Tyrosine-protein kinase

Overview
NameTyrosine-protein kinase
Smed IDSMED30003048
Length (bp)2905
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tyrosine-protein kinase (SMED30003048) t-SNE clustered cells

Violin plots show distribution of expression levels for Tyrosine-protein kinase (SMED30003048) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tyrosine-protein kinase (SMED30003048) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tyrosine-protein kinase (SMED30003048) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Match: SYK (spleen associated tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:11491])

HSP 1 Score: 276.944 bits (707), Expect = 4.716e-81
Identity = 118/224 (52.68%), Postives = 170/224 (75.89%), Query Frame = 2
Query: 1646 MLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTM 2317
            +LK E +      E++ EA  M QL + +IVR+IG+C+ E  +L++E+A LGP+NKYL++N+ + ++++IEL+ QVS GM YLE S FVHRDLAARNVLLV +HYAKISDFG+SKAL   ++YY+A   GKWP+KWYAPECI Y++F SKSDVWS+G+ +WE FSYG++PY+ +KG+++ +ML++G+R+  P  CP  +YD+M  CW+ D   RP FA + + +
Sbjct:  380 ILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRL 603          

HSP 2 Score: 126.716 bits (317), Expect = 1.945e-29
Identity = 79/246 (32.11%), Postives = 130/246 (52.85%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLRESVN--GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGVKSSFFED----CIKKKALEMGFKDSSSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFXXXXXXXXXXXNAGHTEGQFLVRQRKGDCGFVLSISVQNQPKHYKI-INKFDKLHIEGGQYFDSLIELIDHYYFRQDGLL 799
            +F G ITR+ AED L+  G  +G++LLR+S N  G + +S+ H  K +HY IE++ +GT+ I  GR    P +L  +H    DG + L + P  R P G         K+  FED     I++   +       ++E+ +    +  L+ ++    H   PWFH  + R E+E+ +     T G+FL+R R  +  + L +  + +  HY+I  +K  KL I  G+ FD+L +L++HY ++ DGLL
Sbjct:   15 FFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRKAHHYTIERELNGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNR-PQGVQ------PKTGPFEDLKENLIREYVKQTWNLQGQALEQAIIS-QKPQLEKLIATTAHEKMPWFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQLVEHYSYKADGLL 252          

HSP 3 Score: 68.9366 bits (167), Expect = 3.194e-11
Identity = 34/94 (36.17%), Postives = 53/94 (56.38%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLR-ESVNGNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLER 361
            +FHGKI+R+ +E +++      G FL+R    NG+Y + + H  KV HY I+K   G   I  G+KF    +LVEH+    DG L +  +P ++
Sbjct:  168 WFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQLVEHYSYKADGLLRVLTVPCQK 261          
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Match: SYK (spleen associated tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:11491])

HSP 1 Score: 276.944 bits (707), Expect = 4.716e-81
Identity = 118/224 (52.68%), Postives = 170/224 (75.89%), Query Frame = 2
Query: 1646 MLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTM 2317
            +LK E +      E++ EA  M QL + +IVR+IG+C+ E  +L++E+A LGP+NKYL++N+ + ++++IEL+ QVS GM YLE S FVHRDLAARNVLLV +HYAKISDFG+SKAL   ++YY+A   GKWP+KWYAPECI Y++F SKSDVWS+G+ +WE FSYG++PY+ +KG+++ +ML++G+R+  P  CP  +YD+M  CW+ D   RP FA + + +
Sbjct:  380 ILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRL 603          

HSP 2 Score: 126.716 bits (317), Expect = 1.945e-29
Identity = 79/246 (32.11%), Postives = 130/246 (52.85%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLRESVN--GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGVKSSFFED----CIKKKALEMGFKDSSSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFXXXXXXXXXXXNAGHTEGQFLVRQRKGDCGFVLSISVQNQPKHYKI-INKFDKLHIEGGQYFDSLIELIDHYYFRQDGLL 799
            +F G ITR+ AED L+  G  +G++LLR+S N  G + +S+ H  K +HY IE++ +GT+ I  GR    P +L  +H    DG + L + P  R P G         K+  FED     I++   +       ++E+ +    +  L+ ++    H   PWFH  + R E+E+ +     T G+FL+R R  +  + L +  + +  HY+I  +K  KL I  G+ FD+L +L++HY ++ DGLL
Sbjct:   15 FFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRKAHHYTIERELNGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNR-PQGVQ------PKTGPFEDLKENLIREYVKQTWNLQGQALEQAIIS-QKPQLEKLIATTAHEKMPWFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQLVEHYSYKADGLL 252          

HSP 3 Score: 68.9366 bits (167), Expect = 3.194e-11
Identity = 34/94 (36.17%), Postives = 53/94 (56.38%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLR-ESVNGNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLER 361
            +FHGKI+R+ +E +++      G FL+R    NG+Y + + H  KV HY I+K   G   I  G+KF    +LVEH+    DG L +  +P ++
Sbjct:  168 WFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQLVEHYSYKADGLLRVLTVPCQK 261          
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Match: SYK (spleen associated tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:11491])

HSP 1 Score: 276.559 bits (706), Expect = 8.691e-81
Identity = 118/224 (52.68%), Postives = 170/224 (75.89%), Query Frame = 2
Query: 1646 MLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTM 2317
            +LK E +      E++ EA  M QL + +IVR+IG+C+ E  +L++E+A LGP+NKYL++N+ + ++++IEL+ QVS GM YLE S FVHRDLAARNVLLV +HYAKISDFG+SKAL   ++YY+A   GKWP+KWYAPECI Y++F SKSDVWS+G+ +WE FSYG++PY+ +KG+++ +ML++G+R+  P  CP  +YD+M  CW+ D   RP FA + + +
Sbjct:  403 ILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRL 626          

HSP 2 Score: 126.716 bits (317), Expect = 2.202e-29
Identity = 79/246 (32.11%), Postives = 130/246 (52.85%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLRESVN--GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGVKSSFFED----CIKKKALEMGFKDSSSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFXXXXXXXXXXXNAGHTEGQFLVRQRKGDCGFVLSISVQNQPKHYKI-INKFDKLHIEGGQYFDSLIELIDHYYFRQDGLL 799
            +F G ITR+ AED L+  G  +G++LLR+S N  G + +S+ H  K +HY IE++ +GT+ I  GR    P +L  +H    DG + L + P  R P G         K+  FED     I++   +       ++E+ +    +  L+ ++    H   PWFH  + R E+E+ +     T G+FL+R R  +  + L +  + +  HY+I  +K  KL I  G+ FD+L +L++HY ++ DGLL
Sbjct:   15 FFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRKAHHYTIERELNGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNR-PQGVQ------PKTGPFEDLKENLIREYVKQTWNLQGQALEQAIIS-QKPQLEKLIATTAHEKMPWFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQLVEHYSYKADGLL 252          

HSP 3 Score: 68.9366 bits (167), Expect = 3.208e-11
Identity = 34/94 (36.17%), Postives = 53/94 (56.38%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLR-ESVNGNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLER 361
            +FHGKI+R+ +E +++      G FL+R    NG+Y + + H  KV HY I+K   G   I  G+KF    +LVEH+    DG L +  +P ++
Sbjct:  168 WFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQLVEHYSYKADGLLRVLTVPCQK 261          
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Match: SYK (spleen associated tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:11491])

HSP 1 Score: 276.559 bits (706), Expect = 8.691e-81
Identity = 118/224 (52.68%), Postives = 170/224 (75.89%), Query Frame = 2
Query: 1646 MLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTM 2317
            +LK E +      E++ EA  M QL + +IVR+IG+C+ E  +L++E+A LGP+NKYL++N+ + ++++IEL+ QVS GM YLE S FVHRDLAARNVLLV +HYAKISDFG+SKAL   ++YY+A   GKWP+KWYAPECI Y++F SKSDVWS+G+ +WE FSYG++PY+ +KG+++ +ML++G+R+  P  CP  +YD+M  CW+ D   RP FA + + +
Sbjct:  403 ILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRL 626          

HSP 2 Score: 126.716 bits (317), Expect = 2.202e-29
Identity = 79/246 (32.11%), Postives = 130/246 (52.85%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLRESVN--GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGVKSSFFED----CIKKKALEMGFKDSSSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFXXXXXXXXXXXNAGHTEGQFLVRQRKGDCGFVLSISVQNQPKHYKI-INKFDKLHIEGGQYFDSLIELIDHYYFRQDGLL 799
            +F G ITR+ AED L+  G  +G++LLR+S N  G + +S+ H  K +HY IE++ +GT+ I  GR    P +L  +H    DG + L + P  R P G         K+  FED     I++   +       ++E+ +    +  L+ ++    H   PWFH  + R E+E+ +     T G+FL+R R  +  + L +  + +  HY+I  +K  KL I  G+ FD+L +L++HY ++ DGLL
Sbjct:   15 FFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRKAHHYTIERELNGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNR-PQGVQ------PKTGPFEDLKENLIREYVKQTWNLQGQALEQAIIS-QKPQLEKLIATTAHEKMPWFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQLVEHYSYKADGLL 252          

HSP 3 Score: 68.9366 bits (167), Expect = 3.208e-11
Identity = 34/94 (36.17%), Postives = 53/94 (56.38%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLR-ESVNGNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLER 361
            +FHGKI+R+ +E +++      G FL+R    NG+Y + + H  KV HY I+K   G   I  G+KF    +LVEH+    DG L +  +P ++
Sbjct:  168 WFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQLVEHYSYKADGLLRVLTVPCQK 261          
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Match: ZAP70 (zeta chain of T cell receptor associated protein kinase 70 [Source:HGNC Symbol;Acc:HGNC:12858])

HSP 1 Score: 256.144 bits (653), Expect = 4.441e-77
Identity = 120/242 (49.59%), Postives = 167/242 (69.01%), Query Frame = 2
Query: 1628 IPVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYL-RRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTMSRIQVGLSTGI 2350
            I VA+K+LK+    K    E+M EA+ M QL + +IVRLIGVC+ E ++L++E+A  GP++K+L  + + +   ++ EL+ QVS GM YLE   FVHRDLAARNVLLVN HYAKISDFG+SKAL     YY A +AGKWPLKWYAPECI + +F S+SDVWSYG+T+WE  SYG++PYK +KG ++++ ++QG+R++ P  CP  +Y +M  CW      RP F  +   M      L++ +
Sbjct:   57 IDVAIKVLKQGTE-KADTEEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGGPLHKFLVGKREEIPVSNVAELLHQVSMGMKYLEEKNFVHRDLAARNVLLVNRHYAKISDFGLSKALGADDSYYTARSAGKWPLKWYAPECINFRKFSSRSDVWSYGVTMWEALSYGQKPYKKMKGPEVMAFIEQGKRMECPPECPPELYALMSDCWIYKWEDRPDFLTVEQRMRACYYSLASKV 297          
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Match: ark-1 (Ack-related non-receptor tyrosine kinase [Source:UniProtKB/Swiss-Prot;Acc:G5EBZ8])

HSP 1 Score: 202.216 bits (513), Expect = 3.860e-53
Identity = 95/214 (44.39%), Postives = 142/214 (66.36%), Query Frame = 2
Query: 1688 IMEEARTMSQLRHKHIVRLIGVC-KCEQILLILELAPLGPINKYLRR---NQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAG--KWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQR-LKKPINCPESIYDVMLQCWSTDGVRRPTFAELV 2308
             ++EA  M+++RH+H+VRL GV    ++I+L+ ELA  G + + L +     S     L +   Q++ GM+YLE  + +HRDLAARNVL+ +    KISDFG+S++L  G+DYYR+      K P+ W APECI + +F SKSDVW+YG+T+WE+FSYGE P+K   G QIL ++D+ +  L +P  CPE IYD++ + W+     RPTF+++V
Sbjct:  160 FLQEAAIMTRMRHEHVVRLYGVVLDTKKIMLVSELATCGSLLECLHKPALRDSFPVHVLCDYAEQIAMGMSYLELQRLIHRDLAARNVLVFSPKLVKISDFGLSRSLGIGEDYYRSEFTPNLKLPIAWCAPECINFLKFTSKSDVWAYGVTIWEMFSYGEMPWKGRSGAQILELVDRKKELLTRPKACPEDIYDMLKETWTHQVQDRPTFSDIV 373          
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Match: ark-1 (Ack-related non-receptor tyrosine kinase [Source:UniProtKB/Swiss-Prot;Acc:G5EBZ8])

HSP 1 Score: 201.83 bits (512), Expect = 4.390e-53
Identity = 95/214 (44.39%), Postives = 142/214 (66.36%), Query Frame = 2
Query: 1688 IMEEARTMSQLRHKHIVRLIGVC-KCEQILLILELAPLGPINKYLRR---NQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAG--KWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQR-LKKPINCPESIYDVMLQCWSTDGVRRPTFAELV 2308
             ++EA  M+++RH+H+VRL GV    ++I+L+ ELA  G + + L +     S     L +   Q++ GM+YLE  + +HRDLAARNVL+ +    KISDFG+S++L  G+DYYR+      K P+ W APECI + +F SKSDVW+YG+T+WE+FSYGE P+K   G QIL ++D+ +  L +P  CPE IYD++ + W+     RPTF+++V
Sbjct:  160 FLQEAAIMTRMRHEHVVRLYGVVLDTKKIMLVSELATCGSLLECLHKPALRDSFPVHVLCDYAEQIAMGMSYLELQRLIHRDLAARNVLVFSPKLVKISDFGLSRSLGIGEDYYRSEFTPNLKLPIAWCAPECINFLKFTSKSDVWAYGVTIWEMFSYGEMPWKGRSGAQILELVDRKKELLTRPKACPEDIYDMLKETWTHQVQDRPTFSDIV 373          
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Match: src-2 (Tyrosine protein-kinase src-2 [Source:UniProtKB/Swiss-Prot;Acc:O45539])

HSP 1 Score: 187.193 bits (474), Expect = 1.254e-50
Identity = 93/227 (40.97%), Postives = 136/227 (59.91%), Query Frame = 2
Query: 1628 IPVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVC-KCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAEL 2305
            +PVAVK LK          + + EA+ M +LRH  ++ L  VC + E IL++ EL     +    RR +      L+E+ +QV+ GMAYLE   F+HRDLAARN+L+ N    KI+DFG+++ L   ++ Y A    ++P+KW APE   Y RF +KSDVWS+GI L E+ ++G  PY  +   ++L  +D G R+  P  CP ++YD+M QCW +D  +RPTF  L
Sbjct:  263 VPVAVKKLKA---GTADPTDFLAEAQIMKKLRHPKLLSLYAVCTRDEPILIVTELMQENLLTFLQRRGRQCQMPQLVEISAQVAAGMAYLEEMNFIHRDLAARNILINNSLSVKIADFGLARIL-MKENEYEARTGARFPIKWTAPEAANYNRFTTKSDVWSFGILLTEIVTFGRLPYPGMTNAEVLQQVDAGYRMPCPAGCPVTLYDIMQQCWRSDPDKRPTFETL 485          
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Match: abl-1 (Tyrosine-protein kinase abl-1 [Source:UniProtKB/Swiss-Prot;Acc:P03949])

HSP 1 Score: 193.356 bits (490), Expect = 3.754e-50
Identity = 94/234 (40.17%), Postives = 143/234 (61.11%), Query Frame = 2
Query: 1634 VAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQ-ILLILELAPLGPINKYLRRNQS--LSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTMSRI 2326
            +AVK LK++    +  HE + EA  M  L HK++VRL+GVC  E    +I E    G + +YLRR     L    L+++ SQ++ GM+YLEA  F+HRDLAARN L+   +  KI+DFG+++ +   +D Y A A  K+P+KW APE + +  F SKSDVW++G+ LWE+ +YG  PY  ++ + +  +L+ G R+  P  CP S+Y +MLQCW+     RP F ++   +  +
Sbjct:  337 IAVKALKEDA---MPLHEFLAEAAIMKDLHHKNLVRLLGVCTHEAPFYIITEFMCNGNLLEYLRRTDKSLLPPIILVQMASQIASGMSYLEARHFIHRDLAARNCLVSEHNIVKIADFGLARFMK--EDTYTAHAGAKFPIKWTAPEGLAFNTFSSKSDVWAFGVLLWEIATYGMAPYPGVELSNVYGLLENGFRMDGPQGCPPSVYRLMLQCWNWSPSDRPRFRDIHFNLENL 565          

HSP 2 Score: 61.6178 bits (148), Expect = 2.869e-9
Identity = 42/115 (36.52%), Postives = 57/115 (49.57%), Query Frame = 2
Query:   65 SPFNIL----YFHGKITRDRAEDLLMSQGAIEGMFLLRESVN--GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYIL 391
            +P+N L    ++HGKI+R  +E +L S   I G FL+RES    G Y IS+ H  +V HY I   +     I    KF    ELV HH +H DG + L   P  +   G   + L
Sbjct:  184 APYNSLDKYTWYHGKISRSDSEAILGS--GITGSFLVRESETSIGQYTISVRHDGRVFHYRINVDNTEKMFITQEVKFRTLGELVHHHSVHADGLICLLMYPASKKDKGRGLFSL 296          
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Match: abl-1 (Tyrosine-protein kinase abl-1 [Source:UniProtKB/Swiss-Prot;Acc:P03949])

HSP 1 Score: 193.356 bits (490), Expect = 4.187e-50
Identity = 94/234 (40.17%), Postives = 143/234 (61.11%), Query Frame = 2
Query: 1634 VAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQ-ILLILELAPLGPINKYLRRNQS--LSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTMSRI 2326
            +AVK LK++    +  HE + EA  M  L HK++VRL+GVC  E    +I E    G + +YLRR     L    L+++ SQ++ GM+YLEA  F+HRDLAARN L+   +  KI+DFG+++ +   +D Y A A  K+P+KW APE + +  F SKSDVW++G+ LWE+ +YG  PY  ++ + +  +L+ G R+  P  CP S+Y +MLQCW+     RP F ++   +  +
Sbjct:  327 IAVKALKEDA---MPLHEFLAEAAIMKDLHHKNLVRLLGVCTHEAPFYIITEFMCNGNLLEYLRRTDKSLLPPIILVQMASQIASGMSYLEARHFIHRDLAARNCLVSEHNIVKIADFGLARFMK--EDTYTAHAGAKFPIKWTAPEGLAFNTFSSKSDVWAFGVLLWEIATYGMAPYPGVELSNVYGLLENGFRMDGPQGCPPSVYRLMLQCWNWSPSDRPRFRDIHFNLENL 555          

HSP 2 Score: 61.6178 bits (148), Expect = 2.721e-9
Identity = 42/115 (36.52%), Postives = 57/115 (49.57%), Query Frame = 2
Query:   65 SPFNIL----YFHGKITRDRAEDLLMSQGAIEGMFLLRESVN--GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYIL 391
            +P+N L    ++HGKI+R  +E +L S   I G FL+RES    G Y IS+ H  +V HY I   +     I    KF    ELV HH +H DG + L   P  +   G   + L
Sbjct:  174 APYNSLDKYTWYHGKISRSDSEAILGS--GITGSFLVRESETSIGQYTISVRHDGRVFHYRINVDNTEKMFITQEVKFRTLGELVHHHSVHADGLICLLMYPASKKDKGRGLFSL 286          
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Match: Shark (gene:FBgn0015295 transcript:FBtr0087244)

HSP 1 Score: 213.001 bits (541), Expect = 9.025e-57
Identity = 104/232 (44.83%), Postives = 143/232 (61.64%), Query Frame = 2
Query: 1634 VAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKY-LRRNQSLSEQSLIEL-MSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTMSR 2323
            VA+KML  E  +K    E + EA  M +L HK IVRLIG+ K E ++++ ELAPLG + +Y L     ++  + +++  SQ++ GM YLE+  FVHRDLAARN+LL   H AKISDFGMS++L  G   Y+    G+WP++WYAPE      F   SDVWS+G+T+WE+FS G  PY ++     + ++D G+RL +P  CP  IY VM  CW      RPTF  L    +R
Sbjct:  695 VAIKMLSDEHSNK---QEFLREASVMMRLEHKCIVRLIGIAKGEMLMMVQELAPLGSMLQYILDHGHEITANAELKVWASQIACGMHYLESQHFVHRDLAARNILLTARHQAKISDFGMSRSLRPGSTEYQFTQGGRWPIRWYAPESFNLGIFSHASDVWSFGVTIWEMFSLGAPPYGEISNVDAIKLVDSGERLPQPNLCPAYIYAVMQSCWKERPKDRPTFVYLTEFFAR 923          
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Match: Src42A (gene:FBgn0264959 transcript:FBtr0335275)

