [Source:NCBI gene;Acc:101169778])

HSP 1 Score: 180.259 bits (456), Expect = 1.517e-46
Identity = 100/258 (38.76%), Postives = 159/258 (61.63%), Query Frame = 1
Query:  133 SYVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDID---KNKINEIQNEIDILSILDHPNIVAYYNHFVYIDT-VFIEMEYANAGSLSNYLRQLK-EDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVL-NEDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWK 888
            SY+ +RV+GKG+YG+  L ++  D    V K++++    K +    + E  +LS L HPNIV Y   +   D  ++I M +   G L + L+Q K E L E  V+ +F Q+  AL Y+H+ +I+HRD+KT NIFLT + ++K+GD GI++VL N+++ A+T +GTP YMSPE+    PY+ KSD+WA GC +YE+ + K  F   +  SL  +I+ G+   MP+  +  L DL++ +L  +P +RP  + +L+ P  K
Sbjct:    3 SYIFIRVVGKGSYGEVNLVKHKTDRKQYVIKKLNLSTSSKRERRSAEQEAQLLSQLRHPNIVTYRESWEGDDRQLYIVMGFCEGGDLYHRLKQRKGELLPERQVVEWFVQIAMALQYLHERNILHRDLKTQNIFLTKTNIIKVGDLGIARVLENQNDMASTLIGTPYYMSPELFSNKPYNHKSDVWALGCCVYEMSTLKHAFNAKDMNSLVYRIVEGKLPQMPSRYDPQLGDLIKSMLSKKPEERPDVKLILRQPYIK 260          
BLAST of NEK8-1 vs. Ensembl Medaka
Match: ENSORLT00000000545.2 (pep primary_assembly:ASM223467v1:4:1040495:1044496:1 gene:ENSORLG00000000439.2 transcript:ENSORLT00000000545.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 166.777 bits (421), Expect = 3.705e-46
Identity = 100/252 (39.68%), Postives = 147/252 (58.33%), Query Frame = 1
Query:  136 YVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDID---KNKINEIQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKEDL-SESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLNEDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHP 879
            Y  V+ +G+G++GKA+L  +  D    V KEI I      +  E + E+ +L+ + HPNIV Y   F     ++I M+Y   G L   +   K  L SE  +L +F Q+  AL ++H   I+HRDIK+ NIFLT    +++GDFGI++VLN  E A T +GTP Y+SPE+ +  PY++K DIWA GCVLYE+ + K  FE  N  +L +KII G +  +    + +L  LL +L    P +RPS   +L+ P
Sbjct:    4 YENVKQIGEGSFGKAILVNSKEDGRQYVIKEIGISGMSTKERRESRKEVSVLANMSHPNIVQYKESFEG-GCLYIVMDYCEGGDLFKKINSQKGVLFSEDQILDWFVQICLALKHVHGRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNTVELARTCIGTPYYLSPEICENKPYNNK-DIWALGCVLYEMCTLKHAFEAGNMKNLVLKIIRGSYPPVSVHYSPELRSLLAQLFRRNPRERPSVSSILEKP 253          
BLAST of NEK8-1 vs. Planmine SMEST
Match: SMESG000053193.1 (SMESG000053193.1)

HSP 1 Score: 757.288 bits (1954), Expect = 0.000e+0
Identity = 380/382 (99.48%), Postives = 380/382 (99.48%), Query Frame = 1
Query:   67 MDNCRDNEVLSNRDFSTNLNVVSYVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNKINEIQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLNEDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWKGNCQSMIDQVHRTNQANSNSRPCSGDRKERSIVSLNSEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTWSNIQGDKKLSGQLGHGAIVYKIPKL 1212
            M NCRDNEVLSNRDFSTNLNVVSYVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNKINEIQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLNEDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSDLLDLLQRLLLNEPTKRPSAEDVLKHPVWKGNCQSMIDQVHRTNQANSNSRPCSGDRKERSIVSLNSEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTWSNIQGDKKLSGQLGHGAIVYKIP L