HSP 1 Score: 195.282 bits (495), Expect = 3.592e-53
Identity = 94/232 (40.52%), Postives = 148/232 (63.79%), Query Frame = 2
Query: 1625 TIPVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQ-ILLILELAPLGPINKYLR----RNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAEL 2305
            T PVA+K LK      +   + + EA+ M +LRH  +++L  VC  E+ I +I EL   G + +YL+    + +SL  Q+LI++ +Q++ GMAYLE+  ++HRDLAARNVL+ + +  KI+DFG+++ +   +D Y A    ++P+KW APE   Y +F  KSDVWS+GI L E+ +YG  PY  +   ++L+ ++ G R+ +P NC   +Y++ML+CW  D +RRPTF  L
Sbjct:  270 TTPVAIKTLKS---GTMDPKDFLAEAQIMKKLRHTKLIQLYAVCTVEEPIYIITELMKHGSLLEYLQAIAGKGRSLKMQTLIDMAAQIAAGMAYLESQNYIHRDLAARNVLVGDGNIVKIADFGLARLIK--EDEYEARVGARFPIKWTAPEAANYSKFSIKSDVWSFGILLTELVTYGRIPYPGMTNAEVLTQVEHGYRMPQPPNCEPRLYEIMLECWHKDPMRRPTFETL 496          
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Match: Src42A (gene:FBgn0264959 transcript:FBtr0335276)

HSP 1 Score: 199.134 bits (505), Expect = 8.851e-52
Identity = 94/232 (40.52%), Postives = 148/232 (63.79%), Query Frame = 2
Query: 1625 TIPVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQ-ILLILELAPLGPINKYLR----RNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAEL 2305
            T PVA+K LK      +   + + EA+ M +LRH  +++L  VC  E+ I +I EL   G + +YL+    + +SL  Q+LI++ +Q++ GMAYLE+  ++HRDLAARNVL+ + +  KI+DFG+++ +   +D Y A    ++P+KW APE   Y +F  KSDVWS+GI L E+ +YG  PY  +   ++L+ ++ G R+ +P NC   +Y++ML+CW  D +RRPTF  L
Sbjct: 1350 TTPVAIKTLKS---GTMDPKDFLAEAQIMKKLRHTKLIQLYAVCTVEEPIYIITELMKHGSLLEYLQAIAGKGRSLKMQTLIDMAAQIAAGMAYLESQNYIHRDLAARNVLVGDGNIVKIADFGLARLIK--EDEYEARVGARFPIKWTAPEAANYSKFSIKSDVWSFGILLTELVTYGRIPYPGMTNAEVLTQVEHGYRMPQPPNCEPRLYEIMLECWHKDPMRRPTFETL 1576          
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Match: Ack-like (gene:FBgn0263998 transcript:FBtr0330329)

HSP 1 Score: 196.438 bits (498), Expect = 6.015e-51
Identity = 104/241 (43.15%), Postives = 147/241 (61.00%), Query Frame = 2
Query: 1613 NLLETIPVAVKMLKKE-MHSKIGAHEIMEEARTMSQLRHKHIVRLIGVC-KCEQILLILELAPLGPINKYLR----RNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAA--AAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQG--QRLKKPINCPESIYDVMLQCWSTDGVRRPTFAEL 2305
            N  E I VA+K L +E M S     E ++EA  M  + H++IVRL GV    + ++L+ ELA L  + + L+    R   L+  +L E   Q+  GM YLE  + +HRDLAARN+L+ ++   KISDFG+S+AL  G+DYY+       K P+ W APECI Y RF + SDVW++G+ LWE+FSYG +P+  L G QIL  +D    QRL++P  CP   Y +M++CW  D  +RP F E+
Sbjct:  154 NGNERIQVAIKCLCRERMQSN--PMEFLKEAAIMHSIEHENIVRLYGVVLATDSLMLVTELAHLRSLLECLKDSGLRVSFLTIPTLCEFALQICNGMRYLEQKRLIHRDLAARNILVFSKDKVKISDFGLSRALGVGKDYYKTNFNVNLKLPIAWCAPECINYLRFTNASDVWAFGVCLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPDCCPSEYYTLMMKCWQDDAAKRPRFGEI 392          
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Match: Ack-like (gene:FBgn0263998 transcript:FBtr0330331)

HSP 1 Score: 196.438 bits (498), Expect = 6.074e-51
Identity = 104/241 (43.15%), Postives = 147/241 (61.00%), Query Frame = 2
Query: 1613 NLLETIPVAVKMLKKE-MHSKIGAHEIMEEARTMSQLRHKHIVRLIGVC-KCEQILLILELAPLGPINKYLR----RNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAA--AAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQG--QRLKKPINCPESIYDVMLQCWSTDGVRRPTFAEL 2305
            N  E I VA+K L +E M S     E ++EA  M  + H++IVRL GV    + ++L+ ELA L  + + L+    R   L+  +L E   Q+  GM YLE  + +HRDLAARN+L+ ++   KISDFG+S+AL  G+DYY+       K P+ W APECI Y RF + SDVW++G+ LWE+FSYG +P+  L G QIL  +D    QRL++P  CP   Y +M++CW  D  +RP F E+
Sbjct:  154 NGNERIQVAIKCLCRERMQSN--PMEFLKEAAIMHSIEHENIVRLYGVVLATDSLMLVTELAHLRSLLECLKDSGLRVSFLTIPTLCEFALQICNGMRYLEQKRLIHRDLAARNILVFSKDKVKISDFGLSRALGVGKDYYKTNFNVNLKLPIAWCAPECINYLRFTNASDVWAFGVCLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLEQPDCCPSEYYTLMMKCWQDDAAKRPRFGEI 392          
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Match: syk (spleen tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-040702-3])

HSP 1 Score: 276.944 bits (707), Expect = 1.559e-81
Identity = 118/222 (53.15%), Postives = 168/222 (75.68%), Query Frame = 2
Query: 1634 VAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFA 2299
            VAVK+LK +  +     E++ EA  M QL + +IVR+IG+C+ E ++L++ELA LGP++K+L++N+ ++ ++L EL+ QVS GM YLE   FVHRDLAARNVLLV +HYAKISDFG+SKAL   ++YY+A   GKWPLKWYAPEC+ Y +F SKSDVWS+G+ +WE FSYG++PYK +KG +++ M++ GQR+  P +CP  +YD+M +CW+     RP F+
Sbjct:  349 VAVKILKNDDDNAAVKDEMLREANVMQQLDNPYIVRMIGICEAENLMLVMELAELGPLHKFLQKNKHITVKNLTELVHQVSMGMKYLEEHNFVHRDLAARNVLLVTQHYAKISDFGLSKALTEDENYYKAKGHGKWPLKWYAPECMNYLKFSSKSDVWSFGVLMWEAFSYGQKPYKGMKGNEVIQMIENGQRMSAPPDCPPEMYDLMKKCWTYKPDERPGFS 570          

HSP 2 Score: 116.316 bits (290), Expect = 2.004e-26
Identity = 77/245 (31.43%), Postives = 131/245 (53.47%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLRESVN--GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGVKSSFFEDCIKKKALEMGFKDSSSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFXXXXXXXXXXXNAGHTEGQFLVRQRKG---DCGFVLSISVQNQPKHYKI-INKFDKLHIEGGQYFDSLIELIDHYYFRQDGLL 799
            YF G ITR+ +E  L   G+ +G++LLR+S +  G Y +S+ +  +  HY IE++ + T+ I  G+    PI+++ +H    DG + L + P  R P GT   +  G      E  I++   +      S++++ +    R  L+ ++    H   PWFH  + R ++E RL N     G+FL+RQR+    +  + L +   NQ  HY+I  ++  KL I  G+ FD+L +L++HY ++ DGLL
Sbjct:   10 YFFGNITREESEVYLQQGGSGDGLYLLRQSRSFLGGYALSLSYGRQFYHYTIERELNDTYAIAGGKSHRTPIDVINYHSQESDGLICLLKKPFHR-PRGTEPKV--GPFEDLKEQLIRQYVEQTWNLKGSALDQAIIS-QRPQLEKLIATTAHEKMPWFHGKIDREDSELRLLNTSRVNGKFLIRQRENSGRNESYALCLLHNNQVMHYRIDKDRAGKLSIPDGKKFDTLWQLVEHYSYKPDGLL 250          
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Match: syk (spleen tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-040702-3])

HSP 1 Score: 276.944 bits (707), Expect = 1.559e-81
Identity = 118/222 (53.15%), Postives = 168/222 (75.68%), Query Frame = 2
Query: 1634 VAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFA 2299
            VAVK+LK +  +     E++ EA  M QL + +IVR+IG+C+ E ++L++ELA LGP++K+L++N+ ++ ++L EL+ QVS GM YLE   FVHRDLAARNVLLV +HYAKISDFG+SKAL   ++YY+A   GKWPLKWYAPEC+ Y +F SKSDVWS+G+ +WE FSYG++PYK +KG +++ M++ GQR+  P +CP  +YD+M +CW+     RP F+
Sbjct:  349 VAVKILKNDDDNAAVKDEMLREANVMQQLDNPYIVRMIGICEAENLMLVMELAELGPLHKFLQKNKHITVKNLTELVHQVSMGMKYLEEHNFVHRDLAARNVLLVTQHYAKISDFGLSKALTEDENYYKAKGHGKWPLKWYAPECMNYLKFSSKSDVWSFGVLMWEAFSYGQKPYKGMKGNEVIQMIENGQRMSAPPDCPPEMYDLMKKCWTYKPDERPGFS 570          

HSP 2 Score: 116.316 bits (290), Expect = 2.004e-26
Identity = 77/245 (31.43%), Postives = 131/245 (53.47%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLRESVN--GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGVKSSFFEDCIKKKALEMGFKDSSSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFXXXXXXXXXXXNAGHTEGQFLVRQRKG---DCGFVLSISVQNQPKHYKI-INKFDKLHIEGGQYFDSLIELIDHYYFRQDGLL 799
            YF G ITR+ +E  L   G+ +G++LLR+S +  G Y +S+ +  +  HY IE++ + T+ I  G+    PI+++ +H    DG + L + P  R P GT   +  G      E  I++   +      S++++ +    R  L+ ++    H   PWFH  + R ++E RL N     G+FL+RQR+    +  + L +   NQ  HY+I  ++  KL I  G+ FD+L +L++HY ++ DGLL
Sbjct:   10 YFFGNITREESEVYLQQGGSGDGLYLLRQSRSFLGGYALSLSYGRQFYHYTIERELNDTYAIAGGKSHRTPIDVINYHSQESDGLICLLKKPFHR-PRGTEPKV--GPFEDLKEQLIRQYVEQTWNLKGSALDQAIIS-QRPQLEKLIATTAHEKMPWFHGKIDREDSELRLLNTSRVNGKFLIRQRENSGRNESYALCLLHNNQVMHYRIDKDRAGKLSIPDGKKFDTLWQLVEHYSYKPDGLL 250          
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Match: syk (spleen tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-040702-3])

HSP 1 Score: 276.944 bits (707), Expect = 2.645e-81
Identity = 118/222 (53.15%), Postives = 168/222 (75.68%), Query Frame = 2
Query: 1634 VAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFA 2299
            VAVK+LK +  +     E++ EA  M QL + +IVR+IG+C+ E ++L++ELA LGP++K+L++N+ ++ ++L EL+ QVS GM YLE   FVHRDLAARNVLLV +HYAKISDFG+SKAL   ++YY+A   GKWPLKWYAPEC+ Y +F SKSDVWS+G+ +WE FSYG++PYK +KG +++ M++ GQR+  P +CP  +YD+M +CW+     RP F+
Sbjct:  372 VAVKILKNDDDNAAVKDEMLREANVMQQLDNPYIVRMIGICEAENLMLVMELAELGPLHKFLQKNKHITVKNLTELVHQVSMGMKYLEEHNFVHRDLAARNVLLVTQHYAKISDFGLSKALTEDENYYKAKGHGKWPLKWYAPECMNYLKFSSKSDVWSFGVLMWEAFSYGQKPYKGMKGNEVIQMIENGQRMSAPPDCPPEMYDLMKKCWTYKPDERPGFS 593          

HSP 2 Score: 116.316 bits (290), Expect = 2.241e-26
Identity = 77/245 (31.43%), Postives = 131/245 (53.47%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLRESVN--GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGVKSSFFEDCIKKKALEMGFKDSSSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFXXXXXXXXXXXNAGHTEGQFLVRQRKG---DCGFVLSISVQNQPKHYKI-INKFDKLHIEGGQYFDSLIELIDHYYFRQDGLL 799
            YF G ITR+ +E  L   G+ +G++LLR+S +  G Y +S+ +  +  HY IE++ + T+ I  G+    PI+++ +H    DG + L + P  R P GT   +  G      E  I++   +      S++++ +    R  L+ ++    H   PWFH  + R ++E RL N     G+FL+RQR+    +  + L +   NQ  HY+I  ++  KL I  G+ FD+L +L++HY ++ DGLL
Sbjct:   10 YFFGNITREESEVYLQQGGSGDGLYLLRQSRSFLGGYALSLSYGRQFYHYTIERELNDTYAIAGGKSHRTPIDVINYHSQESDGLICLLKKPFHR-PRGTEPKV--GPFEDLKEQLIRQYVEQTWNLKGSALDQAIIS-QRPQLEKLIATTAHEKMPWFHGKIDREDSELRLLNTSRVNGKFLIRQRENSGRNESYALCLLHNNQVMHYRIDKDRAGKLSIPDGKKFDTLWQLVEHYSYKPDGLL 250          
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Match: zap70 (zeta chain of T cell receptor associated protein kinase 70 [Source:ZFIN;Acc:ZDB-GENE-050522-257])

HSP 1 Score: 264.618 bits (675), Expect = 7.324e-77
Identity = 123/258 (47.67%), Postives = 175/258 (67.83%), Query Frame = 2
Query: 1628 IPVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLR-RNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTMSRIQVGLSTGIHELAEQTNYLANSSGS 2398
            I VA+K+LK E    +   E+M EA  M QL    IVR+IG+C+ E ++L++E+AP GP+NK+L  +   ++ ++++ LM QVS GM YLE   FVHRDLAARNVLLVN+ YAKISDFG+SKAL    +YY+A   GKWPLKWYAPECI++ +F SKSDVWS+GIT+WE FS+G +PYK +KG ++++ ++ G RL  P  CPE++Y++M +CW+     R  FA++   M      ++  I       +YL   +G+
Sbjct:  351 IDVAIKVLKNENEKSV-RDEMMREAEIMHQLSDPFIVRMIGLCEAEALMLVMEMAPAGPLNKFLSGKKDQITTENIVMLMHQVSMGMKYLEGRNFVHRDLAARNVLLVNQQYAKISDFGLSKALGADDNYYKARTGGKWPLKWYAPECIHFHKFSSKSDVWSFGITMWEAFSFGGKPYKKMKGPEVITYIEGGSRLDCPAACPEAMYELMKECWTYKHEERLNFAKVEEKMRTFYYSIAKKI------PDYLKTENGT 601          

HSP 2 Score: 111.694 bits (278), Expect = 6.481e-25
Identity = 77/249 (30.92%), Postives = 131/249 (52.61%), Query Frame = 2
Query:   74 NILYFHGKITRDRAEDLLMSQGAIEGMFLLRESVN--GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGVKSSFFEDCIKKKALEMGFKDSSSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFXXXXXXXXXXXNAGHTEGQFLVRQRKGDCGFVLSISVQNQPKHYKII-NKFDKLHIEGGQYFDSLIELIDHYYFRQDGLLCKLR 811
            ++ +F+G I+R  AE+ L   G  +G+FLLR+ +   G YV+S+       HY+IEKQ +GT+ I  G+   GP EL E++    DG +   R P  R P      I +GV  +  ++ +++        +  ++E+ +     Q L+ ++    H   PWFH  + R E E RL +    +G+FLVR+R     F LS++      HY+I+ +K  K+ +  G  FD++ +L+++   + DGL+  LR
Sbjct:    7 DLPFFYGSISRSEAEEHLKLAGMGDGLFLLRQCLRSLGGYVLSMIWNLDFYHYSIEKQLNGTYCIAGGKPHCGPAELCEYYSKDPDGLVCTLRKPCLRSPETE---IRKGVFDNLRDNMLREYVRHTWKLEGDAMEQAIISQAPQ-LEKLIATTAHEKMPWFHGKIPRQEGERRLYSGSQPDGKFLVRERDEMGTFALSVTYGKTVYHYQILRDKSGKIAMPEGTKFDTVWQLVEYLKMKPDGLVTVLR 251          

HSP 3 Score: 57.3806 bits (137), Expect = 7.999e-8
Identity = 32/91 (35.16%), Postives = 46/91 (50.55%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLRESVN-GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLP 352
            +FHGKI R   E  L S    +G FL+RE    G + +S+ +   V HY I +   G   +  G KF    +LVE+  +  DG +T+ R P
Sbjct:  163 WFHGKIPRQEGERRLYSGSQPDGKFLVRERDEMGTFALSVTYGKTVYHYQILRDKSGKIAMPEGTKFDTVWQLVEYLKMKPDGLVTVLREP 253          
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Match: si:ch73-383l1.1 (si:ch73-383l1.1 [Source:ZFIN;Acc:ZDB-GENE-121214-64])

HSP 1 Score: 205.297 bits (521), Expect = 3.720e-55
Identity = 98/234 (41.88%), Postives = 149/234 (63.68%), Query Frame = 2
Query: 1628 IPVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQ-SLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTMSRI 2326
            IPVA+K+L +    K    E M+EA  M+ + H H+VRL+GVC    I L+ +L P G +  Y+  +Q ++  Q L+    Q+++GM YLE  + VHRDLAARNVL+ + ++ KI+DFG+++ L   +  Y +A  GK P+KW A ECI+Y +F  +SDVWSYG+T+WE+ ++G +PY  +   +I  +L++G+RL +P  C   +Y VM++CW  D   RP F EL    SR+
Sbjct:   53 IPVAIKILNESTGPKANV-EFMDEALIMASMEHPHLVRLLGVCLSPTIQLVTQLMPHGCLLDYVHEHQDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHIKITDFGLARLLETNEKEY-SADEGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDILEKGERLPQPPICTIDVYMVMVKCWMIDADSRPRFKELAAEFSRM 284          
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Match: zap70 (zeta chain of T cell receptor associated protein kinase 70 [Source:NCBI gene;Acc:448557])

HSP 1 Score: 264.618 bits (675), Expect = 9.875e-77
Identity = 123/224 (54.91%), Postives = 163/224 (72.77%), Query Frame = 2
Query: 1628 IPVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQS-LIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTF 2296
            I VA+K+LK +    +   E+M+EA  M QL + +IVR+IGVC+ E ++L++E+A  GP+NK+L   + +   S ++ELM QVS GM YLE   FVHRDLAARNVL+VN+HYAKISDFG+SKAL     YY+A + GKWPLKWYAPECI Y +F S+SDVWSYGIT+WE F+YG++PYK LKGT+++S +++ +RL  P  CP  +Y VML CW      RP F
Sbjct:  352 IDVAIKVLKVQDEKNV-RDEMMKEAEIMHQLDNPYIVRMIGVCEAENLMLVMEMASGGPLNKFLGAKKDVIPMSNIVELMHQVSIGMKYLEGKNFVHRDLAARNVLMVNQHYAKISDFGLSKALAADDSYYKAKSFGKWPLKWYAPECINYRKFSSRSDVWSYGITMWEAFTYGQKPYKKLKGTEVMSFIERNERLACPAGCPPEMYQVMLDCWIFKMEDRPNF 574          

HSP 2 Score: 109.768 bits (273), Expect = 4.507e-24
Identity = 74/252 (29.37%), Postives = 132/252 (52.38%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLRESVN--GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGVKSSFFEDCIKKKALEMGFKDSSSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFXXXXXXXXXXXNAGHTEGQFLVRQRKGDCGFVLSISVQNQPKHYKII-NKFDKLHIEGGQYFDSLIELIDHYYFRQDGLLCKLRFGIECP 829
            +++G I+R  AE+ L   G ++G+FLLR+ +   G YV+S+ +    +HY +E+Q +GT+ I  G+   GP EL E++    DG     R P  R PAG       GV  +  ++ +++   +    +  ++E+ +     Q ++ ++    H    W+H  + R EAE +L +    +G+FL+R+RK +  + LS+       HYKI  +K  K  I  G  FD+L +L+++   + DG++  L+    CP
Sbjct:   10 FYYGSISRADAEEYLKLGGMMDGLFLLRQCLRTLGGYVLSMVYNLHFHHYPVERQLNGTYAIAGGKAHCGPAELCEYYSKDADGLCCTLRRPCNR-PAGVE--CQAGVFDNMRDNMMREYVRQTWKLEGDALEQAIISQAPQ-VEKLIATTAHERMAWYHGTISRDEAERKLYSGAQPDGKFLMRERKENGTYALSVMYGKTVYHYKIDQDKSGKYSIPEGTKFDTLWQLVEYLKLKSDGIMAVLK--ESCP 255          
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Match: galk1 (galactokinase 1 [Source:Xenbase;Acc:XB-GENE-969127])

HSP 1 Score: 262.307 bits (669), Expect = 2.217e-76
Identity = 113/223 (50.67%), Postives = 167/223 (74.89%), Query Frame = 2
Query: 1631 PVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFA 2299
            PVAVK+LK + + +    E+++EA+ M  L + +IVR++G+C+ E  +L++ELA LGP+NK+L +N++++E ++ EL+ QVS GM YLE + FVHRDLAARNVLLV +HYAKISDFG+SKAL   ++YY+A  AGKWP+KWYAPE + Y +F SKSDVWS+G+ +WE +SYG +PY  +KG ++ + ++ G RL+ P  CP  +Y+++  CW+     RP+FA
Sbjct:  325 PVAVKILKNDSNDESMKDELLKEAKVMQLLNNPYIVRMLGICEGESWMLVMELAGLGPLNKFLVKNKNVTEHNVTELVHQVSMGMKYLEETNFVHRDLAARNVLLVTQHYAKISDFGLSKALESDENYYQAKTAGKWPMKWYAPESLNYHKFSSKSDVWSFGVLMWEAYSYGLKPYPGMKGNEVTAFIESGNRLECPRRCPAEMYNLIKLCWTYKTEERPSFA 547          

HSP 2 Score: 122.094 bits (305), Expect = 3.691e-28
Identity = 80/251 (31.87%), Postives = 130/251 (51.79%), Query Frame = 2
Query:   74 NILYFHGKITRDRAEDLLMSQGAIEGMFLLRESVN--GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGV--KSSFFED----CIKKKALEMGFKDSSSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFXXXXXXXXXXXNAGHTEGQFLVRQRKGDCGFVLSISVQNQPKHYKI-INKFDKLHIEGGQYFDSLIELIDHYYFRQDGLL 799
            N+ YF G ITR+ +ED L   GA +G++LLR+S +  G Y +S+ H     HY IE++ +GT+ I  G     P EL  +H L   G + L + P  R P         GV  K+  FED     I++   +       ++E+ +    +  L+ ++    H   PWFH  + R ++E+ L +   + G FL+R+R  +  + L +    +  HY+I  +K  KL I  G+ FD+L +L++HY ++ DGLL
Sbjct:    7 NLPYFFGNITREESEDYLRQAGAADGLYLLRQSRSYLGGYALSVAHGRHFYHYTIERELNGTYAISGGISHSSPAELCHYHTLESSGLVCLLKKPCNRLP---------GVQPKTGPFEDLKEHLIREYVHQTWNLQGEALEQAIIS-QKPQLEKLIATTAHEKMPWFHGRISREDSEQLLISGVKSNGSFLIRERDDNGSYALCLLHDRKISHYRIDRDKTGKLSIPDGKKFDTLWQLVEHYSYKPDGLL 247          

HSP 3 Score: 69.707 bits (169), Expect = 1.401e-11
Identity = 36/94 (38.30%), Postives = 54/94 (57.45%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLRE-SVNGNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLER 361
            +FHG+I+R+ +E LL+S     G FL+RE   NG+Y + + H  K++HY I++   G   I  G+KF    +LVEH+    DG L +   P  R
Sbjct:  163 WFHGRISREDSEQLLISGVKSNGSFLIRERDDNGSYALCLLHDRKISHYRIDRDKTGKLSIPDGKKFDTLWQLVEHYSYKPDGLLRVLTEPCPR 256          
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Match: galk1 (galactokinase 1 [Source:Xenbase;Acc:XB-GENE-969127])

HSP 1 Score: 262.307 bits (669), Expect = 2.220e-76
Identity = 113/223 (50.67%), Postives = 167/223 (74.89%), Query Frame = 2
Query: 1631 PVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFA 2299
            PVAVK+LK + + +    E+++EA+ M  L + +IVR++G+C+ E  +L++ELA LGP+NK+L +N++++E ++ EL+ QVS GM YLE + FVHRDLAARNVLLV +HYAKISDFG+SKAL   ++YY+A  AGKWP+KWYAPE + Y +F SKSDVWS+G+ +WE +SYG +PY  +KG ++ + ++ G RL+ P  CP  +Y+++  CW+     RP+FA
Sbjct:  304 PVAVKILKNDSNDESMKDELLKEAKVMQLLNNPYIVRMLGICEGESWMLVMELAGLGPLNKFLVKNKNVTEHNVTELVHQVSMGMKYLEETNFVHRDLAARNVLLVTQHYAKISDFGLSKALESDENYYQAKTAGKWPMKWYAPESLNYHKFSSKSDVWSFGVLMWEAYSYGLKPYPGMKGNEVTAFIESGNRLECPRRCPAEMYNLIKLCWTYKTEERPSFA 526          

HSP 2 Score: 124.02 bits (310), Expect = 8.109e-29
Identity = 93/308 (30.19%), Postives = 150/308 (48.70%), Query Frame = 2
Query:   74 NILYFHGKITRDRAEDLLMSQGAIEGMFLLRESVN--GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGV--KSSFFED----CIKKKALEMGFKDSSSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFXXXXXXXXXXXNAGHTEGQFLVRQRKGDCGFVLSISVQNQPKHYKI-INKFDKLHIEGGQYFDSLIELIDHYYFRQDGLLCKLRFGIECPGFIRSKAEFLQSLNQSSVE--SAHSTICGMQNAARIQRTAVKTDLSR 964
            N+ YF G ITR+ +ED L   GA +G++LLR+S +  G Y +S+ H     HY IE++ +GT+ I  G     P EL  +H L   G + L + P  R P         GV  K+  FED     I++   +       ++E+ +    +  L+ ++    H   PWFH  + R ++E+ L +   + G FL+R+R  +  + L +    +  HY+I  +K  KL I  G+ FD+L +L++HY ++ DGLL  L     CP       EF     + S E  +   T  G  N   +++  +KT  S+
Sbjct:    7 NLPYFFGNITREESEDYLRQAGAADGLYLLRQSRSYLGGYALSVAHGRHFYHYTIERELNGTYAISGGISHSSPAELCHYHTLESSGLVCLLKKPCNRLP---------GVQPKTGPFEDLKEHLIREYVHQTWNLQGEALEQAIIS-QKPQLEKLIATTAHEKMPWFHGRISREDSEQLLISGVKSNGSFLIRERDDNGSYALCLLHDRKISHYRIDRDKTGKLSIPDGKKFDTLWQLVEHYSYKPDGLLRVLT--EPCPRATGHSDEFRPMDGKISREQLTLFETELGSGNFGNVKKGELKTSKSK 302          
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Match: galk1 (galactokinase 1 [Source:Xenbase;Acc:XB-GENE-969127])

HSP 1 Score: 262.692 bits (670), Expect = 5.654e-76
Identity = 113/223 (50.67%), Postives = 167/223 (74.89%), Query Frame = 2
Query: 1631 PVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFA 2299
            PVAVK+LK + + +    E+++EA+ M  L + +IVR++G+C+ E  +L++ELA LGP+NK+L +N++++E ++ EL+ QVS GM YLE + FVHRDLAARNVLLV +HYAKISDFG+SKAL   ++YY+A  AGKWP+KWYAPE + Y +F SKSDVWS+G+ +WE +SYG +PY  +KG ++ + ++ G RL+ P  CP  +Y+++  CW+     RP+FA
Sbjct:  374 PVAVKILKNDSNDESMKDELLKEAKVMQLLNNPYIVRMLGICEGESWMLVMELAGLGPLNKFLVKNKNVTEHNVTELVHQVSMGMKYLEETNFVHRDLAARNVLLVTQHYAKISDFGLSKALESDENYYQAKTAGKWPMKWYAPESLNYHKFSSKSDVWSFGVLMWEAYSYGLKPYPGMKGNEVTAFIESGNRLECPRRCPAEMYNLIKLCWTYKTEERPSFA 596          

HSP 2 Score: 122.865 bits (307), Expect = 2.746e-28
Identity = 80/251 (31.87%), Postives = 130/251 (51.79%), Query Frame = 2
Query:   74 NILYFHGKITRDRAEDLLMSQGAIEGMFLLRESVN--GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGV--KSSFFED----CIKKKALEMGFKDSSSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFXXXXXXXXXXXNAGHTEGQFLVRQRKGDCGFVLSISVQNQPKHYKI-INKFDKLHIEGGQYFDSLIELIDHYYFRQDGLL 799
            N+ YF G ITR+ +ED L   GA +G++LLR+S +  G Y +S+ H     HY IE++ +GT+ I  G     P EL  +H L   G + L + P  R P         GV  K+  FED     I++   +       ++E+ +    +  L+ ++    H   PWFH  + R ++E+ L +   + G FL+R+R  +  + L +    +  HY+I  +K  KL I  G+ FD+L +L++HY ++ DGLL
Sbjct:    7 NLPYFFGNITREESEDYLRQAGAADGLYLLRQSRSYLGGYALSVAHGRHFYHYTIERELNGTYAISGGISHSSPAELCHYHTLESSGLVCLLKKPCNRLP---------GVQPKTGPFEDLKEHLIREYVHQTWNLQGEALEQAIIS-QKPQLEKLIATTAHEKMPWFHGRISREDSEQLLISGVKSNGSFLIRERDDNGSYALCLLHDRKISHYRIDRDKTGKLSIPDGKKFDTLWQLVEHYSYKPDGLL 247          

HSP 3 Score: 70.8626 bits (172), Expect = 6.468e-12
Identity = 37/105 (35.24%), Postives = 58/105 (55.24%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLRE-SVNGNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQ 394
            +FHG+I+R+ +E LL+S     G FL+RE   NG+Y + + H  K++HY I++   G   I  G+KF    +LVEH+    DG L +   P  R    +  +I +
Sbjct:  163 WFHGRISREDSEQLLISGVKSNGSFLIRERDDNGSYALCLLHDRKISHYRIDRDKTGKLSIPDGKKFDTLWQLVEHYSYKPDGLLRVLTEPCPRATGHSESFIFK 267          
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Match: galk1 (galactokinase 1 [Source:Xenbase;Acc:XB-GENE-969127])

HSP 1 Score: 261.922 bits (668), Expect = 7.621e-76
Identity = 113/223 (50.67%), Postives = 167/223 (74.89%), Query Frame = 2
Query: 1631 PVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFA 2299
            PVAVK+LK + + +    E+++EA+ M  L + +IVR++G+C+ E  +L++ELA LGP+NK+L +N++++E ++ EL+ QVS GM YLE + FVHRDLAARNVLLV +HYAKISDFG+SKAL   ++YY+A  AGKWP+KWYAPE + Y +F SKSDVWS+G+ +WE +SYG +PY  +KG ++ + ++ G RL+ P  CP  +Y+++  CW+     RP+FA
Sbjct:  366 PVAVKILKNDSNDESMKDELLKEAKVMQLLNNPYIVRMLGICEGESWMLVMELAGLGPLNKFLVKNKNVTEHNVTELVHQVSMGMKYLEETNFVHRDLAARNVLLVTQHYAKISDFGLSKALESDENYYQAKTAGKWPMKWYAPESLNYHKFSSKSDVWSFGVLMWEAYSYGLKPYPGMKGNEVTAFIESGNRLECPRRCPAEMYNLIKLCWTYKTEERPSFA 588          

HSP 2 Score: 122.479 bits (306), Expect = 3.526e-28
Identity = 96/326 (29.45%), Postives = 156/326 (47.85%), Query Frame = 2
Query:   74 NILYFHGKITRDRAEDLLMSQGAIEGMFLLRESVN--GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGV--KSSFFED----CIKKKALEMGFKDSSSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFXXXXXXXXXXXNAGHTEGQFLVRQRKGDCGFVLSISVQNQPKHYKI-INKFDKLHIEGGQYFDSLIELIDHYYFRQDGLLCKLRFGIE-CPG---------FIRSKAEFLQSLNQSSVESAHSTICGMQ-NAARIQRTAVKTDLSRIVTDKYRDM 991
            N+ YF G ITR+ +ED L   GA +G++LLR+S +  G Y +S+ H     HY IE++ +GT+ I  G     P EL  +H L   G + L + P  R P         GV  K+  FED     I++   +       ++E+ +    +  L+ ++    H   PWFH  + R ++E+ L +   + G FL+R+R  +  + L +    +  HY+I  +K  KL I  G+ FD+L +L++HY ++ DGL   LR   E CP          F R+      + +Q    +  ++IC +Q +        V  D   + TD YR +
Sbjct:    7 NLPYFFGNITREESEDYLRQAGAADGLYLLRQSRSYLGGYALSVAHGRHFYHYTIERELNGTYAISGGISHSSPAELCHYHTLESSGLVCLLKKPCNRLP---------GVQPKTGPFEDLKEHLIREYVHQTWNLQGEALEQAIIS-QKPQLEKLIATTAHEKMPWFHGRISREDSEQLLISGVKSNGSFLIRERDDNGSYALCLLHDRKISHYRIDRDKTGKLSIPDGKKFDTLWQLVEHYSYKPDGL---LRVLTEPCPRATGHSESFIFKRAPCPAPPTQHQMVSNACITSICSLQHHKGHSLLVKVTMDSMPMDTDVYRGI 319          
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Match: Syk (spleen tyrosine kinase [Source:MGI Symbol;Acc:MGI:99515])

HSP 1 Score: 275.018 bits (702), Expect = 2.012e-80
Identity = 117/224 (52.23%), Postives = 169/224 (75.45%), Query Frame = 2
Query: 1646 MLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTM 2317
            +LK E +      E++ EA  M QL + +IVR+IG+C+ E  +L++E+A LGP+NKYL++N+ + ++++IEL+ QVS GM YLE S FVHRDLAARNVLLV +HYAKISDFG+SKAL   ++YY+A   GKWP+KWYAPECI Y++F SKSDVWS+G+ +WE FSYG++PY+ +KG+++ +ML++G+R+  P  CP  +YD+M  CW+ D   RP F  + + +
Sbjct:  397 ILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHIKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFTAVELRL 620          

HSP 2 Score: 128.642 bits (322), Expect = 3.353e-30
Identity = 80/249 (32.13%), Postives = 131/249 (52.61%), Query Frame = 2
Query:   74 NILYFHGKITRDRAEDLLMSQGAIEGMFLLRESVN--GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGVKSSFFED----CIKKKALEMGFKDSSSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFXXXXXXXXXXXNAGHTEGQFLVRQRKGDCGFVLSISVQNQPKHYKI-INKFDKLHIEGGQYFDSLIELIDHYYFRQDGLL 799
            ++ YF G ITR+ AED L+  G  +G++LLR+S N  G + +S+ H  K +HY IE++ +GT+ I  GR    P +L  +H    DG + L + P  R P G         K+  FED     I++   +       ++E+ +    +  L+ ++    H   PWFH  + R E+E+ +     T G+FL+R R     + L +  + +  HY+I  +K  KL I  G+ FD+L +L++HY ++ DGLL
Sbjct:   11 HLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNR-PPGVQ------PKTGPFEDLKENLIREYVKQTWNLQGQALEQAIIS-QKPQLEKLIATTAHEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLL 251          

HSP 3 Score: 65.855 bits (159), Expect = 2.129e-10
Identity = 33/94 (35.11%), Postives = 51/94 (54.26%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLRESVN-GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLER 361
            +FHG I+RD +E  ++      G FL+R   N G+Y + + H  KV HY I++   G   I  G+KF    +LVEH+    DG L +  +P ++
Sbjct:  167 WFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQK 260          
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Match: Syk (spleen tyrosine kinase [Source:MGI Symbol;Acc:MGI:99515])

HSP 1 Score: 275.018 bits (702), Expect = 2.012e-80
Identity = 117/224 (52.23%), Postives = 169/224 (75.45%), Query Frame = 2
Query: 1646 MLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTM 2317
            +LK E +      E++ EA  M QL + +IVR+IG+C+ E  +L++E+A LGP+NKYL++N+ + ++++IEL+ QVS GM YLE S FVHRDLAARNVLLV +HYAKISDFG+SKAL   ++YY+A   GKWP+KWYAPECI Y++F SKSDVWS+G+ +WE FSYG++PY+ +KG+++ +ML++G+R+  P  CP  +YD+M  CW+ D   RP F  + + +
Sbjct:  397 ILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHIKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFTAVELRL 620          

HSP 2 Score: 128.642 bits (322), Expect = 3.353e-30
Identity = 80/249 (32.13%), Postives = 131/249 (52.61%), Query Frame = 2
Query:   74 NILYFHGKITRDRAEDLLMSQGAIEGMFLLRESVN--GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGVKSSFFED----CIKKKALEMGFKDSSSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFXXXXXXXXXXXNAGHTEGQFLVRQRKGDCGFVLSISVQNQPKHYKI-INKFDKLHIEGGQYFDSLIELIDHYYFRQDGLL 799
            ++ YF G ITR+ AED L+  G  +G++LLR+S N  G + +S+ H  K +HY IE++ +GT+ I  GR    P +L  +H    DG + L + P  R P G         K+  FED     I++   +       ++E+ +    +  L+ ++    H   PWFH  + R E+E+ +     T G+FL+R R     + L +  + +  HY+I  +K  KL I  G+ FD+L +L++HY ++ DGLL
Sbjct:   11 HLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNR-PPGVQ------PKTGPFEDLKENLIREYVKQTWNLQGQALEQAIIS-QKPQLEKLIATTAHEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLL 251          

HSP 3 Score: 65.855 bits (159), Expect = 2.129e-10
Identity = 33/94 (35.11%), Postives = 51/94 (54.26%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLRESVN-GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLER 361
            +FHG I+RD +E  ++      G FL+R   N G+Y + + H  KV HY I++   G   I  G+KF    +LVEH+    DG L +  +P ++
Sbjct:  167 WFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQK 260          
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Match: Syk (spleen tyrosine kinase [Source:MGI Symbol;Acc:MGI:99515])

HSP 1 Score: 268.085 bits (684), Expect = 2.607e-78
Identity = 113/208 (54.33%), Postives = 162/208 (77.88%), Query Frame = 2
Query: 1646 MLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWS 2269
            +LK E +      E++ EA  M QL + +IVR+IG+C+ E  +L++E+A LGP+NKYL++N+ + ++++IEL+ QVS GM YLE S FVHRDLAARNVLLV +HYAKISDFG+SKAL   ++YY+A   GKWP+KWYAPECI Y++F SKSDVWS+G+ +WE FSYG++PY+ +KG+++ +ML++G+R+  P  CP  +YD+M  CW+
Sbjct:  374 ILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHIKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWT 581          

HSP 2 Score: 128.642 bits (322), Expect = 2.578e-30
Identity = 80/249 (32.13%), Postives = 131/249 (52.61%), Query Frame = 2
Query:   74 NILYFHGKITRDRAEDLLMSQGAIEGMFLLRESVN--GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGVKSSFFED----CIKKKALEMGFKDSSSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFXXXXXXXXXXXNAGHTEGQFLVRQRKGDCGFVLSISVQNQPKHYKI-INKFDKLHIEGGQYFDSLIELIDHYYFRQDGLL 799
            ++ YF G ITR+ AED L+  G  +G++LLR+S N  G + +S+ H  K +HY IE++ +GT+ I  GR    P +L  +H    DG + L + P  R P G         K+  FED     I++   +       ++E+ +    +  L+ ++    H   PWFH  + R E+E+ +     T G+FL+R R     + L +  + +  HY+I  +K  KL I  G+ FD+L +L++HY ++ DGLL
Sbjct:   11 HLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNR-PPGVQ------PKTGPFEDLKENLIREYVKQTWNLQGQALEQAIIS-QKPQLEKLIATTAHEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLL 251          

HSP 3 Score: 65.4698 bits (158), Expect = 2.167e-10
Identity = 33/94 (35.11%), Postives = 51/94 (54.26%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLRESVN-GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLER 361
            +FHG I+RD +E  ++      G FL+R   N G+Y + + H  KV HY I++   G   I  G+KF    +LVEH+    DG L +  +P ++
Sbjct:  167 WFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQK 260          
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Match: Zap70 (zeta-chain (TCR) associated protein kinase [Source:MGI Symbol;Acc:MGI:99613])