Sbjct:    1 MVNCRDNEVLSNRDFSTNLNVVSYVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNKINEIQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLNEDEFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSDLLDLLQRLLLNEPTKRPSAEDVLKHPVWKGNCQSMIDQVHRTNQANSNSRPCSGDRKERSIVSLNSEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTWSNIQGDKKLSGQLGHGAIVYKIPNL 382          
BLAST of NEK8-1 vs. Planmine SMEST
Match: SMESG000043302.1 (SMESG000043302.1)

HSP 1 Score: 309.301 bits (791), Expect = 3.947e-91
Identity = 222/646 (34.37%), Postives = 337/646 (52.17%), Query Frame = 1
Query:  109 FSTNLNVVSYVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNKINEIQ---NEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLNED-EFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWKGNCQSMIDQVHRTNQANSNSRPCSGDRKERSIVSLNSEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTWSNIQGDKKLSGQLGHGAIV-YKIPKLVQSLKGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGINSNETEMINQFEKITVTDPIDKSPVI-INQISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYN-----KLGINIHAQGLSGSSQKNLCYDVPFETKFKIVAVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFAGKKIEKISCGDYFTIVSTTNNEIFGWG 2013
            FS    +  + ++R +GKGAYG AVLYR   D+SLV+ KEI++      E Q   NE+ +LS LDHPNIVAY++ F     + IEMEYA+ G+L+ +L   ++ L E  +L  FFQ++ A+ YIH+  I+HRD+KT+NIFLT   ++KIGDFGISK+L+   E AN+ +GTP Y+SPE+ QG  Y+ KSD+WA GC+LYE+    K FE SN  +L  KI+ G+F+ +    + +L +L+  LL   P  R S E +L H          +  + +T   +S+    +   + RS+      V+V     +N L   +   K    Q+ +G +H +VLT ++ ++TW    G  +  GQLGHG +V  K P+LV SL    +  ++CG + +I    NG +  CGS   G LG           F+ +     I+    I +  IS  + H   +   ED+++ WG  + G+LGL   +    P ++    H   +K  +   D T ++ +    L    NN        +LG  +  + LS     N  ++       K+ AV+R+  V+ VS G  HT VL    K+  FG NS GQ+G G TK +  +    K     KI K++ G  FT+     N ++ WG
Sbjct:   42 FSIQQTINGFEKIRTVGKGAYGTAVLYRKKDDDSLVILKEINMHDLSATERQLAMNEVKVLSQLDHPNIVAYFDSFEEDGVLMIEMEYADNGTLAQFLSNQEKPLEEKKILEMFFQIVSAIHYIHEHKILHRDLKTVNIFLTKEEIIKIGDFGISKMLSTTHEGANSVIGTPYYISPEMCQGKLYNEKSDVWALGCILYEMTCLHKTFEGSNLPALVNKILKGQFEPVKGSYSDELKELISSLLEKNPDDRLSTEVILHH---------KLPMMMKTFHTDSSDNVDTAKPQTRSV------VYVMDINTLN-LSPVRLPSKIRIKQICSGENHTIVLTTDRTVFTW----GSNEF-GQLGHGDLVDRKKPELVSSLTQKSLIRIACGNDFSIFGPENGIIMTCGSGISGSLG--------HGDFKDVLKPRLIESLLTIDVVCISATNSHVVVVSS-EDVIYGWGSNKNGQLGLDSLNLYCSPQVITFKEH-VLVKNAFTSEDATMLLTETGGLLASGNNNGNKLGLNARLGFLMTMKSLSQQPTINSVHEFT-----KVEAVMRHC-VNQVSMGKGHTTVLCESGKIIAFGINSSGQLGNGSTK-NSPIPCEVKTMKKHKITKVTSGSNFTVACVDFNSLYFWG 649          
BLAST of NEK8-1 vs. Planmine SMEST
Match: SMESG000043302.1 (SMESG000043302.1)

HSP 1 Score: 309.301 bits (791), Expect = 4.083e-91
Identity = 222/646 (34.37%), Postives = 337/646 (52.17%), Query Frame = 1