HSP 1 Score: 255.758 bits (652), Expect = 1.869e-73
Identity = 121/240 (50.42%), Postives = 165/240 (68.75%), Query Frame = 2
Query: 1628 IPVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYL-RRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTMSRIQVGLST 2344
            I VA+K+LK+    K    E+M EA+ M QL + +IVRLIGVC+ E ++L++E+A  GP++K+L  + + +   ++ EL+ QV+ GM YLE   FVHRDLAARNVLLVN HYAKISDFG+SKAL     YY A +AGKWPLKWYAPECI + +F S+SDVWSYG+T+WE FSYG++PYK +KG ++L  + QG+R++ P  CP  +Y +M  CW      RP F  +   M      L++
Sbjct:  363 IDVAIKVLKQGTE-KADKDEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGGPLHKFLLGKKEEIPVSNVAELLHQVAMGMKYLEEKNFVHRDLAARNVLLVNRHYAKISDFGLSKALGADDSYYTARSAGKWPLKWYAPECINFRKFSSRSDVWSYGVTMWEAFSYGQKPYKKMKGPEVLDFIKQGKRMECPPECPPEMYALMSDCWIYKWEDRPDFLTVEQRMRNYYYSLAS 601          

HSP 2 Score: 105.916 bits (263), Expect = 5.179e-23
Identity = 76/254 (29.92%), Postives = 129/254 (50.79%), Query Frame = 2
Query:   74 NILYFHGKITRDRAEDLLMSQGAIEGMFLLRESVN--GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGVKSSFFEDCIKKKALEMGFK-----DSSSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFXXXXXXXXXXXNAGHTEGQFLVRQRKGDCGFVLSISVQNQPKHYKII-NKFDKLHIEGGQYFDSLIELIDHYYFRQDGLLCKLR 811
            ++ +F+G I+R  AE+ L   G  +G+FLLR+ +   G YV+S+ H  + +H+ IE+Q +GT+ I  G+   GP EL + +    DG     R P  R P       L+     F  DC++   +    +     +  ++E+ +     Q ++ ++    H   PW+H  L R EAE +L +   T+G+FL+R RK    + LS+       HY I  +K  K  I  G  FD+L +L+++   + DGL+ +L+
Sbjct:    7 HLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFPIERQLNGTYAIAGGKAHCGPAELCQFYSQDPDGLPCNLRKPCNRPPG------LEPQPGVF--DCLRDAMVRDYVRQTWKLEGDALEQAIISQAPQ-VEKLIATTAHERMPWYHSSLTREEAERKLYSGQQTDGKFLLRPRKEQGTYALSLVYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLKLKADGLIYRLK 251          
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Match: Erbb4 (erb-b2 receptor tyrosine kinase 4 [Source:MGI Symbol;Acc:MGI:104771])

HSP 1 Score: 201.83 bits (512), Expect = 1.534e-52
Identity = 97/234 (41.45%), Postives = 148/234 (63.25%), Query Frame = 2
Query: 1628 IPVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQ-SLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTMSRI 2326
            IPVA+K+L +    K    E M+EA  M+ + H H+VRL+GVC    I L+ +L P G +  Y+  ++ ++  Q L+    Q+++GM YLE  + VHRDLAARNVL+ + ++ KI+DFG+++ L   +  Y A   GK P+KW A ECI+Y +F  +SDVWSYG+T+WE+ ++G +PY  +   +I  +L++G+RL +P  C   +Y VM++CW  D   RP F EL    SR+
Sbjct:  746 IPVAIKILNETTGPKANV-EFMDEALIMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADG-GKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRM 977          
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Match: sp|Q64725|KSYK_RAT (Tyrosine-protein kinase SYK OS=Rattus norvegicus OX=10116 GN=Syk PE=1 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 2.349e-80
Identity = 118/224 (52.68%), Postives = 169/224 (75.45%), Query Frame = 2
Query: 1646 MLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTM 2317
            +LK E +      E++ EA  M QL + +IVR+IG+C+ E  +L++E+A  GP+NKYL++N+ + ++++IEL+ QVS GM YLE S FVHRDLAARNVLLV +HYAKISDFG+SKAL   ++YY+A   GKWP+KWYAPECI YF+F SKSDVWS+G+ +WE FSYG++PY+ +KG+++ +ML++G+R+  P  CP  +YD+M  CW+ D   RP FA + + +
Sbjct:  397 ILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAAWGPLNKYLQQNRHIKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYFKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPPGCPREMYDLMFLCWTYDVENRPGFAAVELRL 620          

HSP 2 Score: 127.872 bits (320), Expect = 4.413e-29
Identity = 80/249 (32.13%), Postives = 132/249 (53.01%), Query Frame = 2
Query:   74 NILYFHGKITRDRAEDLLMSQGAIEGMFLLRESVN--GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGVKSSFFED----CIKKKALEMGFKDSSSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFXXXXXXXXXXXNAGHTEGQFLVRQRKGDCGFVLSISVQNQPKHYKI-INKFDKLHIEGGQYFDSLIELIDHYYFRQDGLL 799
            ++ YF G ITR+ AED L+  G  +G++LLR+S N  G + +S+ H  K +HY IE++ +GT+ I  GR    P +L  +H    +G + L + P  R P G         K+  FED     I++   +       ++E+ +    +  L+ ++    H   PWFH  + R E+E+ +     T G+FL+R R  +  F L +  + +  HY+I  +K  KL I  G+ FD+L +L++HY ++ DGLL
Sbjct:   11 HLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPEGLVCLLKKPFNR-PPGVQ------PKTGPFEDLKENLIREYVKQTWNLQGQALEQAIIS-QKPQLEKLIATTAHEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNNGSFALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLL 251          

HSP 3 Score: 64.6994 bits (156), Expect = 3.366e-9
Identity = 32/94 (34.04%), Postives = 51/94 (54.26%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLR-ESVNGNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLER 361
            +FHG I+RD +E  ++      G FL+R    NG++ + + H  KV HY I++   G   I  G+KF    +LVEH+    DG L +  +P ++
Sbjct:  167 WFHGNISRDESEQTVLIGSKTNGKFLIRARDNNGSFALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQK 260          
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Match: sp|P43405|KSYK_HUMAN (Tyrosine-protein kinase SYK OS=Homo sapiens OX=9606 GN=SYK PE=1 SV=1)

HSP 1 Score: 276.559 bits (706), Expect = 4.174e-80
Identity = 118/224 (52.68%), Postives = 170/224 (75.89%), Query Frame = 2
Query: 1646 MLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTM 2317
            +LK E +      E++ EA  M QL + +IVR+IG+C+ E  +L++E+A LGP+NKYL++N+ + ++++IEL+ QVS GM YLE S FVHRDLAARNVLLV +HYAKISDFG+SKAL   ++YY+A   GKWP+KWYAPECI Y++F SKSDVWS+G+ +WE FSYG++PY+ +KG+++ +ML++G+R+  P  CP  +YD+M  CW+ D   RP FA + + +
Sbjct:  403 ILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRL 626          

HSP 2 Score: 126.716 bits (317), Expect = 1.057e-28
Identity = 79/246 (32.11%), Postives = 130/246 (52.85%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLRESVN--GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGVKSSFFED----CIKKKALEMGFKDSSSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFXXXXXXXXXXXNAGHTEGQFLVRQRKGDCGFVLSISVQNQPKHYKI-INKFDKLHIEGGQYFDSLIELIDHYYFRQDGLL 799
            +F G ITR+ AED L+  G  +G++LLR+S N  G + +S+ H  K +HY IE++ +GT+ I  GR    P +L  +H    DG + L + P  R P G         K+  FED     I++   +       ++E+ +    +  L+ ++    H   PWFH  + R E+E+ +     T G+FL+R R  +  + L +  + +  HY+I  +K  KL I  G+ FD+L +L++HY ++ DGLL
Sbjct:   15 FFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRKAHHYTIERELNGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNR-PQGVQ------PKTGPFEDLKENLIREYVKQTWNLQGQALEQAIIS-QKPQLEKLIATTAHEKMPWFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQLVEHYSYKADGLL 252          

HSP 3 Score: 68.9366 bits (167), Expect = 1.541e-10
Identity = 34/94 (36.17%), Postives = 53/94 (56.38%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLR-ESVNGNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLER 361
            +FHGKI+R+ +E +++      G FL+R    NG+Y + + H  KV HY I+K   G   I  G+KF    +LVEH+    DG L +  +P ++
Sbjct:  168 WFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQLVEHYSYKADGLLRVLTVPCQK 261          
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Match: sp|F1N9Y5|KSYK_CHICK (Tyrosine-protein kinase SYK OS=Gallus gallus OX=9031 GN=SYK PE=1 SV=2)

HSP 1 Score: 275.404 bits (703), Expect = 6.583e-80
Identity = 117/229 (51.09%), Postives = 175/229 (76.42%), Query Frame = 2
Query: 1631 PVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTM 2317
            PVAVK+LK E +      E++ EA  M QL + +IVR+IG+C+ E  +L++E+A LGP+NK+L++N+ ++E+++ EL+ QVS GM YLE + FVHRDLAARNVLLV +HYAKISDFG+SKAL+  ++YY+A + GKWP+KWYAPEC+ +++F SKSDVWS+G+ +WE FSYG++PYK +KG ++  M+++G+R++ P  CP  +YD+M  CW+ +   RP F  + + +
Sbjct:  376 PVAVKILKNESNDPAIKDELLREANVMQQLDNPYIVRMIGICEAEAWMLVMEMAELGPLNKFLQKNRHVTEKNITELVHQVSMGMKYLEENNFVHRDLAARNVLLVTQHYAKISDFGLSKALSADENYYKAQSHGKWPVKWYAPECMNFYKFSSKSDVWSFGVLMWEAFSYGQKPYKGMKGGEVAQMIERGERMECPEACPVEVYDLMKLCWTYNVDDRPGFVAVELRL 604          

HSP 2 Score: 127.102 bits (318), Expect = 7.007e-29
Identity = 88/269 (32.71%), Postives = 139/269 (51.67%), Query Frame = 2
Query:   47 IMSQGKSPFNIL-YFHGKITRDRAEDLLMSQGAIEGMFLLRESVN--GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGVKSSFFED----CIKKKALEMGFKDSSSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFXXXXXXXXXXXNAGHTEGQFLVRQRKGDCGFVLSISVQNQPKHYKI-INKFDKLHIEGGQYFDSLIELIDHYYFRQDGLLCKLRFGIECP 829
            + S   +P N L YF G ITR+ AE+ LM  G  +G++LLR+S N  G + +S+ +  KV+HY IE++  GT+ I  G+    P EL+ +H    DG + L R    R P G         K+  FED     I++   +       ++E+ +    +  L+ ++    H   PWFH  + R E+E R+       G+FL+R+R  +  + L +    +  HY+I  +K  KL I  G+ FD+L +L++HY ++ DGLL  L   I CP
Sbjct:    1 MASNMANPANHLPYFFGNITREEAEEYLMQGGMSDGLYLLRQSRNYLGGFALSLAYGRKVHHYTIERELSGTYAIAGGKSHASPAELINYHSEEADGLICLLRKSFNR-PPGVE------PKTGPFEDLKENLIREYVKQTWNLQGHALEQAIIS-QKPQLEKLIATTAHEKMPWFHGRISREESEHRILIGSRNNGKFLIRERDSNGSYALCLLNDGKVLHYRIDRDKTGKLSIPDGKRFDTLWQLVEHYSYKPDGLLRVL--SIPCP 259          

HSP 3 Score: 63.5438 bits (153), Expect = 7.666e-9
Identity = 32/95 (33.68%), Postives = 53/95 (55.79%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLRE-SVNGNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERY 364
            +FHG+I+R+ +E  ++      G FL+RE   NG+Y + + +  KV HY I++   G   I  G++F    +LVEH+    DG L +  +P  R+
Sbjct:  167 WFHGRISREESEHRILIGSRNNGKFLIRERDSNGSYALCLLNDGKVLHYRIDRDKTGKLSIPDGKRFDTLWQLVEHYSYKPDGLLRVLSIPCPRH 261          
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Match: sp|P48025|KSYK_MOUSE (Tyrosine-protein kinase SYK OS=Mus musculus OX=10090 GN=Syk PE=1 SV=2)

HSP 1 Score: 275.018 bits (702), Expect = 1.408e-79
Identity = 117/224 (52.23%), Postives = 169/224 (75.45%), Query Frame = 2
Query: 1646 MLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTM 2317
            +LK E +      E++ EA  M QL + +IVR+IG+C+ E  +L++E+A LGP+NKYL++N+ + ++++IEL+ QVS GM YLE S FVHRDLAARNVLLV +HYAKISDFG+SKAL   ++YY+A   GKWP+KWYAPECI Y++F SKSDVWS+G+ +WE FSYG++PY+ +KG+++ +ML++G+R+  P  CP  +YD+M  CW+ D   RP F  + + +
Sbjct:  397 ILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHIKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFTAVELRL 620          

HSP 2 Score: 128.642 bits (322), Expect = 2.346e-29
Identity = 80/249 (32.13%), Postives = 131/249 (52.61%), Query Frame = 2
Query:   74 NILYFHGKITRDRAEDLLMSQGAIEGMFLLRESVN--GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGVKSSFFED----CIKKKALEMGFKDSSSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFXXXXXXXXXXXNAGHTEGQFLVRQRKGDCGFVLSISVQNQPKHYKI-INKFDKLHIEGGQYFDSLIELIDHYYFRQDGLL 799
            ++ YF G ITR+ AED L+  G  +G++LLR+S N  G + +S+ H  K +HY IE++ +GT+ I  GR    P +L  +H    DG + L + P  R P G         K+  FED     I++   +       ++E+ +    +  L+ ++    H   PWFH  + R E+E+ +     T G+FL+R R     + L +  + +  HY+I  +K  KL I  G+ FD+L +L++HY ++ DGLL
Sbjct:   11 HLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNR-PPGVQ------PKTGPFEDLKENLIREYVKQTWNLQGQALEQAIIS-QKPQLEKLIATTAHEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLL 251          

HSP 3 Score: 65.855 bits (159), Expect = 1.489e-9
Identity = 33/94 (35.11%), Postives = 51/94 (54.26%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLRESVN-GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLER 361
            +FHG I+RD +E  ++      G FL+R   N G+Y + + H  KV HY I++   G   I  G+KF    +LVEH+    DG L +  +P ++
Sbjct:  167 WFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQK 260          
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Match: sp|Q00655|KSYK_PIG (Tyrosine-protein kinase SYK OS=Sus scrofa OX=9823 GN=SYK PE=1 SV=1)

HSP 1 Score: 270.781 bits (691), Expect = 5.823e-78
Identity = 115/224 (51.34%), Postives = 168/224 (75.00%), Query Frame = 2
Query: 1646 MLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTM 2317
            +LK E +      E++ EA  M QL + +IVR+IG+C+ E  +L++E+A LGP+NKYL++N+ + ++++IEL+ QVS GM YLE   FVHRDLAARNVLLV +HYAKISDFG+SKAL   ++YY+A   GKWP+KWYAPECI Y++F SKSDVWS+G+ +WE FSYG++PY+ +KG+++ +ML++G+R+  P  CP  +Y++M  CW+ D   RP F  + + +
Sbjct:  396 ILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEECNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVSAMLEKGERMGCPPGCPREMYELMTLCWTYDVENRPGFVAVELRL 619          

HSP 2 Score: 125.946 bits (315), Expect = 1.756e-28
Identity = 81/246 (32.93%), Postives = 133/246 (54.07%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLRESVN--GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGVKSSFFED----CIKKKALEMGFKDSSSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFXXXXXXXXXXXNAGHTEGQFLVRQRKGDCGFVLSISVQNQPKHYKI-INKFDKLHIEGGQYFDSLIELIDHYYFRQDGLL 799
            +F G+ITR+ AED L+  G  +G++LLR+S N  G + +S+ +  K +HY IE++ +GT+ I  GR    P EL  +H   LDG + L + P  R P G         K+  FED     I++   +       ++E+ +    +  L+ ++    H   PWFH  + R E+E+ +     T G+FL+R R  +  + L +  + +  HY+I  +K  KL I GG+ FD+L +L++HY ++ DGLL
Sbjct:   10 FFFGQITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAYDRKAHHYTIERELNGTYAISGGRTHGSPAELCHYHSQELDGLVCLLKNPFNR-PPGVQ------PKTGPFEDLKENLIREYVKQTWNLQGQALEQAIIS-QKPQLEKLIATTAHEKMPWFHGKISRDESEQIVLIGSKTNGKFLIRARD-NGSYALGLLHEGKVLHYRIDKDKTGKLSIPGGKNFDTLWQLVEHYSYKSDGLL 246          

HSP 3 Score: 72.7886 bits (177), Expect = 9.912e-12
Identity = 34/93 (36.56%), Postives = 52/93 (55.91%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLRESVNGNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLER 361
            +FHGKI+RD +E +++      G FL+R   NG+Y + + H  KV HY I+K   G   I  G+ F    +LVEH+    DG L +  +P ++
Sbjct:  163 WFHGKISRDESEQIVLIGSKTNGKFLIRARDNGSYALGLLHEGKVLHYRIDKDKTGKLSIPGGKNFDTLWQLVEHYSYKSDGLLRVLTVPCQK 255          
BLAST of Tyrosine-protein kinase vs. TrEMBL
Match: A0A5K3ELS1 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 397.897 bits (1021), Expect = 6.076e-125
Identity = 223/428 (52.10%), Postives = 275/428 (64.25%), Query Frame = 2
Query: 1169 VFQWNNSISSSTQSFVNDTRQTNDTP-KVSENVITLEYKDNILDQSLNEPQITDQLWSEPEIASSR--------------------QVISPSLEVEISRNRIKSSSMPPKL--------------QPWDLGILD--PMLAV-----ETQKIYDSLSLNDISFNLPIDKIEIKQKLXXXXXXXXXXXXXKINLLETIPVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTMSRI 2326
            VF+ NN  S +TQ   + TR     P K S N       +++  +SLN P I D LW EP+ +  R                     +++P L +  S    +     P +              QP    + D  P  +V     E QKIYDSL   D +  LP + + + ++LGGGNFG V  G YK      + VAVK LK+   +  G   I+ EA+TM+QL+H+HIVRLIGVCK ++ +L+LELAPLGPINKYL+++   S   L ELM QV++GMAYLE+ K VHRDLAARNVLLV + +AKISDFGMSKALN+G DYYRAA+AGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKD+KG QIL+MLDQG RL +P  CPE IY VM QCW+ +GVRRPTF ELV+TMSR+
Sbjct:   27 VFRTNNFASGATQRTASATRNPQLPPCKFSPN-------NSLPPESLNFPPIIDALWEEPDGSEERSQPSSSMASINLESLPPPPPHILNPFLPLTTSAVSPQPCHHAPGVSTFCNSTCCQRKESQPNSPQLRDTTPPASVLPAIEEAQKIYDSLP--DNTLFLPPESLSLMERLGGGNFGQVVKGIYKTPHGLDVQVAVKTLKESQIACTGEQTILAEAKTMTQLKHRHIVRLIGVCKAQRFMLVLELAPLGPINKYLKKHPDTSVCVLAELMHQVAQGMAYLESCKLVHRDLAARNVLLVTQRFAKISDFGMSKALNFGNDYYRAASAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDMKGAQILAMLDQGLRLSRPARCPEPIYAVMQQCWNAEGVRRPTFTELVLTMSRL 445          
BLAST of Tyrosine-protein kinase vs. TrEMBL
Match: A0A158QUA3 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS5960 PE=3 SV=1)

HSP 1 Score: 397.512 bits (1020), Expect = 9.766e-122
Identity = 223/428 (52.10%), Postives = 275/428 (64.25%), Query Frame = 2
Query: 1169 VFQWNNSISSSTQSFVNDTRQTNDTP-KVSENVITLEYKDNILDQSLNEPQITDQLWSEPEIASSR--------------------QVISPSLEVEISRNRIKSSSMPPKL--------------QPWDLGILD--PMLAV-----ETQKIYDSLSLNDISFNLPIDKIEIKQKLXXXXXXXXXXXXXKINLLETIPVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTMSRI 2326
            VF+ NN  S +TQ   + TR     P K S N       +++  +SLN P I D LW EP+ +  R                     +++P L +  S    +     P +              QP    + D  P  +V     E QKIYDSL   D +  LP + + + ++LGGGNFG V  G YK      + VAVK LK+   +  G   I+ EA+TM+QL+H+HIVRLIGVCK ++ +L+LELAPLGPINKYL+++   S   L ELM QV++GMAYLE+ K VHRDLAARNVLLV + +AKISDFGMSKALN+G DYYRAA+AGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKD+KG QIL+MLDQG RL +P  CPE IY VM QCW+ +GVRRPTF ELV+TMSR+
Sbjct:  263 VFRTNNFASGATQRTASATRNPQLPPCKFSPN-------NSLPPESLNFPPIIDALWEEPDGSEERSQPSSSMASINLESLPPPPPHILNPFLPLTTSAVSPQPCHHAPGVSTFCNSTCCQRKESQPNSPQLRDTTPPASVLPAIEEAQKIYDSLP--DNTLFLPPESLSLMERLGGGNFGQVVKGIYKTPHGLDVQVAVKTLKESQIACTGEQTILAEAKTMTQLKHRHIVRLIGVCKAQRFMLVLELAPLGPINKYLKKHPDTSVCVLAELMHQVAQGMAYLESCKLVHRDLAARNVLLVTQRFAKISDFGMSKALNFGNDYYRAASAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDMKGAQILAMLDQGLRLSRPARCPEPIYAVMQQCWNAEGVRRPTFTELVLTMSRL 681          

HSP 2 Score: 65.4698 bits (158), Expect = 5.932e-7
Identity = 39/121 (32.23%), Postives = 65/121 (53.72%), Query Frame = 2
Query:  761 LIDHYYFRQDGLLCKLRFGIECPGFIRSKAEFLQSLNQSSVESAHSTICGMQNAARIQRTA-------VKTDLSRIVTDKYRDMSINS-IFRQKKSDMISVSSDLISFSEWSTNLPRLLNE 1099
            +IDHY+FRQDGLLCKLR  +  P FIR+K +   S++  S + + S++   ++   + RTA          +++        D +  S + R+   D++  S+DLISF++W      L N+
Sbjct:    1 MIDHYHFRQDGLLCKLRKVVAAPDFIRTKQDS-ASISSESPQGSPSSLKKPESTMNVSRTASHSLPSLASLNVTSPTVATSNDTNRGSPVIRKVNEDVMHSSTDLISFNDWPNVTSLLANQ 120          
BLAST of Tyrosine-protein kinase vs. TrEMBL
Match: A0A183MH92 (Protein kinase domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS15417 PE=3 SV=1)

HSP 1 Score: 392.889 bits (1008), Expect = 1.322e-120
Identity = 192/280 (68.57%), Postives = 226/280 (80.71%), Query Frame = 2
Query: 1487 QKIYDSLSLNDISFNLPIDKIEIKQKLXXXXXXXXXXXXXKINLLETIPVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTMSRI 2326
            Q+IYD L  ++  F L    + +K++LGGGNFG+V  G Y+    + +PVAVK LK       G  EI+ EARTM+QL+H+HIVRLIGVCK EQ +L+LELAPLGPINKYL++   +S  +L ELM QV+ GMAYLE+ KFVHRDLAARNVLLV  H+AKISDFGMSKALN+G DYYRAA AGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEV+SYGERPY+D+KG QIL+MLDQG RL +P  CPESIY VM QCW+ +GV RPTFAELV+T+SRI
Sbjct:  285 QQIYDELPPSN--FLLNSQTVTLKERLGGGNFGHVVKGLYRTPSGQEVPVAVKTLKPNQIVNSGEREILAEARTMAQLKHRHIVRLIGVCKEEQFMLVLELAPLGPINKYLKKRPDVSVHTLTELMHQVALGMAYLESCKFVHRDLAARNVLLVTRHFAKISDFGMSKALNFGSDYYRAATAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVYSYGERPYRDMKGAQILAMLDQGLRLSRPSRCPESIYSVMQQCWNFEGVHRPTFAELVLTISRI 562          
BLAST of Tyrosine-protein kinase vs. TrEMBL
Match: G4VKS4 (Tyrosine kinase OS=Schistosoma mansoni OX=6183 GN=Smp_149460 PE=3 SV=1)

HSP 1 Score: 394.815 bits (1013), Expect = 2.802e-120
Identity = 191/280 (68.21%), Postives = 227/280 (81.07%), Query Frame = 2
Query: 1487 QKIYDSLSLNDISFNLPIDKIEIKQKLXXXXXXXXXXXXXKINLLETIPVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTMSRI 2326
            Q+IYD L  ++  F L    + +K++LGGGNFG+V  G Y+    + +PVAVK LK    +  G  EI+ EARTM+QL+H+HIVRLIGVCK EQ +L+LELAPLGPINKYL++   +S  +L ELM QV+ GMAYLE+ KFVHRDLAARNVLLV  H+AKISDFGMSKALN+G DYYRAA AGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEV+SYGERPY+D+KG QIL+MLDQG RL +P  CPESIY +M QCW+ +GV RPTFAELV+T+SRI
Sbjct:  372 QQIYDELPPSN--FLLNSQTVTLKERLGGGNFGHVVKGLYRTPSGQEVPVAVKTLKPNQIANSGEREILAEARTMAQLKHRHIVRLIGVCKEEQFMLVLELAPLGPINKYLKKRPDVSVHTLTELMHQVALGMAYLESCKFVHRDLAARNVLLVTRHFAKISDFGMSKALNFGSDYYRAATAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVYSYGERPYRDMKGAQILAMLDQGLRLSRPSRCPESIYSIMQQCWNFEGVHRPTFAELVLTISRI 649          
BLAST of Tyrosine-protein kinase vs. TrEMBL
Match: A0A0X3P5I8 (Tyrosine-protein kinase SYK (Fragment) OS=Schistocephalus solidus OX=70667 GN=KSYK PE=4 SV=1)

HSP 1 Score: 383.645 bits (984), Expect = 7.000e-120
Identity = 184/279 (65.95%), Postives = 226/279 (81.00%), Query Frame = 2
Query: 1481 ETQKIYDSLSLNDISFNLPIDKIEIKQKLXXXXXXXXXXXXXKINLLETIPVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTM 2317
            E QKIYDSL   + +F L  D + + ++LGGGNFG V  G Y+    + +PVAVK LK+   +  G   I+ EA+ M+QL+H+HIVRLIGVCK ++ +L+LELAPLGPINK+L+++   S   + +LM QV++GMAYLE+ KFVHRDLAARNVLLV + +AKISDFGMSKALN+G DYYRAA+AGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFS+GERPYKD+KG QILSMLDQG RL +P  CPE++Y VM +CW+ +GVRRPTFAELV+TM
Sbjct:  120 EAQKIYDSLP--ESTFFLNPDHLSLMERLGGGNFGQVVKGIYRTPHGQEVPVAVKTLKESQIASTGEQSILSEAKMMTQLKHRHIVRLIGVCKAQRFMLVLELAPLGPINKFLKKHPDTSVNVITDLMYQVAQGMAYLESCKFVHRDLAARNVLLVTQRFAKISDFGMSKALNFGNDYYRAASAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSFGERPYKDMKGAQILSMLDQGLRLSRPARCPEAVYAVMRECWNFEGVRRPTFAELVLTM 396          
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Match: zap70 (tyrosine-protein kinase ZAP-70 [Source:NCBI gene;Acc:103044019])

HSP 1 Score: 274.633 bits (701), Expect = 8.245e-81
Identity = 124/231 (53.68%), Postives = 170/231 (73.59%), Query Frame = 2
Query: 1628 IPVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLR-RNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTM 2317
            I VA+K+LK E + K    E+M EA  M QL + +IVR+IG+C+ E ++L++E+AP GP+NK+L  +   +S ++++ELM QVS GM YLE   FVHRDLAARNVLLVN+HYAKISDFG+SKAL    +YY+A   GKWPLKWYAPECI + +F +K DVWSYG+T+WE FSYG +PYK +KG +++SM+  G R++ P  CPE++Y+VM  CW+     RP+F ++   M
Sbjct:  332 IDVAIKILKSE-NEKAVKDEMMREAEIMHQLDNPYIVRMIGLCQAEALMLVMEMAPAGPLNKFLSSKKDQVSVENVVELMHQVSLGMKYLEEKNFVHRDLAARNVLLVNQHYAKISDFGLSKALGADDNYYKARTLGKWPLKWYAPECINFHKFSNKGDVWSYGVTMWEAFSYGGKPYKKMKGPEVISMIQNGNRMECPAGCPEAMYEVMKDCWTYKYEERPSFVKVEEKM 561          

HSP 2 Score: 102.449 bits (254), Expect = 4.751e-22
Identity = 75/246 (30.49%), Postives = 126/246 (51.22%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLRESVN--GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGVKSSFFEDCIKKKALEMGFKDSSSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFXXXXXXXXXXXNAGHTEGQFLVRQRKGDCGFVLSISVQNQPKHYKII-NKFDKLHIEGGQYFDSLIELIDHYYFRQDGLLCKLR 811
            +F+G I+R  AE  L   G  +G+FLLR+ +   G YV+S+    +  HY +EKQ +GTF I  G+   GP EL E++    DG + + R P  R  A T   I  GV  +  ++ +++        +  ++E+ +     Q L+ ++    H    W+H  + R E E RL +    +G+FLVR+R     F LS+       HY+++ +K  K  +  G  FD++ +L+++   + DGL+  LR
Sbjct:   10 FFYGSISRSEAEQHLKLAGMSDGLFLLRQCLRSLGGYVLSLVWNLEFYHYPVEKQLNGTFCISGGKPHCGPAELCEYYSKDADGLVCMLRKPCLR-TAETP--IKHGVFDNLRDNMLREYVRHTWNLEGEAMEQAIISQAPQ-LEKLIATTAHEKMLWYHGKIPRQEGERRLYSGSQPDGKFLVRERDESGTFALSVMYGKTAYHYQVLHDKSGKYSMPEGTKFDTVWQLVEYLKMKPDGLVTLLR 251          

HSP 3 Score: 55.4546 bits (132), Expect = 2.243e-7
Identity = 30/91 (32.97%), Postives = 47/91 (51.65%), Query Frame = 2
Query:   77 ILYFHGKITRDRAEDLLMSQGAIEGMFLLRE-SVNGNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLAR 346
            +L++HGKI R   E  L S    +G FL+RE   +G + +S+ +     HY +     G + +  G KF    +LVE+  +  DG +TL R
Sbjct:  161 MLWYHGKIPRQEGERRLYSGSQPDGKFLVRERDESGTFALSVMYGKTAYHYQVLHDKSGKYSMPEGTKFDTVWQLVEYLKMKPDGLVTLLR 251          
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Match: zap70 (tyrosine-protein kinase ZAP-70 [Source:NCBI gene;Acc:103044019])

HSP 1 Score: 274.633 bits (701), Expect = 1.366e-80
Identity = 124/231 (53.68%), Postives = 170/231 (73.59%), Query Frame = 2
Query: 1628 IPVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLR-RNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTM 2317
            I VA+K+LK E + K    E+M EA  M QL + +IVR+IG+C+ E ++L++E+AP GP+NK+L  +   +S ++++ELM QVS GM YLE   FVHRDLAARNVLLVN+HYAKISDFG+SKAL    +YY+A   GKWPLKWYAPECI + +F +K DVWSYG+T+WE FSYG +PYK +KG +++SM+  G R++ P  CPE++Y+VM  CW+     RP+F ++   M
Sbjct:  353 IDVAIKILKSE-NEKAVKDEMMREAEIMHQLDNPYIVRMIGLCQAEALMLVMEMAPAGPLNKFLSSKKDQVSVENVVELMHQVSLGMKYLEEKNFVHRDLAARNVLLVNQHYAKISDFGLSKALGADDNYYKARTLGKWPLKWYAPECINFHKFSNKGDVWSYGVTMWEAFSYGGKPYKKMKGPEVISMIQNGNRMECPAGCPEAMYEVMKDCWTYKYEERPSFVKVEEKM 582          

HSP 2 Score: 102.834 bits (255), Expect = 3.677e-22
Identity = 75/246 (30.49%), Postives = 126/246 (51.22%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLRESVN--GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGVKSSFFEDCIKKKALEMGFKDSSSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFXXXXXXXXXXXNAGHTEGQFLVRQRKGDCGFVLSISVQNQPKHYKII-NKFDKLHIEGGQYFDSLIELIDHYYFRQDGLLCKLR 811
            +F+G I+R  AE  L   G  +G+FLLR+ +   G YV+S+    +  HY +EKQ +GTF I  G+   GP EL E++    DG + + R P  R  A T   I  GV  +  ++ +++        +  ++E+ +     Q L+ ++    H    W+H  + R E E RL +    +G+FLVR+R     F LS+       HY+++ +K  K  +  G  FD++ +L+++   + DGL+  LR
Sbjct:   10 FFYGSISRSEAEQHLKLAGMSDGLFLLRQCLRSLGGYVLSLVWNLEFYHYPVEKQLNGTFCISGGKPHCGPAELCEYYSKDADGLVCMLRKPCLR-TAETP--IKHGVFDNLRDNMLREYVRHTWNLEGEAMEQAIISQAPQ-LEKLIATTAHEKMLWYHGKIPRQEGERRLYSGSQPDGKFLVRERDESGTFALSVMYGKTAYHYQVLHDKSGKYSMPEGTKFDTVWQLVEYLKMKPDGLVTLLR 251          

HSP 3 Score: 55.8398 bits (133), Expect = 1.769e-7
Identity = 30/91 (32.97%), Postives = 47/91 (51.65%), Query Frame = 2
Query:   77 ILYFHGKITRDRAEDLLMSQGAIEGMFLLRE-SVNGNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLAR 346
            +L++HGKI R   E  L S    +G FL+RE   +G + +S+ +     HY +     G + +  G KF    +LVE+  +  DG +TL R
Sbjct:  161 MLWYHGKIPRQEGERRLYSGSQPDGKFLVRERDESGTFALSVMYGKTAYHYQVLHDKSGKYSMPEGTKFDTVWQLVEYLKMKPDGLVTLLR 251          
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Match: zap70 (tyrosine-protein kinase ZAP-70 [Source:NCBI gene;Acc:103044019])

HSP 1 Score: 274.633 bits (701), Expect = 1.366e-80
Identity = 124/231 (53.68%), Postives = 170/231 (73.59%), Query Frame = 2
Query: 1628 IPVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLR-RNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTM 2317
            I VA+K+LK E + K    E+M EA  M QL + +IVR+IG+C+ E ++L++E+AP GP+NK+L  +   +S ++++ELM QVS GM YLE   FVHRDLAARNVLLVN+HYAKISDFG+SKAL    +YY+A   GKWPLKWYAPECI + +F +K DVWSYG+T+WE FSYG +PYK +KG +++SM+  G R++ P  CPE++Y+VM  CW+     RP+F ++   M
Sbjct:  353 IDVAIKILKSE-NEKAVKDEMMREAEIMHQLDNPYIVRMIGLCQAEALMLVMEMAPAGPLNKFLSSKKDQVSVENVVELMHQVSLGMKYLEEKNFVHRDLAARNVLLVNQHYAKISDFGLSKALGADDNYYKARTLGKWPLKWYAPECINFHKFSNKGDVWSYGVTMWEAFSYGGKPYKKMKGPEVISMIQNGNRMECPAGCPEAMYEVMKDCWTYKYEERPSFVKVEEKM 582          

HSP 2 Score: 102.834 bits (255), Expect = 3.677e-22
Identity = 75/246 (30.49%), Postives = 126/246 (51.22%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLRESVN--GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGVKSSFFEDCIKKKALEMGFKDSSSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFXXXXXXXXXXXNAGHTEGQFLVRQRKGDCGFVLSISVQNQPKHYKII-NKFDKLHIEGGQYFDSLIELIDHYYFRQDGLLCKLR 811
            +F+G I+R  AE  L   G  +G+FLLR+ +   G YV+S+    +  HY +EKQ +GTF I  G+   GP EL E++    DG + + R P  R  A T   I  GV  +  ++ +++        +  ++E+ +     Q L+ ++    H    W+H  + R E E RL +    +G+FLVR+R     F LS+       HY+++ +K  K  +  G  FD++ +L+++   + DGL+  LR
Sbjct:   10 FFYGSISRSEAEQHLKLAGMSDGLFLLRQCLRSLGGYVLSLVWNLEFYHYPVEKQLNGTFCISGGKPHCGPAELCEYYSKDADGLVCMLRKPCLR-TAETP--IKHGVFDNLRDNMLREYVRHTWNLEGEAMEQAIISQAPQ-LEKLIATTAHEKMLWYHGKIPRQEGERRLYSGSQPDGKFLVRERDESGTFALSVMYGKTAYHYQVLHDKSGKYSMPEGTKFDTVWQLVEYLKMKPDGLVTLLR 251          

HSP 3 Score: 55.8398 bits (133), Expect = 1.769e-7
Identity = 30/91 (32.97%), Postives = 47/91 (51.65%), Query Frame = 2
Query:   77 ILYFHGKITRDRAEDLLMSQGAIEGMFLLRE-SVNGNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLAR 346
            +L++HGKI R   E  L S    +G FL+RE   +G + +S+ +     HY +     G + +  G KF    +LVE+  +  DG +TL R
Sbjct:  161 MLWYHGKIPRQEGERRLYSGSQPDGKFLVRERDESGTFALSVMYGKTAYHYQVLHDKSGKYSMPEGTKFDTVWQLVEYLKMKPDGLVTLLR 251          
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Match: syk (spleen tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-040702-3])

HSP 1 Score: 251.906 bits (642), Expect = 1.048e-72
Identity = 110/223 (49.33%), Postives = 165/223 (73.99%), Query Frame = 2
Query: 1631 PVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFA 2299
            PVAVK+LK + +++    E++ EA  M +L + +IVR+IG+C+ E ++L++ELA LGP++KYL+RN+ ++ +++ EL+ QV  GM YLE S FVHRDLAARNVLLV +HYAKISDFG+S+AL   +  Y     GKWP+KWYAPEC+ +F+F  KSDVWS+G+ +WE +SYG++PYK +KG +++ M+++G+R+  P +CP  +Y++M +        RP FA
Sbjct:  340 PVAVKILKNDENNEAVKQEMLREAEVMQKLDNPYIVRMIGICEAENLMLVMELAELGPLHKYLQRNKHVTSKNITELVHQVCMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSRALG-EERIYNCLCPGKWPVKWYAPECMNFFKFSCKSDVWSFGVLMWEAYSYGQKPYKGMKGNEVIQMVERGERMAAPADCPPEMYELMKKMVDD----RPGFA 557          

HSP 2 Score: 124.405 bits (311), Expect = 4.062e-29
Identity = 80/254 (31.50%), Postives = 133/254 (52.36%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLRESVN--GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGVKSSFFEDCIKKKALEMGFKDSSSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFXXXXXXXXXXXNAGHTEGQFLVRQRKGDCGFVLSISVQNQPKHYKI-INKFDKLHIEGGQYFDSLIELIDHYYFRQDGLLCKLRFGIECPGF 835
            +F+G I R+ AE+ L   G  +G++LLR+S N  G + +S+ +  +  HY IEK+ + TF I+ G+    P +++E+H    DG + L + P  R P G    +  G      E  I++   +      +++E+ +    R  L+ ++    H   PWFH  + R ++E RL  +    G+FL+RQR  +  F L +   +Q  HY+I  +K  KL I  G+ FD+L +L++HY ++ DGLL  L      P F
Sbjct:   10 FFYGNIAREEAEEYLRHAGMSDGLYLLRQSRNYLGGFALSVAYNRQCYHYTIEKELNETFAIVGGKSHRTPQDVIEYHSQESDGLICLLKKPCNR-PRGVQPKV--GAFEDVKEKLIRQYVTQTWNLQGAALEQAIIS-QRPQLEKLIATTAHEKMPWFHGNITREDSELRLHGSSRVNGKFLIRQRDTNGSFALCLLHNHQVMHYRIDRDKAGKLSIPDGKKFDTLWQLVEHYTYKPDGLLRVLTEACPHPAF 259          
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Match: syk (spleen tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-040702-3])