Query:  109 FSTNLNVVSYVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNKINEIQ---NEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLNED-EFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWKGNCQSMIDQVHRTNQANSNSRPCSGDRKERSIVSLNSEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTWSNIQGDKKLSGQLGHGAIV-YKIPKLVQSLKGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGINSNETEMINQFEKITVTDPIDKSPVI-INQISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYN-----KLGINIHAQGLSGSSQKNLCYDVPFETKFKIVAVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFAGKKIEKISCGDYFTIVSTTNNEIFGWG 2013
            FS    +  + ++R +GKGAYG AVLYR   D+SLV+ KEI++      E Q   NE+ +LS LDHPNIVAY++ F     + IEMEYA+ G+L+ +L   ++ L E  +L  FFQ++ A+ YIH+  I+HRD+KT+NIFLT   ++KIGDFGISK+L+   E AN+ +GTP Y+SPE+ QG  Y+ KSD+WA GC+LYE+    K FE SN  +L  KI+ G+F+ +    + +L +L+  LL   P  R S E +L H          +  + +T   +S+    +   + RS+      V+V     +N L   +   K    Q+ +G +H +VLT ++ ++TW    G  +  GQLGHG +V  K P+LV SL    +  ++CG + +I    NG +  CGS   G LG           F+ +     I+    I +  IS  + H   +   ED+++ WG  + G+LGL   +    P ++    H   +K  +   D T ++ +    L    NN        +LG  +  + LS     N  ++       K+ AV+R+  V+ VS G  HT VL    K+  FG NS GQ+G G TK +  +    K     KI K++ G  FT+     N ++ WG
Sbjct:   51 FSIQQTINGFEKIRTVGKGAYGTAVLYRKKDDDSLVILKEINMHDLSATERQLAMNEVKVLSQLDHPNIVAYFDSFEEDGVLMIEMEYADNGTLAQFLSNQEKPLEEKKILEMFFQIVSAIHYIHEHKILHRDLKTVNIFLTKEEIIKIGDFGISKMLSTTHEGANSVIGTPYYISPEMCQGKLYNEKSDVWALGCILYEMTCLHKTFEGSNLPALVNKILKGQFEPVKGSYSDELKELISSLLEKNPDDRLSTEVILHHK---------LPMMMKTFHTDSSDNVDTAKPQTRSV------VYVMDINTLN-LSPVRLPSKIRIKQICSGENHTIVLTTDRTVFTW----GSNEF-GQLGHGDLVDRKKPELVSSLTQKSLIRIACGNDFSIFGPENGIIMTCGSGISGSLG--------HGDFKDVLKPRLIESLLTIDVVCISATNSHVVVVSS-EDVIYGWGSNKNGQLGLDSLNLYCSPQVITFKEH-VLVKNAFTSEDATMLLTETGGLLASGNNNGNKLGLNARLGFLMTMKSLSQQPTINSVHEFT-----KVEAVMRHC-VNQVSMGKGHTTVLCESGKIIAFGINSSGQLGNGSTK-NSPIPCEVKTMKKHKITKVTSGSNFTVACVDFNSLYFWG 658          
BLAST of NEK8-1 vs. Planmine SMEST
Match: SMESG000043302.1 (SMESG000043302.1)

HSP 1 Score: 309.301 bits (791), Expect = 4.204e-91
Identity = 222/646 (34.37%), Postives = 337/646 (52.17%), Query Frame = 1
Query:  109 FSTNLNVVSYVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNKINEIQ---NEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLNED-EFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWKGNCQSMIDQVHRTNQANSNSRPCSGDRKERSIVSLNSEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTWSNIQGDKKLSGQLGHGAIV-YKIPKLVQSLKGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGINSNETEMINQFEKITVTDPIDKSPVI-INQISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYN-----KLGINIHAQGLSGSSQKNLCYDVPFETKFKIVAVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFAGKKIEKISCGDYFTIVSTTNNEIFGWG 2013