HSP 1 Score: 252.677 bits (644), Expect = 1.124e-72
Identity = 107/216 (49.54%), Postives = 162/216 (75.00%), Query Frame = 2
Query: 1631 PVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDG 2278
            PVAVK+LK + +++    E++ EA  M +L + +IVR+IG+C+ E ++L++ELA LGP++KYL+RN+ ++ +++ EL+ QV  GM YLE S FVHRDLAARNVLLV +HYAKISDFG+S+AL   +  Y     GKWP+KWYAPEC+ +F+F  KSDVWS+G+ +WE +SYG++PYK +KG +++ M+++G+R+  P +CP  +Y++M +     G
Sbjct:  381 PVAVKILKNDENNEAVKQEMLREAEVMQKLDNPYIVRMIGICEAENLMLVMELAELGPLHKYLQRNKHVTSKNITELVHQVCMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSRALGE-ERIYNCLCPGKWPVKWYAPECMNFFKFSCKSDVWSFGVLMWEAYSYGQKPYKGMKGNEVIQMVERGERMAAPADCPPEMYELMKKMLDVQG 595          

HSP 2 Score: 126.716 bits (317), Expect = 9.256e-30
Identity = 82/274 (29.93%), Postives = 140/274 (51.09%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLRESVN--GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGVKSSFFEDCIKKKALEMGFKDSSSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFXXXXXXXXXXXNAGHTEGQFLVRQRKGDCGFVLSISVQNQPKHYKI-INKFDKLHIEGGQYFDSLIELIDHYYFRQDGLLCKLRFGIECPGFIRSKAEFLQSLNQSSVESAH 895
            +F+G I R+ AE+ L   G  +G++LLR+S N  G + +S+ +  +  HY IEK+ + TF I+ G+    P +++E+H    DG + L + P  R P G    +  G      E  I++   +      +++E+ +    R  L+ ++    H   PWFH  + R ++E RL  +    G+FL+RQR  +  F L +   +Q  HY+I  +K  KL I  G+ FD+L +L++HY ++ DGLL  L      P F    A+    +  +  ++ H
Sbjct:   10 FFYGNIAREEAEEYLRHAGMSDGLYLLRQSRNYLGGFALSVAYNRQCYHYTIEKELNETFAIVGGKSHRTPQDVIEYHSQESDGLICLLKKPCNR-PRGVQPKV--GAFEDVKEKLIRQYVTQTWNLQGAALEQAIIS-QRPQLEKLIATTAHEKMPWFHGNITREDSELRLHGSSRVNGKFLIRQRDTNGSFALCLLHNHQVMHYRIDRDKAGKLSIPDGKKFDTLWQLVEHYTYKPDGLLRVLTEACPHPAFSHQSADGRPGVPPNHPQTGH 279          
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006670.1 (pep scaffold:Pmarinus_7.0:GL482639:18:11990:1 gene:ENSPMAG00000006016.1 transcript:ENSPMAT00000006670.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 195.667 bits (496), Expect = 3.010e-55
Identity = 94/232 (40.52%), Postives = 145/232 (62.50%), Query Frame = 2
Query: 1622 ETIPVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQ-ILLILELAPLGPINKYLR--RNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNY-GQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAEL 2305
            +T PVA+K LK+    +    + + EA+ M +LRH  +++L  VC  E+ I +I EL   G +  YL+    +SL    L+++ +QV+ GMAYLEA  ++HRDLAARN+L+   +  K++DFG+++ +    +D Y A    K+P+KW APE   Y RF  KSDVWS+G+ L E+ +YG+ PY      ++L+ +D+G R+  P  CP++ YD+ML+CW+ D   RPTF  L
Sbjct:  135 KTTPVAIKTLKQGTMDR---DDFLREAQLMKRLRHPKLIQLYAVCTQEEPIYIITELMSNGSLANYLQTPEGRSLDLVELVDMAAQVAAGMAYLEAQNYIHRDLAARNILVAEHNACKVADFGLARVIKMSNEDEYEARVGSKFPIKWTAPEAANYNRFSIKSDVWSFGVLLHEIITYGKLPYPGQTNAEVLAAVDRGYRMPCPPGCPQAFYDLMLECWNVDDQARPTFETL 363          
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003172.1 (pep scaffold:Pmarinus_7.0:GL476855:1052:76454:1 gene:ENSPMAG00000002842.1 transcript:ENSPMAT00000003172.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 196.438 bits (498), Expect = 3.363e-52
Identity = 95/234 (40.60%), Postives = 148/234 (63.25%), Query Frame = 2
Query: 1628 IPVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRN-QSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTMSRI 2326
            IPVA+K+L+ E  S     EI++EA  M+ + H H+VRL+G+C    + L+ +L PLG + +Y R + + +  Q L+    Q+++GM YLE  + VHRDLAARNVL+    + KI+DFG+++ L+  +  Y A   GK P+KW A E I Y  F  +SDVWSYG+T+WE+ ++G +PY+ +    I  +L++G+RL +P  C   +Y +M++CW  D   RP F EL +  S++
Sbjct:  602 IPVAIKVLR-EATSPKANKEILDEAYIMASVSHPHLVRLLGICLTPSVQLVTQLMPLGCLLEYTREHKEHIGSQLLLNWAVQIAKGMMYLEEQRLVHRDLAARNVLVRTPQHVKITDFGLARLLDINEIEYHADG-GKMPIKWLALESIQYRTFTHQSDVWSYGVTIWELMTFGGKPYEGIPARDIPELLEKGERLPQPPICTIDVYMIMVKCWMIDAESRPRFKELAVEFSKM 833          
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Match: frk (fyn-related Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-110411-7])

HSP 1 Score: 187.963 bits (476), Expect = 7.263e-52
Identity = 94/228 (41.23%), Postives = 138/228 (60.53%), Query Frame = 2
Query: 1634 VAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQ-ILLILELAPLGPINKYLRR--NQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYG-QDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAEL 2305
            VAVK LK     K    E + EA+ M QLRH ++++L  VC  E+ I +I EL   G +  YLR    + L    L+++  Q++ GMAYLE+  ++HRDLAARN+L+      K++DFG+++ +    +D Y   A  K P+KW APE + + RF  KSDVWS+GI L+E+ +YG  PY ++   ++L  LD+G R+ +P NCP   Y +ML+CW+     RPTF  L
Sbjct:  214 VAVKTLKPGAMKK---EEFIGEAQIMKQLRHANLIQLYAVCSQEEPIYIITELMRHGSLLDYLRGPLGKQLKAPELVDMARQIAAGMAYLESQNYIHRDLAARNILVGEGKVCKVADFGLARIIKVRYEDEYEGKAGAKVPIKWTAPEAVNFHRFSVKSDVWSFGILLYELITYGRMPYPEMGNMEVLKQLDRGYRMPQPDNCPPLFYSIMLECWNKKEEERPTFETL 438          
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001705.1 (pep scaffold:Pmarinus_7.0:GL487204:7598:9057:-1 gene:ENSPMAG00000001543.1 transcript:ENSPMAT00000001705.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 176.022 bits (445), Expect = 5.879e-50
Identity = 88/240 (36.67%), Postives = 133/240 (55.42%), Query Frame = 2
Query: 1697 EARTMSQLRHKHIVRLIGVCKCEQ-ILLILELAPLGPINKYLRRNQS-----------------------LSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTMSRIQVGLST 2344
            EA  M++  H +IV+L+GVC   +   L+ E  P G +N+YLRR  S                       L     + + +QV+ GMAYL   KFVHRDLA RN L+ N    KISDFG+S+++ Y  DYY+A      P++W  PE I+Y R+ S+SDVW++G+ LWE+FS+G +PY  +   +++  +  G  L  P  CP  +Y++M  CW+     RP+FA +   ++R+   L+ 
Sbjct:   11 EAALMAEFTHPNIVKLLGVCAVGKPFCLLFEFMPHGDLNEYLRRCSSEAGLAASSPPARAPTSSGSEPVSLCCADKLFVATQVAAGMAYLAERKFVHRDLATRNCLVGNRLVVKISDFGLSQSI-YAADYYKANENDAIPIRWMPPESIFYNRYTSESDVWAFGVVLWEIFSHGLQPYFGMSHEEVIYFVRDGNVLACPDGCPLDLYNLMRLCWAHAPADRPSFASVQHVLARMHAQLTA 249          
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Match: frk (fyn-related Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-110411-7])

HSP 1 Score: 179.874 bits (455), Expect = 8.667e-50
Identity = 92/231 (39.83%), Postives = 136/231 (58.87%), Query Frame = 2
Query: 1622 ETIPVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQ-ILLILELAPLGPINKYLRRNQS--LSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAEL 2305
            +T  VAVK LK      +   E + EA  M +  H ++++L  VC  E+ I +I EL   G + +YL+ ++   L    LI +  QV+ GMAYLEA  ++HRDLAARN+L+ +    K++DFG+++ +    D Y A   GK+P+KW APE   Y RF  KSDVWS+GI L+E+ +YG+ PY  +   ++L  L+ G R+  P NCP   Y +M  CW  +   RP+F +L
Sbjct:  144 KTTRVAVKTLKP---GAMVPEEFLAEAHIMKRFTHCNLIQLYAVCTTEEPIYIITELMVNGSLLQYLQNDEGGVLKMCHLINMAVQVASGMAYLEAQNYIHRDLAARNILVGDNLTCKVADFGLARVIK--DDEYIAREGGKFPVKWTAPEAANYSRFTIKSDVWSFGILLYEIVTYGKVPYAGMTNAEVLEELEHGYRMPCPTNCPRDFYSIMYNCWHKEEACRPSFLQL 369          

HSP 2 Score: 51.2174 bits (121), Expect = 7.320e-7
Identity = 33/93 (35.48%), Postives = 50/93 (53.76%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLRESVN--GNYVISICHCN-----KVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTL 340
            +F GKI+R  A  LL+++G   G FL+RES +  G Y +S+   +     +V HY+I+    G F I     F    +LV HH+L  +G  +L
Sbjct:    1 WFFGKISRADAVKLLLARGNDHGSFLIRESESKHGAYALSVSEWDALQGVEVRHYHIQPLEGGGFTINKRAAFSTLQDLVRHHVLEANGLKSL 93          
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Match: BCK1 (MAPKKK acting in the protein kinase C signaling pathway; the kinase C signaling pathway controls cell integrity; upon activation by Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p; MAPKKK is an acronym for mitogen-activated protein (MAP) kinase kinase kinase [Source:SGD;Acc:S000003631])

HSP 1 Score: 88.1965 bits (217), Expect = 3.535e-18
Identity = 64/218 (29.36%), Postives = 107/218 (49.08%), Query Frame = 2
Query: 1688 IMEEARTMSQLRHKHIVRLIGVCKCEQIL-LILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYY-RAAAAGKWPLKWYAPECIYYFR-FDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQ--------CWSTDGVRRPTFAELV 2308
            +  E  T+  L H +IV+ +G      I  L LE    G +   +R      E  +  L +QV +G+AYL +   +HRD+ A N+LL  +   KISDFG+S+     +D Y  +    +  + W APE +   + + +K D+WS G  + E+F+ G+RP+ +L+   + +M   G+    P   PE    ++ Q        C+  +  +RPT  EL+
Sbjct: 1225 LRSEVSTLKDLDHLNIVQYLGFENKNNIYSLFLEYVAGGSVGSLIRMYGRFDEPLIKHLTTQVLKGLAYLHSKGILHRDMKADNLLLDQDGICKISDFGISRK---SKDIYSNSDMTMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCIVLEMFA-GKRPWSNLE--VVAAMFKIGKSKSAPP-IPEDTLPLISQIGRNFLDACFEINPEKRPTANELL 1435          
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 87.0409 bits (214), Expect = 8.275e-18
Identity = 62/227 (27.31%), Postives = 112/227 (49.34%), Query Frame = 2
Query: 1634 VAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIG-VCKCEQILLILELAPLGPINKYLRRNQS-LSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELV 2308
            VA+K +  E   ++  ++IM E   +  L H +IV+  G + K  ++ ++LE    G + + + R+ + LSE      ++Q   G+ YL     +HRD+ A N+LL  ++  K++DFG+S  +N       +A      L W APE +      + SD+WS G T+ E+ +    PY +L    I   + +      P +  E + D + +C+  +  +RPT  +L+
Sbjct:   51 VAIKEVVYENDEEL--NDIMAEISLLKNLNHNNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIVN------SSALTLAGTLNWMAPEILGNRGASTLSDIWSLGATVVEMLTKNP-PYHNLTDANIYYAV-ENDTYYPPSSFSEPLKDFLSKCFVKNMYKRPTADQLL 267          
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Match: STE11 (Signal transducing MEK kinase; involved in pheromone response and pseudohyphal/invasive growth pathways where it phosphorylates Ste7p, and the high osmolarity response pathway, via phosphorylation of Pbs2p; regulated by Ste20p and Ste50p; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004354])

HSP 1 Score: 79.7221 bits (195), Expect = 1.052e-15
Identity = 53/219 (24.20%), Postives = 99/219 (45.21%), Query Frame = 2
Query: 1655 KEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCK-CEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELV 2308
            + +H K+    +  E   + +L H++IV   G  +    + + LE  P G ++  L       E  +     Q+  G+AYL     +HRD+   N+L+  +   KI+DFG+SK L+         A+ +  + W +PE +      +K+D+WS G  + E+F+ G+ P+ D    Q +  +      + P        + + + +  D   RP+  EL+
Sbjct:  491 QNIHRKM-VDALQHEMNLLKELHHENIVTYYGASQEGGNLNIFLEYVPGGSVSSMLNNYGPFEESLITNFTRQILIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNKKQNKRASLQGSVFWMSPEVVKQTATTAKADIWSTGCVVIEMFT-GKHPFPDFSQMQAIFKIGTNTTPEIPSWATSEGKNFLRKAFELDYQYRPSALELL 707          
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Match: KIN2 (Serine/threonine protein kinase involved in regulation of exocytosis; localizes to the cytoplasmic face of the plasma membrane; KIN2 has a paralog, KIN1, that arose from the whole genome duplication [Source:SGD;Acc:S000004086])

HSP 1 Score: 78.5666 bits (192), Expect = 3.610e-15
Identity = 54/216 (25.00%), Postives = 100/216 (46.30%), Query Frame = 2
Query: 1685 EIMEEARTMSQ------LRHKHIVRLIGVCK-CEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDS-KSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELV 2308
            EI  + RT+ +      L H HI RL  +C       ++ E    G +  Y+ ++ SL E    +    ++  + YL A+  VHRDL   N+++ +    KI DFG+S   +Y +  +    +    L + APE +    +   + D+WS+GI L+ V   G+ P+ D   + +   + +G ++  P +    +  ++ +    D +RR T   +V
Sbjct:  163 EIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYIIQHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISSSGEIKIIDFGLSNIFDYRKQLHTFCGS----LYFAAPELLKAQPYTGPEVDIWSFGIVLY-VLVCGKVPFDDENSSILHEKIKKG-KVDYPSHLSIEVISLLTRMIVVDPLRRATLKNVV 372          
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Match: TPK2 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk3p; localizes to P-bodies during stationary phase; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000006124])

HSP 1 Score: 73.559 bits (179), Expect = 3.638e-14
Identity = 56/223 (25.11%), Postives = 102/223 (45.74%), Query Frame = 2
Query: 1637 AVKMLKKEMHSKIGAHEIMEEARTMSQL-RHKHIVRLIGVCK-CEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPL----KWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRR 2287
            A+K+LKK+   K+   E   + R M +L  H  ++R+ G  +    I ++++    G +   LR++Q           ++V   + YL A   ++RDL   N+LL    + KI+DFG +K +              W L     + APE I    ++   D WS G+ ++E+ + G  P+ D    +    + QG+ +  P   P+ + D++ +  + D  RR
Sbjct:   97 AIKVLKKQQVVKMKQVEHTNDERRMLKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAKEVQ----------TVTWTLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIYEMLA-GYTPFYDTTPMKTYEKILQGKVVYPPYFHPDVV-DLLSKLITADLTRR 307          
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Match: EDO31298 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYB5])

HSP 1 Score: 268.085 bits (684), Expect = 1.243e-82
Identity = 134/261 (51.34%), Postives = 184/261 (70.50%), Query Frame = 2
Query: 1523 SFNLPIDKIEIKQKLXXXXXXXXXXXXXKINLLETIPVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAEL 2305
            +F L ++ + + ++LG GNFG V  G YK+   E IPVAVK LK +  +   + EI+ EAR M +L H +IVR+IG+C+   ++L++ELA  GP+NKYL++N+ +   +++ LM QV+ GM YLE+ +FVHRDLAARNVL+VN+ + KISDFGMS+A+  G DYY+A  AG+WPLKWYAPECIY+ +F SKSDVWSYGITLWE  SYG RPY+ L G  IL  ++ G RL  P   P  +Y +M  CW  +   RP+F ++
Sbjct:   18 TFELKMENLSLGKELGHGNFGSVLKGTYKMPNGERIPVAVKSLKSDDINNPKS-EILHEARVMMELDHPYIVRIIGMCQGPSMMLVMELAGEGPLNKYLKKNKGMPLLNILVLMLQVAEGMQYLESLQFVHRDLAARNVLVVNDSFVKISDFGMSRAMGAGSDYYKAGTAGRWPLKWYAPECIYFRKFSSKSDVWSYGITLWEATSYGARPYQSLSGQAILEKIESGYRLPAPAKLPSCVYQLMKDCWQWEQDDRPSFMQI 277          
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Match: EDO49804 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFY7])

HSP 1 Score: 187.963 bits (476), Expect = 2.461e-54
Identity = 91/215 (42.33%), Postives = 137/215 (63.72%), Query Frame = 2
Query: 1625 TIPVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQ-SLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCW 2266
            TIPVAVKM+K    S+    + +EEA+ M Q +H ++V+L G+C  + I +I EL   G +  YLR++Q  L    + E++ QV+  M YLE+  F+HRDLAARN L+      K++DFG+++ +    D Y A+   K+P+KW APE I Y +F SKSDVW++GI  WEV++ G++PY     T ++ M+  G RL+KP+ CP++ Y  M +CW
Sbjct:    5 TIPVAVKMMKDGAMSE---EDFIEEAKVMKQFQHGNLVQLYGICSEKPIYIIQELMKGGCLLHYLRKSQFKLQSAEMTEMVRQVAAAMKYLESHNFIHRDLAARNCLIGENRTVKVADFGLARYVI--DDEYTASEGTKFPIKWAAPEVILYSKFSSKSDVWAFGILAWEVYTGGKQPYPATNNTDVVQMVINGYRLEKPLRCPDAAYSTMRKCW 214          
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Match: EDO47802 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL50])

HSP 1 Score: 190.66 bits (483), Expect = 8.888e-53
Identity = 102/248 (41.13%), Postives = 146/248 (58.87%), Query Frame = 2
Query: 1628 IPVAVKMLKKEMHSKI--GAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRN-QSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQ--GQRLKKPINCPESIYDVMLQ-CWSTDGVRRPTFAELVMTMSRIQVGLSTGIH 2353
            + VAVK LK    +       + ++EA +M+ L H HI+RL G+     ++L+ ELAPLG +   LR N Q     +L + M QV+ GMAYLE+ +F+HRDLAARNVLL +    KI DFG+ +AL+   DYY     GK P  W  PE + Y +F   SDVWS+GI + E+FSYGE P+  L G QIL+ +D    +R  KP +CP  IY +++  CW+ D   R  F+EL  ++ +++      +H
Sbjct:  143 VDVAVKCLKFSADAAFIQMQTDFIKEANSMALLDHPHIIRLFGIVLSTPMMLVTELAPLGCLLTALRNNRQRFMVSTLCDFMIQVASGMAYLESKRFIHRDLAARNVLLESNEKVKIGDFGLMRALSVEDDYYTMNPKGKVPFAWCPPEALKYRKFSHASDVWSFGICVIELFSYGEEPWPGLNGAQILAKVDMPLCERPLKPSHCPSLIYSLLVSLCWAHDPSNRAGFSELKKSLEQVRPHDVRAVH 390          
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Match: EDO40994 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5K8])

HSP 1 Score: 184.496 bits (467), Expect = 6.662e-51
Identity = 94/232 (40.52%), Postives = 141/232 (60.78%), Query Frame = 2
Query: 1625 TIPVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVC-KCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQ---VSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELV 2308
            TIPVA+K LK+   SK    + + EA  M Q    +++ L GV  K   ++++ E    G ++ +L++  S  + SLI+LM     ++ GM YL    FVHRDLAARN+L+      K++DFG+S+ L   +D     + GK P++W APE I Y +F + SDVWSYGI LWE FS+ ERPY D    +++  ++ G RL  P++CP+ I+ +ML+CW  D  +RP+FA +V
Sbjct:   84 TIPVAIKTLKQGSTSK-NRGDFLSEASVMGQFCDPNVIFLEGVVSKTHPLMIVTEFMSNGSLDNFLKKMDS--KLSLIQLMGMARGIASGMKYLSEMNFVHRDLAARNILVTETLVCKVADFGLSREL---EDSAYETSGGKIPVRWTAPEAIKYRKFSTSSDVWSYGILLWETFSFAERPYWDWSNFEVMDRVETGYRLPPPMSCPKVIHQIMLECWDADRTKRPSFALIV 309          
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Match: EDO37886 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEI8])

HSP 1 Score: 179.874 bits (455), Expect = 1.828e-50
Identity = 102/254 (40.16%), Postives = 151/254 (59.45%), Query Frame = 2
Query: 1622 ETIPVAVKMLKKEMHSKIGAHEIMEEARTMSQL-RHKHIVRLIGVC-KCEQILLILELAPLGPINKYLRRNQSLSE----------QSLIELMSQV------SRGMAYLEASKFVHRDLAARNVLLVNEHYA-KISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTMSRI 2326
            E   VAVKMLK E  S+    ++  E + M  L  HK+I+ L+G C + E ++LILE A  G + ++LR  + + E          ++   L  QV      ++GM +L + K +HRDLAARNVL V+E YA KI DFG+++ + Y  D Y    AG  P+KW APE ++   + SK+DVW++G+ LWE+ + G  PY  +   Q+L  +++G+R+ +P +CP  IY +M  CWS +  RRPTFAELV  + RI
Sbjct:   48 EATTVAVKMLK-ENASESDYKDLASELKIMIHLGEHKNIINLLGACTRGENLMLILEYAKHGNLLQFLRTRRDIYEPTWKKTTFNPKTEFTLADQVVDAYQIAQGMDFLASKKCIHRDLAARNVL-VDEGYALKIGDFGLARDI-YKTDLYVKKGAGLLPVKWMAPEALFDREYSSKTDVWAFGVVLWEILTLGGSPYPGVPLEQLLDYINEGKRMAQPRDCPPEIYAIMCDCWSLEQDRRPTFAELVRRIERI 298          
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Match: syk (spleen associated tyrosine kinase [Source:NCBI gene;Acc:101155127])

HSP 1 Score: 283.878 bits (725), Expect = 3.059e-84
Identity = 121/223 (54.26%), Postives = 171/223 (76.68%), Query Frame = 2
Query: 1631 PVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFA 2299
            PVAVK+LK + ++     E++ EA  M QL + +IVR+IG+C+ E ++L++ELA LGP+NK+L++N+  S +++ EL+ QVS GM YLE   FVHRDLAARNVLLV +HYAKISDFG+SKA+    +YY+A   GKWP+KWYAPECI YF+F SKSDVWS+G+ +WE FSYG++PYK +KG  ++ ML+ G+R++ P+ CP+ +Y++ML CW+     RP+FA
Sbjct:  340 PVAVKILKNDDNNPSVREEMLREASVMQQLDNPYIVRMIGICEAENLMLVMELADLGPLNKFLQKNKHASTKNITELVHQVSMGMKYLEEHNFVHRDLAARNVLLVTQHYAKISDFGLSKAIAEEHNYYKAKGHGKWPVKWYAPECINYFKFSSKSDVWSFGVLMWEAFSYGQKPYKGMKGNDVMQMLEGGRRMEAPVGCPQEMYEMMLSCWTYKVDERPSFA 562          

HSP 2 Score: 127.102 bits (318), Expect = 5.051e-30
Identity = 79/247 (31.98%), Postives = 134/247 (54.25%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLRESVN--GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGVKSSFFEDCIKKKALEMGFKDS-----SSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFXXXXXXXXXXXNAGHTEGQFLVRQRKGDCGFVLSISVQNQPKHYKI-INKFDKLHIEGGQYFDSLIELIDHYYFRQDGLL 799
            +F+G I R+ AED L   G   G++LLR+S N  G + +S+ +     HY IEK+ + T+ I  G+ +  P+++++HH    DG + L + P  R P           K   FED +K+K +    K +     +++E+ +    R  L+ ++    H S PWFH  + R E+  RL++     G+FL+RQR  +  + L +  + +  HY+I  ++ DKL I  G+ FD+L +L++HY ++ DGLL
Sbjct:   10 FFYGNIAREEAEDYLRQAGMSNGLYLLRQSRNYLGGFALSVANAKHCYHYTIEKKPNETYAIAGGKSYRSPVDVIDHHSQETDGLVCLLKKPCNR-PKNMQ------PKVGPFED-LKEKLIREYVKQTWNLRGAALEQAIIS-QRPQLEKLIATTAHESMPWFHGAISREESAARLQSGSRNNGKFLIRQRNENGSYALCLLHEGEVIHYRIDRDRKDKLSIPDGKQFDTLWQLVEHYSYKPDGLL 247          

HSP 3 Score: 56.225 bits (134), Expect = 1.335e-7
Identity = 31/94 (32.98%), Postives = 49/94 (52.13%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLRE-SVNGNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLER 361
            +FHG I+R+ +   L S     G FL+R+ + NG+Y + + H  +V HY I++       I  G++F    +LVEH+    DG L +   P  R
Sbjct:  163 WFHGAISREESAARLQSGSRNNGKFLIRQRNENGSYALCLLHEGEVIHYRIDRDRKDKLSIPDGKQFDTLWQLVEHYSYKPDGLLRVLTEPSPR 256          
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Match: syk (spleen associated tyrosine kinase [Source:NCBI gene;Acc:101155127])

HSP 1 Score: 284.263 bits (726), Expect = 4.311e-84
Identity = 121/223 (54.26%), Postives = 171/223 (76.68%), Query Frame = 2
Query: 1631 PVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFA 2299
            PVAVK+LK + ++     E++ EA  M QL + +IVR+IG+C+ E ++L++ELA LGP+NK+L++N+  S +++ EL+ QVS GM YLE   FVHRDLAARNVLLV +HYAKISDFG+SKA+    +YY+A   GKWP+KWYAPECI YF+F SKSDVWS+G+ +WE FSYG++PYK +KG  ++ ML+ G+R++ P+ CP+ +Y++ML CW+     RP+FA
Sbjct:  366 PVAVKILKNDDNNPSVREEMLREASVMQQLDNPYIVRMIGICEAENLMLVMELADLGPLNKFLQKNKHASTKNITELVHQVSMGMKYLEEHNFVHRDLAARNVLLVTQHYAKISDFGLSKAIAEEHNYYKAKGHGKWPVKWYAPECINYFKFSSKSDVWSFGVLMWEAFSYGQKPYKGMKGNDVMQMLEGGRRMEAPVGCPQEMYEMMLSCWTYKVDERPSFA 588          

HSP 2 Score: 127.872 bits (320), Expect = 4.219e-30
Identity = 79/247 (31.98%), Postives = 134/247 (54.25%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLRESVN--GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGVKSSFFEDCIKKKALEMGFKDS-----SSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFXXXXXXXXXXXNAGHTEGQFLVRQRKGDCGFVLSISVQNQPKHYKI-INKFDKLHIEGGQYFDSLIELIDHYYFRQDGLL 799
            +F+G I R+ AED L   G   G++LLR+S N  G + +S+ +     HY IEK+ + T+ I  G+ +  P+++++HH    DG + L + P  R P           K   FED +K+K +    K +     +++E+ +    R  L+ ++    H S PWFH  + R E+  RL++     G+FL+RQR  +  + L +  + +  HY+I  ++ DKL I  G+ FD+L +L++HY ++ DGLL
Sbjct:   10 FFYGNIAREEAEDYLRQAGMSNGLYLLRQSRNYLGGFALSVANAKHCYHYTIEKKPNETYAIAGGKSYRSPVDVIDHHSQETDGLVCLLKKPCNR-PKNMQ------PKVGPFED-LKEKLIREYVKQTWNLRGAALEQAIIS-QRPQLEKLIATTAHESMPWFHGAISREESAARLQSGSRNNGKFLIRQRNENGSYALCLLHEGEVIHYRIDRDRKDKLSIPDGKQFDTLWQLVEHYSYKPDGLL 247          

HSP 3 Score: 56.6102 bits (135), Expect = 1.206e-7
Identity = 31/94 (32.98%), Postives = 49/94 (52.13%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLRE-SVNGNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLER 361
            +FHG I+R+ +   L S     G FL+R+ + NG+Y + + H  +V HY I++       I  G++F    +LVEH+    DG L +   P  R
Sbjct:  163 WFHGAISREESAARLQSGSRNNGKFLIRQRNENGSYALCLLHEGEVIHYRIDRDRKDKLSIPDGKQFDTLWQLVEHYSYKPDGLLRVLTEPSPR 256          
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Match: syk (spleen associated tyrosine kinase [Source:NCBI gene;Acc:101155127])

HSP 1 Score: 283.878 bits (725), Expect = 7.402e-84
Identity = 121/223 (54.26%), Postives = 171/223 (76.68%), Query Frame = 2
Query: 1631 PVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFA 2299
            PVAVK+LK + ++     E++ EA  M QL + +IVR+IG+C+ E ++L++ELA LGP+NK+L++N+  S +++ EL+ QVS GM YLE   FVHRDLAARNVLLV +HYAKISDFG+SKA+    +YY+A   GKWP+KWYAPECI YF+F SKSDVWS+G+ +WE FSYG++PYK +KG  ++ ML+ G+R++ P+ CP+ +Y++ML CW+     RP+FA
Sbjct:  387 PVAVKILKNDDNNPSVREEMLREASVMQQLDNPYIVRMIGICEAENLMLVMELADLGPLNKFLQKNKHASTKNITELVHQVSMGMKYLEEHNFVHRDLAARNVLLVTQHYAKISDFGLSKAIAEEHNYYKAKGHGKWPVKWYAPECINYFKFSSKSDVWSFGVLMWEAFSYGQKPYKGMKGNDVMQMLEGGRRMEAPVGCPQEMYEMMLSCWTYKVDERPSFA 609          

HSP 2 Score: 127.487 bits (319), Expect = 6.682e-30
Identity = 79/247 (31.98%), Postives = 134/247 (54.25%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLRESVN--GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGVKSSFFEDCIKKKALEMGFKDS-----SSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFXXXXXXXXXXXNAGHTEGQFLVRQRKGDCGFVLSISVQNQPKHYKI-INKFDKLHIEGGQYFDSLIELIDHYYFRQDGLL 799
            +F+G I R+ AED L   G   G++LLR+S N  G + +S+ +     HY IEK+ + T+ I  G+ +  P+++++HH    DG + L + P  R P           K   FED +K+K +    K +     +++E+ +    R  L+ ++    H S PWFH  + R E+  RL++     G+FL+RQR  +  + L +  + +  HY+I  ++ DKL I  G+ FD+L +L++HY ++ DGLL
Sbjct:   10 FFYGNIAREEAEDYLRQAGMSNGLYLLRQSRNYLGGFALSVANAKHCYHYTIEKKPNETYAIAGGKSYRSPVDVIDHHSQETDGLVCLLKKPCNR-PKNMQ------PKVGPFED-LKEKLIREYVKQTWNLRGAALEQAIIS-QRPQLEKLIATTAHESMPWFHGAISREESAARLQSGSRNNGKFLIRQRNENGSYALCLLHEGEVIHYRIDRDRKDKLSIPDGKQFDTLWQLVEHYSYKPDGLL 247          

HSP 3 Score: 56.225 bits (134), Expect = 1.434e-7
Identity = 31/94 (32.98%), Postives = 49/94 (52.13%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLRE-SVNGNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLER 361
            +FHG I+R+ +   L S     G FL+R+ + NG+Y + + H  +V HY I++       I  G++F    +LVEH+    DG L +   P  R
Sbjct:  163 WFHGAISREESAARLQSGSRNNGKFLIRQRNENGSYALCLLHEGEVIHYRIDRDRKDKLSIPDGKQFDTLWQLVEHYSYKPDGLLRVLTEPSPR 256          
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Match: zap70 (tyrosine-protein kinase ZAP-70 [Source:NCBI gene;Acc:101170171])

HSP 1 Score: 263.077 bits (671), Expect = 1.748e-76
Identity = 117/240 (48.75%), Postives = 171/240 (71.25%), Query Frame = 2
Query: 1628 IPVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLR-RNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTMSRIQVGLST 2344
            + VAVK+LK E + K+   E+M EA  M QL +  IVR++G+C+ + ++L++E+A  GP+NK+L  +   ++ ++++ L+ QVS GM YLE   FVHRDLAARNVLLVN+ +AKISDFG+SKAL    +YY+A  AGKWPLKWYAPECI + +F SKSDVWS+G+T+WE F+YG +PYK +KG +++S +  G R++KP  CP+ +Y VM++CW+     RP F ++  +M      +S 
Sbjct:  342 VDVAVKVLKSE-NEKLVKDEMMREAEIMHQLSNPFIVRMLGLCQGDNLMLVMEMAAAGPLNKFLSTKKDVITVENIVNLLHQVSMGMKYLEEKNFVHRDLAARNVLLVNQQFAKISDFGLSKALGADDNYYKARTAGKWPLKWYAPECINFHKFSSKSDVWSFGVTMWEAFTYGGKPYKKMKGPEVISFIKNGNRMEKPPACPDRMYAVMMECWTYSHEERPDFKKVEESMRTYHYSISN 580          

HSP 2 Score: 110.923 bits (276), Expect = 9.311e-25
Identity = 86/270 (31.85%), Postives = 137/270 (50.74%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLRESVN--GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGVKSSFFEDCIKKKALEMGFKDSSSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFXXXXXXXXXXXNAGHTEGQFLVRQRKGDCGFVLSISVQNQPKHYKII-NKFDKLHIEGGQYFDSLIELIDHYYFRQDGLLCKLRFGIECP-GFIRSKAEFLQSLNQSS 880
            +F+G I+R  AE  L   G  +G+FLLR  +   G YV+S+    + +HY+IEKQ +GT+ I  G+   GP EL E +    DG + + R P  R P   +  I  GV      + +++   +    +  ++E+ +     Q L+ ++    H   PWFH  + R E E RL +    +G+FLVR+R     F LS+       HY+I+ +K  KL +  G  FD+L +L+++   + DGL+  L  G  C  G +  + E   SLN+ S
Sbjct:   11 FFYGSISRSDAEQQLKLGGMADGLFLLRHCLRNLGGYVLSVVWNLEFHHYSIEKQLNGTYCIAGGKPHCGPAELCEFYSKDPDGLVCILRKPCLRPP---NTPIKMGVFDKIRVNMLREYVRQTWNLEGEAMEQAIISQAPQ-LEKLIATTAHEKMPWFHGKINRHEGERRLYSGAQPDGKFLVRERDEPGTFALSVVYGKTVYHYQIVQDKSGKLSVPEGTKFDTLWQLVEYLKMKPDGLVIVL--GEACTNGRVSERTEPF-SLNRRS 273          
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Match: zap70 (tyrosine-protein kinase ZAP-70 [Source:NCBI gene;Acc:101170171])

HSP 1 Score: 263.077 bits (671), Expect = 9.292e-76
Identity = 117/239 (48.95%), Postives = 171/239 (71.55%), Query Frame = 2
Query: 1628 IPVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLR-RNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTMSRIQVGLS 2341
            + VAVK+LK E + K+   E+M EA  M QL +  IVR++G+C+ + ++L++E+A  GP+NK+L  +   ++ ++++ L+ QVS GM YLE   FVHRDLAARNVLLVN+ +AKISDFG+SKAL    +YY+A  AGKWPLKWYAPECI + +F SKSDVWS+G+T+WE F+YG +PYK +KG +++S +  G R++KP  CP+ +Y VM++CW+     RP F ++  +M      +S
Sbjct:  417 VDVAVKVLKSE-NEKLVKDEMMREAEIMHQLSNPFIVRMLGLCQGDNLMLVMEMAAAGPLNKFLSTKKDVITVENIVNLLHQVSMGMKYLEEKNFVHRDLAARNVLLVNQQFAKISDFGLSKALGADDNYYKARTAGKWPLKWYAPECINFHKFSSKSDVWSFGVTMWEAFTYGGKPYKKMKGPEVISFIKNGNRMEKPPACPDRMYAVMMECWTYSHEERPDFKKVEESMRTYHYSIS 654          

HSP 2 Score: 111.694 bits (278), Expect = 8.644e-25
Identity = 78/245 (31.84%), Postives = 126/245 (51.43%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLRESVN--GNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGVKSSFFEDCIKKKALEMGFKDSSSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFXXXXXXXXXXXNAGHTEGQFLVRQRKGDCGFVLSISVQNQPKHYKII-NKFDKLHIEGGQYFDSLIELIDHYYFRQDGLLCKL 808
            +F+G I+R  AE  L   G  +G+FLLR  +   G YV+S+    + +HY+IEKQ +GT+ I  G+   GP EL E +    DG + + R P  R P   +  I  GV      + +++   +    +  ++E+ +     Q L+ ++    H   PWFH  + R E E RL +    +G+FLVR+R     F LS+       HY+I+ +K  KL +  G  FD+L +L+++   + DGL+  L
Sbjct:   86 FFYGSISRSDAEQQLKLGGMADGLFLLRHCLRNLGGYVLSVVWNLEFHHYSIEKQLNGTYCIAGGKPHCGPAELCEFYSKDPDGLVCILRKPCLRPP---NTPIKMGVFDKIRVNMLREYVRQTWNLEGEAMEQAIISQAPQ-LEKLIATTAHEKMPWFHGKINRHEGERRLYSGAQPDGKFLVRERDEPGTFALSVVYGKTVYHYQIVQDKSGKLSVPEGTKFDTLWQLVEYLKMKPDGLVIVL 326          
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Match: SMESG000064511.1 (SMESG000064511.1)

HSP 1 Score: 1614.36 bits (4179), Expect = 0.000e+0
Identity = 810/826 (98.06%), Postives = 810/826 (98.06%), Query Frame = 2
Query:   50 MSQGKSPFNILYFHGKITRDRAEDLLMSQGAIEGMFLLRESVNGNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGVKSSFFEDCIKKKALEMGFKDSSSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFXXXXXXXXXXXNAGHTEGQFLVRQRKGDCGFVLSISVQNQPKHYKIINKFDKLHIEGGQYFDSLIELIDHYYFRQDGLLCKLRFGIECPGFIRSKAEFLQSLNQSSVESAHSTICGMQNAARIQRTAVKTDLSRIVTDKYRDMSINSIFRQKKSDMISVSSDLISFSEWSTNLPRLLNEPVSASLNNLNKELFYPNSITTKNVFQWNNSISSSTQSFVNDTRQTNDTPKVSENVITLEYKDNILDQSLNEPQITDQLWSEPEIASSRQVISPSLEVEISRNRIKSSSMPPKLQPWDLGILDPMLAVETQKIYDSLSLNDISFNLPIDKIEIKQKLXXXXXXXXXXXXXKINLLETIPVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTMSRIQVGLSTGIHELAEQTNYLANSSGSSVAKTSYGSSECSQFPSPPISLKENEIWSKESVSTNNREFGDW 2527
            MSQGKSPFNILYFHGKITRDRAEDLLMSQGAIEGMFLLRESVNGNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGVKSSFFEDCIKKKALEMGFKDSSSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFLRRLEAEERLENAGHTEGQFLVRQRKGDCGFVLSISVQNQPKHYKIINKFDKLHIEGGQYFDSLIELIDHYYFRQDGLLCKLRFGIECPGFIRSKAEFLQSLNQSSVESAHSTICGMQNAARIQRTAVKTDLSRIVTDKYRDMSINSIFRQKKSDMISVSSDLISFSEWSTNLPRLLNEPVSASLNNLNKELFYPNSITTKNVFQWNNSISSSTQSFVNDTRQTNDTPKVSENVITLEYKDNILDQSLNEPQITDQLWSEPEIASSRQVISPSLEVEISRNRIKSSSMPPKLQPWDLGILDPMLAVETQKIYDSLSLNDISFNLPIDKIEIKQKLGGGNFGYVYGGFYKINLLETIPVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSR               AARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTMSRIQVGLSTGIHELAEQTNYLANSSGSSVAKTSYGSSECSQFPSPPISLKENEIWSKESVSTNN EFGDW
Sbjct:    1 MSQGKSPFNILYFHGKITRDRAEDLLMSQGAIEGMFLLRESVNGNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGVKSSFFEDCIKKKALEMGFKDSSSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFLRRLEAEERLENAGHTEGQFLVRQRKGDCGFVLSISVQNQPKHYKIINKFDKLHIEGGQYFDSLIELIDHYYFRQDGLLCKLRFGIECPGFIRSKAEFLQSLNQSSVESAHSTICGMQNAARIQRTAVKTDLSRIVTDKYRDMSINSIFRQKKSDMISVSSDLISFSEWSTNLPRLLNEPVSASLNNLNKELFYPNSITTKNVFQWNNSISSSTQSFVNDTRQTNDTPKVSENVITLEYKDNILDQSLNEPQITDQLWSEPEIASSRQVISPSLEVEISRNRIKSSSMPPKLQPWDLGILDPMLAVETQKIYDSLSLNDISFNLPIDKIEIKQKLGGGNFGYVYGGFYKINLLETIPVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSR---------------AARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTMSRIQVGLSTGIHELAEQTNYLANSSGSSVAKTSYGSSECSQFPSPPISLKENEIWSKESVSTNNHEFGDW 811          
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Match: SMESG000064511.1 (SMESG000064511.1)