            FS    +  + ++R +GKGAYG AVLYR   D+SLV+ KEI++      E Q   NE+ +LS LDHPNIVAY++ F     + IEMEYA+ G+L+ +L   ++ L E  +L  FFQ++ A+ YIH+  I+HRD+KT+NIFLT   ++KIGDFGISK+L+   E AN+ +GTP Y+SPE+ QG  Y+ KSD+WA GC+LYE+    K FE SN  +L  KI+ G+F+ +    + +L +L+  LL   P  R S E +L H          +  + +T   +S+    +   + RS+      V+V     +N L   +   K    Q+ +G +H +VLT ++ ++TW    G  +  GQLGHG +V  K P+LV SL    +  ++CG + +I    NG +  CGS   G LG           F+ +     I+    I +  IS  + H   +   ED+++ WG  + G+LGL   +    P ++    H   +K  +   D T ++ +    L    NN        +LG  +  + LS     N  ++       K+ AV+R+  V+ VS G  HT VL    K+  FG NS GQ+G G TK +  +    K     KI K++ G  FT+     N ++ WG
Sbjct:   46 FSIQQTINGFEKIRTVGKGAYGTAVLYRKKDDDSLVILKEINMHDLSATERQLAMNEVKVLSQLDHPNIVAYFDSFEEDGVLMIEMEYADNGTLAQFLSNQEKPLEEKKILEMFFQIVSAIHYIHEHKILHRDLKTVNIFLTKEEIIKIGDFGISKMLSTTHEGANSVIGTPYYISPEMCQGKLYNEKSDVWALGCILYEMTCLHKTFEGSNLPALVNKILKGQFEPVKGSYSDELKELISSLLEKNPDDRLSTEVILHH---------KLPMMMKTFHTDSSDNVDTAKPQTRSV------VYVMDINTLN-LSPVRLPSKIRIKQICSGENHTIVLTTDRTVFTW----GSNEF-GQLGHGDLVDRKKPELVSSLTQKSLIRIACGNDFSIFGPENGIIMTCGSGISGSLG--------HGDFKDVLKPRLIESLLTIDVVCISATNSHVVVVSS-EDVIYGWGSNKNGQLGLDSLNLYCSPQVITFKEH-VLVKNAFTSEDATMLLTETGGLLASGNNNGNKLGLNARLGFLMTMKSLSQQPTINSVHEFT-----KVEAVMRHC-VNQVSMGKGHTTVLCESGKIIAFGINSSGQLGNGSTK-NSPIPCEVKTMKKHKITKVTSGSNFTVACVDFNSLYFWG 653          
BLAST of NEK8-1 vs. Planmine SMEST
Match: SMESG000043302.1 (SMESG000043302.1)

HSP 1 Score: 309.301 bits (791), Expect = 4.217e-91
Identity = 222/646 (34.37%), Postives = 337/646 (52.17%), Query Frame = 1
Query:  109 FSTNLNVVSYVQVRVLGKGAYGKAVLYRNAVDNSLVVWKEIDIDKNKINEIQ---NEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYANAGSLSNYLRQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNIFLTTSTLLKIGDFGISKVLNED-EFANTQVGTPVYMSPEVIQGLPYSSKSDIWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSXXXXXXXXXXXNEPTKRPSAEDVLKHPVWKGNCQSMIDQVHRTNQANSNSRPCSGDRKERSIVSLNSEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTAEKDLYTWSNIQGDKKLSGQLGHGAIV-YKIPKLVQSLKGVCIKEVSCGEETTICLSTNGEMFGCGSNYYGELGINSNETEMINQFEKITVTDPIDKSPVI-INQISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLHKCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYN-----KLGINIHAQGLSGSSQKNLCYDVPFETKFKIVAVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSYGQIGLGHTKTHKDVNKSSKVFAGKKIEKISCGDYFTIVSTTNNEIFGWG 2013
            FS    +  + ++R +GKGAYG AVLYR   D+SLV+ KEI++      E Q   NE+ +LS LDHPNIVAY++ F     + IEMEYA+ G+L+ +L   ++ L E  +L  FFQ++ A+ YIH+  I+HRD+KT+NIFLT   ++KIGDFGISK+L+   E AN+ +GTP Y+SPE+ QG  Y+ KSD+WA GC+LYE+    K FE SN  +L  KI+ G+F+ +    + +L +L+  LL   P  R S E +L H          +  + +T   +S+    +   + RS+      V+V     +N L   +   K    Q+ +G +H +VLT ++ ++TW    G  +  GQLGHG +V  K P+LV SL    +  ++CG + +I    NG +  CGS   G LG           F+ +     I+    I +  IS  + H   +   ED+++ WG  + G+LGL   +    P ++    H   +K  +   D T ++ +    L    NN        +LG  +  + LS     N  ++       K+ AV+R+  V+ VS G  HT VL    K+  FG NS GQ+G G TK +  +    K     KI K++ G  FT+     N ++ WG
Sbjct:   46 FSIQQTINGFEKIRTVGKGAYGTAVLYRKKDDDSLVILKEINMHDLSATERQLAMNEVKVLSQLDHPNIVAYFDSFEEDGVLMIEMEYADNGTLAQFLSNQEKPLEEKKILEMFFQIVSAIHYIHEHKILHRDLKTVNIFLTKEEIIKIGDFGISKMLSTTHEGANSVIGTPYYISPEMCQGKLYNEKSDVWALGCILYEMTCLHKTFEGSNLPALVNKILKGQFEPVKGSYSDELKELISSLLEKNPDDRLSTEVILHHK---------LPMMMKTFHTDSSDNVDTAKPQTRSV------VYVMDINTLN-LSPVRLPSKIRIKQICSGENHTIVLTTDRTVFTW----GSNEF-GQLGHGDLVDRKKPELVSSLTQKSLIRIACGNDFSIFGPENGIIMTCGSGISGSLG--------HGDFKDVLKPRLIESLLTIDVVCISATNSHVVVVSS-EDVIYGWGSNKNGQLGLDSLNLYCSPQVITFKEH-VLVKNAFTSEDATMLLTETGGLLASGNNNGNKLGLNARLGFLMTMKSLSQQPTINSVHEFT-----KVEAVMRHC-VNQVSMGKGHTTVLCESGKIIAFGINSSGQLGNGSTK-NSPIPCEVKTMKKHKITKVTSGSNFTVACVDFNSLYFWG 653          
The following BLAST results are available for this feature:
BLAST of NEK8-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NEK91.965e-17540.60NIMA related kinase 9 [Source:HGNC Symbol;Acc:HGNC... [more]
NEK86.407e-9932.18NIMA related kinase 8 [Source:HGNC Symbol;Acc:HGNC... [more]
NEK82.622e-5538.52NIMA related kinase 8 [Source:HGNC Symbol;Acc:HGNC... [more]
NEK55.855e-4940.55NIMA related kinase 5 [Source:HGNC Symbol;Acc:HGNC... [more]
NEK37.148e-4636.95NIMA related kinase 3 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of NEK8-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nekl-11.202e-8330.42NEK (NEver in mitosis Kinase) Like [Source:UniPro... [more]
nekl-12.390e-8330.42NEK (NEver in mitosis Kinase) Like [Source:UniPro... [more]
nekl-22.704e-4135.36Serine/threonine-protein kinase nekl-2 [Source:Un... [more]
nekl-31.995e-3433.59Serine/threonine-protein kinase nekl-3 [Source:Un... [more]
nekl-31.995e-3433.59Serine/threonine-protein kinase nekl-3 [Source:Un... [more]
back to top
BLAST of NEK8-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
niki2.878e-7530.65gene:FBgn0045980 transcript:FBtr0084737[more]
Nek22.885e-4035.29gene:FBgn0029970 transcript:FBtr0071142[more]
Sik29.722e-3131.80gene:FBgn0025625 transcript:FBtr0070340[more]
AMPKalpha2.621e-2831.75gene:FBgn0023169 transcript:FBtr0070216[more]
AMPKalpha2.621e-2831.75gene:FBgn0023169 transcript:FBtr0070217[more]
back to top
BLAST of NEK8-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nek81.141e-9932.60NIMA-related kinase 8 [Source:NCBI gene;Acc:171094... [more]
nek86.634e-9932.74NIMA-related kinase 8 [Source:NCBI gene;Acc:171094... [more]
nek14.106e-4839.13NIMA-related kinase 1 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
nek124.251e-4736.40NIMA-related kinase 12 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
nek124.251e-4736.40NIMA-related kinase 12 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of NEK8-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nek91.291e-17641.64NIMA-related kinase 9 [Source:NCBI gene;Acc:100216... [more]
nek93.471e-17641.64NIMA-related kinase 9 [Source:NCBI gene;Acc:100216... [more]
nek92.112e-16140.06NIMA-related kinase 9 [Source:NCBI gene;Acc:100216... [more]
nek97.717e-16140.06NIMA-related kinase 9 [Source:NCBI gene;Acc:100216... [more]
nek96.077e-15539.72NIMA-related kinase 9 [Source:NCBI gene;Acc:100216... [more]
back to top
BLAST of NEK8-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nek98.215e-16940.74NIMA (never in mitosis gene a)-related expressed k... [more]
Nek86.948e-8832.24NIMA (never in mitosis gene a)-related expressed k... [more]
Nek41.127e-4937.84NIMA (never in mitosis gene a)-related expressed k... [more]
Nek42.742e-4635.91NIMA (never in mitosis gene a)-related expressed k... [more]
Nek45.408e-4637.84NIMA (never in mitosis gene a)-related expressed k... [more]
back to top
BLAST of NEK8-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8TD19|NEK9_HUMAN9.438e-17540.60Serine/threonine-protein kinase Nek9 OS=Homo sapie... [more]
sp|Q7ZZC8|NEK9_XENLA6.578e-17441.22Serine/threonine-protein kinase Nek9 OS=Xenopus la... [more]
sp|Q8K1R7|NEK9_MOUSE5.746e-16840.74Serine/threonine-protein kinase Nek9 OS=Mus muscul... [more]
sp|Q86SG6|NEK8_HUMAN3.077e-9832.18Serine/threonine-protein kinase Nek8 OS=Homo sapie... [more]
sp|Q90XC2|NEK8_DANRE8.068e-9732.74Serine/threonine-protein kinase Nek8 OS=Danio reri... [more]
back to top
BLAST of NEK8-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YFE50.000e+0100.00NEK8-1 OS=Schmidtea mediterranea OX=79327 GN=NEK8-... [more]
A0A1I8HFL40.000e+043.04Protein kinase domain-containing protein OS=Macros... [more]
A0A267F6Z20.000e+043.04Protein kinase domain-containing protein OS=Macros... [more]
A0A267EN970.000e+043.04Protein kinase domain-containing protein OS=Macros... [more]
A0A1I8HNF10.000e+043.04Protein kinase domain-containing protein OS=Macros... [more]
back to top
BLAST of NEK8-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NEK90.000e+041.65NIMA related kinase 9 [Source:NCBI gene;Acc:103037... [more]
nek86.546e-10233.44NIMA related kinase 8 [Source:NCBI gene;Acc:103024... [more]
nek86.996e-10032.59NIMA related kinase 8 [Source:NCBI gene;Acc:103024... [more]
nek122.217e-4939.16serine/threonine-protein kinase Nek4-like [Source:... [more]
nek125.249e-4939.16serine/threonine-protein kinase Nek4-like [Source:... [more]
back to top
BLAST of NEK8-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NEK95.800e-17139.32NIMA related kinase 9 [Source:HGNC Symbol;Acc:HGNC... [more]
ENSPMAT00000001750.16.703e-8332.41pep scaffold:Pmarinus_7.0:GL481695:1137:12922:1 ge... [more]
ENSPMAT00000007414.18.974e-5238.78pep scaffold:Pmarinus_7.0:GL476981:230882:244405:1... [more]
ENSPMAT00000000555.11.093e-3645.45pep scaffold:Pmarinus_7.0:GL477093:35206:42652:1 g... [more]
nek29.908e-3638.05NIMA-related kinase 2 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
back to top
BLAST of NEK8-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
GIN47.766e-2933.02Protein kinase involved in bud growth and assembly... [more]
TPK32.297e-2729.36cAMP-dependent protein kinase catalytic subunit; p... [more]
SNF12.945e-2733.03AMP-activated S/T protein kinase; forms a complex ... [more]
TPK12.990e-2731.36cAMP-dependent protein kinase catalytic subunit; p... [more]
KCC41.071e-2633.49Protein kinase of the bud neck involved in the sep... [more]
back to top
BLAST of NEK8-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO356991.340e-15739.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461851.771e-10733.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498225.280e-5241.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO496905.109e-5138.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491381.038e-4940.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of NEK8-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NEK95.484e-17741.60NIMA related kinase 9 [Source:NCBI gene;Acc:101166... [more]
nek81.361e-9132.24NIMA related kinase 8 [Source:NCBI gene;Acc:101161... [more]
nek82.965e-8632.11NIMA related kinase 8 [Source:NCBI gene;Acc:101161... [more]
nek41.517e-4638.76NIMA related kinase 4 [Source:NCBI gene;Acc:101169... [more]
ENSORLT00000000545.23.705e-4639.68pep primary_assembly:ASM223467v1:4:1040495:1044496... [more]
back to top
BLAST of NEK8-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000053193.10.000e+099.48SMESG000053193.1[more]
SMESG000043302.13.947e-9134.37SMESG000043302.1[more]
SMESG000043302.14.083e-9134.37SMESG000043302.1[more]
SMESG000043302.14.204e-9134.37SMESG000043302.1[more]
SMESG000043302.14.217e-9134.37SMESG000043302.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30003066
GenBankAKN21710.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003066 ID=SMED30003066|Name=NEK8-1|organism=Schmidtea mediterranea sexual|type=transcript|length=2522bp
TTGGCTGTTACTTTGTTAATAAAAATTGATTGATTCCATTGAATCAATTG
CATGTTGAAATGAATAATGGATAATTGTAGAGACAATGAAGTTTTGTCGA
ATAGAGATTTTTCAACTAACCTCAATGTCGTTTCATATGTTCAAGTACGA
GTTCTAGGAAAAGGTGCTTATGGTAAAGCTGTTCTCTACAGGAATGCCGT
TGATAATTCATTAGTGGTTTGGAAAGAAATCGATATTGATAAAAATAAAA
TCAATGAAATCCAAAATGAAATCGATATTCTATCAATTTTGGATCATCCA
AACATTGTGGCATATTACAATCATTTTGTATACATCGACACCGTTTTCAT
AGAAATGGAATACGCAAATGCTGGCTCATTATCTAATTATCTACGACAAT
TGAAGGAAGATTTATCAGAATCTTGCGTATTGTGGTATTTCTTCCAATTG
ATATATGCTTTAGATTATATCCATAAATTGCACATTATTCACAGAGACAT
TAAGACGCTCAACATTTTCCTGACGACCTCTACTCTTTTGAAAATTGGAG
ATTTTGGCATTTCAAAAGTATTAAATGAGGATGAATTTGCAAACACTCAG
GTCGGAACTCCAGTTTATATGAGTCCAGAAGTAATTCAAGGGTTACCATA
TAGTTCCAAAAGTGACATTTGGGCCAGTGGCTGCGTTCTTTATGAAATTA
TTTCAAGAAAAAAGTTATTTGAATATTCCAATCATTTATCATTGGCTATG
AAAATAATTAATGGTGAATTTCAAACAATGCCTAACTGTAACAATTCGGA
TCTTTTGGATTTACTTCAGAGATTGCTTTTAAATGAACCAACAAAACGAC
CTTCAGCGGAAGATGTTTTAAAACACCCAGTTTGGAAAGGAAATTGTCAA
AGCATGATTGATCAAGTTCATAGAACAAACCAAGCAAATTCTAACTCCAG
ACCATGTTCAGGGGATCGAAAAGAAAGATCAATAGTTTCACTGAATTCCG
AAGTTTTTGTCTGGGGTGGTGGCAAAATAAATGCCTTGAAAATTGAGCAA
TTTCAAGAAAAAGATAGTGCCTTACAAGTAGCGGCAGGAGGTTCTCATTT
TGTTGTTTTGACGGCAGAAAAAGATCTATATACTTGGTCAAACATACAAG
GAGATAAAAAGCTATCGGGTCAATTGGGACATGGGGCTATTGTCTACAAA
ATCCCCAAACTTGTACAAAGTTTGAAAGGTGTTTGCATAAAAGAAGTCTC
TTGTGGAGAAGAAACTACAATTTGTTTGTCGACAAACGGAGAAATGTTTG
GCTGTGGCTCAAATTATTACGGCGAATTAGGGATAAATTCAAATGAAACA
GAAATGATCAACCAATTTGAAAAAATTACAGTAACAGATCCCATTGATAA
ATCTCCTGTCATTATCAATCAAATCAGTTGTGGTCATCATCATGCTGCTG
CTATCGGTGGTTGTGAGGATTTATTATTCACTTGGGGTTGCGGAGAATAT
GGCAGGCTCGGATTAGGACACGAGGATAATATTTACAAACCAACTCTAGT
AGATATACCATTACACAAGTGTAAATTGAAGCTTGTTTATTGCGGGTATG
ATACAACTTTCATTGTTCATAAATGCAGTGATAGGTTACTTGGTTGTGGA
AATAATCAGTACAATAAACTTGGCATCAACATACATGCTCAAGGTTTGTC
TGGATCTTCCCAAAAAAATCTATGCTATGATGTTCCATTTGAAACCAAAT
TTAAAATTGTAGCTGTACTTCGAAACGTGAAAGTTTCAACTGTTAGTTGT
GGAAATAGCCATACTGCGGTTTTAGATATATATAATAAACTGTACATTTT
TGGTGACAATAGCTACGGTCAAATCGGATTGGGGCACACAAAAACTCATA
AAGATGTCAATAAAAGTTCGAAAGTGTTCGCTGGTAAAAAGATTGAAAAA
ATATCCTGTGGCGATTATTTTACGATAGTTAGTACGACAAATAATGAAAT
ATTTGGTTGGGGAAGAGCAGATAGTGGGAGACTAGGGTTGGAAATTACTG
TTGACCAAAGGTGTGTTTTACATCCAAGAGCTTTATTTGGAACCCTTCAA
AAATGTGCCGATATTCAAAGTTTTGGATGGCAAACTATAATGATTACCGA
AAGAATCTTGGAAACAAGTACAATATCTGCCAATAGCACAGCAATTATGG
ACAAACTATCTCTTAAAAATGTTAATTCATTTGAAACTGAATACGATAAA
GATGGTTCAGGTGACATTCAAACTTGGCTGCGTAAAGAATTGCAAGAGGA
TGTAATCTACATGGATCAAGTTTCTGTAAATTTACACTCAATAAATGTGA
ATAGCTATAGTAGTAACAATTCTAATGAGTTATATTCGTGCGAATGTGGA
TGCCAAAAATGTCAAAATTATATTAAATTTCTTGAAAATAGAATAAGACT
TTTATGTGATAAAAATATTTTACAATAATACTGGAAGTTTAATGTTGTTT
ATTTTTGAAAATTGAAAAACAG
back to top

protein sequence of SMED30003066-orf-1

>SMED30003066-orf-1 ID=SMED30003066-orf-1|Name=SMED30003066-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=804bp
MDNCRDNEVLSNRDFSTNLNVVSYVQVRVLGKGAYGKAVLYRNAVDNSLV
VWKEIDIDKNKINEIQNEIDILSILDHPNIVAYYNHFVYIDTVFIEMEYA
NAGSLSNYLRQLKEDLSESCVLWYFFQLIYALDYIHKLHIIHRDIKTLNI
FLTTSTLLKIGDFGISKVLNEDEFANTQVGTPVYMSPEVIQGLPYSSKSD
IWASGCVLYEIISRKKLFEYSNHLSLAMKIINGEFQTMPNCNNSDLLDLL
QRLLLNEPTKRPSAEDVLKHPVWKGNCQSMIDQVHRTNQANSNSRPCSGD
RKERSIVSLNSEVFVWGGGKINALKIEQFQEKDSALQVAAGGSHFVVLTA
EKDLYTWSNIQGDKKLSGQLGHGAIVYKIPKLVQSLKGVCIKEVSCGEET
TICLSTNGEMFGCGSNYYGELGINSNETEMINQFEKITVTDPIDKSPVII
NQISCGHHHAAAIGGCEDLLFTWGCGEYGRLGLGHEDNIYKPTLVDIPLH
KCKLKLVYCGYDTTFIVHKCSDRLLGCGNNQYNKLGINIHAQGLSGSSQK
NLCYDVPFETKFKIVAVLRNVKVSTVSCGNSHTAVLDIYNKLYIFGDNSY
GQIGLGHTKTHKDVNKSSKVFAGKKIEKISCGDYFTIVSTTNNEIFGWGR
ADSGRLGLEITVDQRCVLHPRALFGTLQKCADIQSFGWQTIMITERILET
STISANSTAIMDKLSLKNVNSFETEYDKDGSGDIQTWLRKELQEDVIYMD
QVSVNLHSINVNSYSSNNSNELYSCECGCQKCQNYIKFLENRIRLLCDKN
ILQ*
back to top
Aliases
The feature 'NEK8-1' has the following synonyms
Synonym
NEK8-1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000408Reg_chr_condens
IPR000719Prot_kinase_dom
IPR009091RCC1/BLIP-II
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
GO:0019901protein kinase binding
GO:0046872metal ion binding
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0007067mitotic nuclear division
GO:0007077mitotic nuclear envelope disassembly
GO:0016310phosphorylation
GO:0051301cell division
GO:0007049cell cycle
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005829cytosol