HSP 1 Score: 1598.56 bits (4138), Expect = 0.000e+0
Identity = 809/845 (95.74%), Postives = 810/845 (95.86%), Query Frame = 2
Query:   50 MSQGKSPFNILYFHGKITRDRAEDLLMSQGAIEGMFLLRESVNGNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGVKSSFFEDCIKKKALEMGFKDSSSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFXXXXXXXXXXXNAGHTEGQFLVRQRKGDCGFVLSISVQNQPKHYKIINKFDKLHIEGGQYFDSLIELIDHYYFRQDGLLCKLRFGIECPGFIRSKAEFLQSLNQSSVESAHSTICGMQNAARIQRTAVKTDLSRIVTDKYRDMSINSIFRQKKSDMISVSSDLISFSEWSTNLPRLLNEPVSASLNNLNKELFYPNSITTKNVFQWNNSISSSTQSFVNDTRQTNDTPKVSENVITLEYKDNILDQSLNEPQITDQLWSEPEI-------------------ASSRQVISPSLEVEISRNRIKSSSMPPKLQPWDLGILDPMLAVETQKIYDSLSLNDISFNLPIDKIEIKQKLXXXXXXXXXXXXXKINLLETIPVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTMSRIQVGLSTGIHELAEQTNYLANSSGSSVAKTSYGSSECSQFPSPPISLKENEIWSKESVSTNNREFGDW 2527
            MSQGKSPFNILYFHGKITRDRAEDLLMSQGAIEGMFLLRESVNGNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGVKSSFFEDCIKKKALEMGFKDSSSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFLRRLEAEERLENAGHTEGQFLVRQRKGDCGFVLSISVQNQPKHYKIINKFDKLHIEGGQYFDSLIELIDHYYFRQDGLLCKLRFGIECPGFIRSKAEFLQSLNQSSVESAHSTICGMQNAARIQRTAVKTDLSRIVTDKYRDMSINSIFRQKKSDMISVSSDLISFSEWSTNLPRLLNEPVSASLNNLNKELFYPNSITTKNVFQWNNSISSSTQSFVNDTRQTNDTPKVSENVITLEYKDNILDQSLNEPQITDQLWSEPEI                   +SSRQVISPSLEVEISRNRIKSSSMPPKLQPWDLGILDPMLAVETQKIYDSLSLNDISFNLPIDKIEIKQKLGGGNFGYVYGGFYKINLLETIPVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSR               AARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTMSRIQVGLSTGIHELAEQTNYLANSSGSSVAKTSYGSSECSQFPSPPISLKENEIWSKESVSTNN EFGDW
Sbjct:    1 MSQGKSPFNILYFHGKITRDRAEDLLMSQGAIEGMFLLRESVNGNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGVKSSFFEDCIKKKALEMGFKDSSSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFLRRLEAEERLENAGHTEGQFLVRQRKGDCGFVLSISVQNQPKHYKIINKFDKLHIEGGQYFDSLIELIDHYYFRQDGLLCKLRFGIECPGFIRSKAEFLQSLNQSSVESAHSTICGMQNAARIQRTAVKTDLSRIVTDKYRDMSINSIFRQKKSDMISVSSDLISFSEWSTNLPRLLNEPVSASLNNLNKELFYPNSITTKNVFQWNNSISSSTQSFVNDTRQTNDTPKVSENVITLEYKDNILDQSLNEPQITDQLWSEPEIVCKFFKSANFPVREFSGYHSSSRQVISPSLEVEISRNRIKSSSMPPKLQPWDLGILDPMLAVETQKIYDSLSLNDISFNLPIDKIEIKQKLGGGNFGYVYGGFYKINLLETIPVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSR---------------AARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTMSRIQVGLSTGIHELAEQTNYLANSSGSSVAKTSYGSSECSQFPSPPISLKENEIWSKESVSTNNHEFGDW 830          
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Match: SMESG000043611.1 (SMESG000043611.1)

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 426/861 (49.48%), Postives = 554/861 (64.34%), Query Frame = 2
Query:   50 MSQGKSPFNILYFHGKITRDRAEDLLMSQGAIEGMFLLRESVNGNYVISICHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARLPLERYPAGTSYYILQGVKSSFFEDCIKKKALEMGFKDSSSIEEVLNGPMRQHLKHMVLKDLHFSQPWFHHFXXXXXXXXXXXNAGHTEGQFLVRQRKGDCGFVLSISVQNQPKHYKIINKFDKLHIEGGQYFDSLIELIDHYYFRQDGLLCKLRFGIECPGF--IRSKAEFLQSLNQSSVESAHS-TICGMQNAARIQRTAVKTDLSRIVTDKYRDMSINSIFRQK-------------KSDMISVSSDLISFSEW------------------------------STNLPRLLNEPVSASLNNL--NKEL-----------FYPNSITTKNVFQWNNS-----------ISSSTQSF-----VNDTRQT--NDTPKVSENVITLEYKDNILDQSLNEPQITDQLWSEPEIASSRQVISPSLEVEISRNRIKSSSMPPKLQPWDLGILDPMLAVETQKIYDSLSLNDISFNLPIDKIEIKQKLXXXXXXXXXXXXXKI-NLLETIPVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTMSRIQVGLSTGIHELAEQTNYLANSSGS 2398
            M+Q  SP ++ Y+HG+ITRD+AE+LLM +G  E +FLLRESVN NY +SIC  N+V+HYNIE+Q DGT+QI TGR+FIGP+ELV+HH  HLDGFLTLAR PLERYP G SY++LQGV +S  E+ ++ KA++MG K ++SIEE L GPMR+HLK +VL+DLH  QPW+H  +RR ++E+RL+ AGHTEGQFLVR RK +  FVLS+S QNQPKHYKI    DK  I+GGQYF SLIE+IDHY+FRQDGLLCKLRF +E P +   RS A  + S + S   +  S  + G ++     R    T     +T +    S  S                       +  SDLISF++W                              STNLP   ++ +S  +  L  N+E            F P       +   N +           ++ S++SF     ++  R T  N +PK      T        +Q LN+P I D+ W EP++  S    +P++ +++     +  S  P      +  L    +  TQ +YDSL L+D +FN    +I IK KLGGGNFG+V+GG YK  +  + +PVA+KMLK++  S I   +IM EAR M+QL+H+HIVRLIG+C+  Q++L+LELAPLGPINKYLR+NQ ++  S+ ELM QV+ GMAYLEASKFVHRDLAARNVLLV++ YAKISDFGMSKAL +G DYYRAA AGKWP+KWYAPECIYYFRFDSKSDVWSYG+T+WEVFSYG+RPY+D+KGTQIL+M+D+G+RL KP +CP+SIYDVMLQCW  DGVRRPTFAELV+ +SRI     T         ++ +N  GS
Sbjct:    1 MTQPISPKSVNYYHGRITRDQAEELLMGRGGTESLFLLRESVNNNYAVSICFNNRVHHYNIERQIDGTYQIPTGRRFIGPVELVKHHSQHLDGFLTLARYPLERYPPGLSYFVLQGVSASDLEERLRLKAIQMGLKGTTSIEEALAGPMREHLKQLVLRDLHLCQPWYHDSIRRSDSEQRLQEAGHTEGQFLVRYRKDENNFVLSLSYQNQPKHYKINCSSDKFQIDGGQYFSSLIEMIDHYHFRQDGLLCKLRFPVESPKYQRSRSGANSITSRSLSGASTPSSLPLAGEKSTPPQLRNIKPTQQFNQITGQLPTFSSESSSESSGPASRVSNNPWGIPGPETTTPSDLISFTDWSNLSSLMNNNNVSSQQPIVTPLNIFATTPNSTNLPVFHSQMISNMIAPLHINQEKLIEASSNFSTGFTPTPTPGNCMISQNPNFNPLQNPLSIRVNQSSESFEQLSAISGGRSTGSNQSPKT-----TPHQSRTSSNQGLNQPAIMDEQWEEPDLDGSGHH-APNMRIDLPNVSPQQRSNKPHSNSCHISEL---FSEATQVVYDSLPLDDETFNFDPSQISIKDKLGGGNFGHVFGGIYKPSDGKKEVPVAIKMLKQDQMSNIIEDDIMAEARVMAQLKHRHIVRLIGICRDAQVMLVLELAPLGPINKYLRKNQEMNYISITELMYQVALGMAYLEASKFVHRDLAARNVLLVSDKYAKISDFGMSKALKFGNDYYRAANAGKWPIKWYAPECIYYFRFDSKSDVWSYGVTMWEVFSYGDRPYRDMKGTQILAMIDRGKRLSKPHSCPDSIYDVMLQCWEFDGVRRPTFAELVLIISRILNNFHTSAGTKIGNNSFHSNQFGS 852          
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Match: SMESG000016930.1 (SMESG000016930.1)

HSP 1 Score: 205.297 bits (521), Expect = 7.020e-56
Identity = 98/229 (42.79%), Postives = 142/229 (62.01%), Query Frame = 2
Query: 1622 ETIPVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSE-QSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAEL 2305
            +T  VAVK LK    +K    E ++EAR M +L H ++VRL  VC  E I ++ EL   G + +YLR     +E + L+++MSQ++ GMAYLE   ++HRDLAARN+L+   +  KI+DFG+++ +    D Y A    K+P+KW APE     +F  KSDVWSYGI L+E+ ++G+ P+  +  TQ L  +++G R+ KP NCP+ +Y VML CW      RPTF  L
Sbjct:  381 KTTDVAVKTLKPGTMAK---EEFLKEARIMKRLNHSNLVRLYAVCSDEPIYIVTELMTKGSLLEYLREEGKHTELKELMDMMSQIANGMAYLEKEGYIHRDLAARNILIGENNICKIADFGLTRVIQGSSDTYNARQGAKFPIKWTAPEAALMGKFTVKSDVWSYGIVLYEIITHGQTPFPAMNNTQTLQQVEKGYRMPKPSNCPQELYKVMLYCWEALPENRPTFKYL 606          
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Match: SMESG000051839.1 (SMESG000051839.1)

HSP 1 Score: 203.756 bits (517), Expect = 2.422e-54
Identity = 124/325 (38.15%), Postives = 183/325 (56.31%), Query Frame = 2
Query: 1388 VEISRNRIKSSSMPPKLQPWDLGILDPMLAVETQKIYDSLSLNDISFNL-PIDKIEIKQKLXXXXXXXXXXXXXKINLLETIPVAVKMLKKEMHSKIGAHEIMEEARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYL-RRNQSLSEQSLIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALNYGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGERPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFAELVMTMSRIQVGLSTGIHE 2356
            V  +RN   SS+ PP+           M +  +  ++  ++ N+    + P D + +  +LG G FG VY G   ++  +   VAVK+L +         + M+EA  M QL H +I+ + GVC+ +++++ILE+A LG +  YL    + +    L     Q++ GM YLE+  FVHRDLA RNVLL +E   KISDFG+S+A+    DYY+A   GKWP+KWYAPE IYY  F   SDVWSYG+ LWE++S GE PY      ++L  +++G RL +P    + +Y +M QCW+     RPTF+ L+   S     L T I+E
Sbjct:  495 VRANRNHNTSSTNPPR-----------MSSSSSSGVWSQMANNNSEIRMIPSDAVILLYRLGEGEFGEVYRGRLHLDNGQMEEVAVKVLVQPSQRL----DFMKEASIMMQLSHPNIITMYGVCENKRLMMILEVANLGSLLDYLLDYPEKIQLSDLHNWAMQIASGMTYLESKGFVHRDLACRNVLLSSESCCKISDFGLSRAVGVESDYYKATRRGKWPVKWYAPESIYYKTFSHASDVWSYGVCLWEMWSLGEHPYAQQDSFEVLRQIEEGVRLPRPKLTSDKVYMLMQQCWAYRPEDRPTFSHLLAVFSH----LCTNIYE 800          

HSP 2 Score: 51.2174 bits (121), Expect = 4.413e-6
Identity = 28/70 (40.00%), Postives = 44/70 (62.86%), Query Frame = 2
Query:   83 YFHGKITRDRAEDLLMSQGAIEGMFLLRESVN-GNYVISICHCNKVNHYNIEKQSDGTFQI-LTGRKFIG 286
            ++HG I+R+  E LL  Q A  G FL+R S++ G YV+S+    ++ HY IE+  DG +Q+  T  K++G
Sbjct:   69 WYHGNISREDTERLLKHQSA-NGTFLIRYSISTGKYVLSVIFNQQIYHYPIEELPDGFYQVNGTNSKYLG 137          
The following BLAST results are available for this feature:
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYK4.716e-8152.68spleen associated tyrosine kinase [Source:HGNC Sym... [more]
SYK4.716e-8152.68spleen associated tyrosine kinase [Source:HGNC Sym... [more]
SYK8.691e-8152.68spleen associated tyrosine kinase [Source:HGNC Sym... [more]
SYK8.691e-8152.68spleen associated tyrosine kinase [Source:HGNC Sym... [more]
ZAP704.441e-7749.59zeta chain of T cell receptor associated protein k... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ark-13.860e-5344.39Ack-related non-receptor tyrosine kinase [Source:... [more]
ark-14.390e-5344.39Ack-related non-receptor tyrosine kinase [Source:... [more]
src-21.254e-5040.97Tyrosine protein-kinase src-2 [Source:UniProtKB/S... [more]
abl-13.754e-5040.17Tyrosine-protein kinase abl-1 [Source:UniProtKB/S... [more]
abl-14.187e-5040.17Tyrosine-protein kinase abl-1 [Source:UniProtKB/S... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Shark9.025e-5744.83gene:FBgn0015295 transcript:FBtr0087244[more]
Src42A3.592e-5340.52gene:FBgn0264959 transcript:FBtr0335275[more]
Src42A8.851e-5240.52gene:FBgn0264959 transcript:FBtr0335276[more]
Ack-like6.015e-5143.15gene:FBgn0263998 transcript:FBtr0330329[more]
Ack-like6.074e-5143.15gene:FBgn0263998 transcript:FBtr0330331[more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syk1.559e-8153.15spleen tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
syk1.559e-8153.15spleen tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
syk2.645e-8153.15spleen tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
zap707.324e-7747.67zeta chain of T cell receptor associated protein k... [more]
si:ch73-383l1.13.720e-5541.88si:ch73-383l1.1 [Source:ZFIN;Acc:ZDB-GENE-121214-6... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zap709.875e-7754.91zeta chain of T cell receptor associated protein k... [more]
galk12.217e-7650.67galactokinase 1 [Source:Xenbase;Acc:XB-GENE-969127... [more]
galk12.220e-7650.67galactokinase 1 [Source:Xenbase;Acc:XB-GENE-969127... [more]
galk15.654e-7650.67galactokinase 1 [Source:Xenbase;Acc:XB-GENE-969127... [more]
galk17.621e-7650.67galactokinase 1 [Source:Xenbase;Acc:XB-GENE-969127... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Syk2.012e-8052.23spleen tyrosine kinase [Source:MGI Symbol;Acc:MGI:... [more]
Syk2.012e-8052.23spleen tyrosine kinase [Source:MGI Symbol;Acc:MGI:... [more]
Syk2.607e-7854.33spleen tyrosine kinase [Source:MGI Symbol;Acc:MGI:... [more]
Zap701.869e-7350.42zeta-chain (TCR) associated protein kinase [Source... [more]
Erbb41.534e-5241.45erb-b2 receptor tyrosine kinase 4 [Source:MGI Symb... [more]
back to top
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q64725|KSYK_RAT2.349e-8052.68Tyrosine-protein kinase SYK OS=Rattus norvegicus O... [more]
sp|P43405|KSYK_HUMAN4.174e-8052.68Tyrosine-protein kinase SYK OS=Homo sapiens OX=960... [more]
sp|F1N9Y5|KSYK_CHICK6.583e-8051.09Tyrosine-protein kinase SYK OS=Gallus gallus OX=90... [more]
sp|P48025|KSYK_MOUSE1.408e-7952.23Tyrosine-protein kinase SYK OS=Mus musculus OX=100... [more]
sp|Q00655|KSYK_PIG5.823e-7851.34Tyrosine-protein kinase SYK OS=Sus scrofa OX=9823 ... [more]
back to top
BLAST of Tyrosine-protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3ELS16.076e-12552.10Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A158QUA39.766e-12252.10Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A183MH921.322e-12068.57Protein kinase domain-containing protein OS=Schist... [more]
G4VKS42.802e-12068.21Tyrosine kinase OS=Schistosoma mansoni OX=6183 GN=... [more]
A0A0X3P5I87.000e-12065.95Tyrosine-protein kinase SYK (Fragment) OS=Schistoc... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zap708.245e-8153.68tyrosine-protein kinase ZAP-70 [Source:NCBI gene;A... [more]
zap701.366e-8053.68tyrosine-protein kinase ZAP-70 [Source:NCBI gene;A... [more]
zap701.366e-8053.68tyrosine-protein kinase ZAP-70 [Source:NCBI gene;A... [more]
syk1.048e-7249.33spleen tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
syk1.124e-7249.54spleen tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006670.13.010e-5540.52pep scaffold:Pmarinus_7.0:GL482639:18:11990:1 gene... [more]
ENSPMAT00000003172.13.363e-5240.60pep scaffold:Pmarinus_7.0:GL476855:1052:76454:1 ge... [more]
frk7.263e-5241.23fyn-related Src family tyrosine kinase [Source:ZFI... [more]
ENSPMAT00000001705.15.879e-5036.67pep scaffold:Pmarinus_7.0:GL487204:7598:9057:-1 ge... [more]
frk8.667e-5039.83fyn-related Src family tyrosine kinase [Source:ZFI... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
BCK13.535e-1829.36MAPKKK acting in the protein kinase C signaling pa... [more]
CDC158.275e-1827.31Protein kinase of the Mitotic Exit Network; locali... [more]
STE111.052e-1524.20Signal transducing MEK kinase; involved in pheromo... [more]
KIN23.610e-1525.00Serine/threonine protein kinase involved in regula... [more]
TPK23.638e-1425.11cAMP-dependent protein kinase catalytic subunit; p... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO312981.243e-8251.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498042.461e-5442.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478028.888e-5341.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409946.662e-5140.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378861.828e-5040.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syk3.059e-8454.26spleen associated tyrosine kinase [Source:NCBI gen... [more]
syk4.311e-8454.26spleen associated tyrosine kinase [Source:NCBI gen... [more]
syk7.402e-8454.26spleen associated tyrosine kinase [Source:NCBI gen... [more]
zap701.748e-7648.75tyrosine-protein kinase ZAP-70 [Source:NCBI gene;A... [more]
zap709.292e-7648.95tyrosine-protein kinase ZAP-70 [Source:NCBI gene;A... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064511.10.000e+098.06SMESG000064511.1[more]
SMESG000064511.10.000e+095.74SMESG000064511.1[more]
SMESG000043611.10.000e+049.48SMESG000043611.1[more]
SMESG000016930.17.020e-5642.79SMESG000016930.1[more]
SMESG000051839.12.422e-5438.15SMESG000051839.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003048 ID=SMED30003048|Name=Tyrosine-protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=2905bp
ATGAAATAATTATGATTAATTGTATACAAATGTAAACAATTCAATAATTA
TGTCTCAAGGCAAATCACCCTTTAATATTCTTTATTTCCATGGAAAAATT
ACTAGAGATCGGGCGGAAGATTTATTGATGAGCCAAGGAGCAATCGAAGG
AATGTTTCTTCTACGTGAAAGTGTTAATGGGAATTACGTAATATCTATTT
GTCACTGTAATAAAGTAAACCATTATAACATTGAAAAACAAAGTGATGGA
ACTTTTCAAATTTTAACCGGAAGAAAATTTATTGGTCCAATTGAGCTTGT
TGAACATCACATGTTACATCTTGATGGGTTTTTGACTCTAGCCAGATTAC
CTCTTGAAAGATATCCTGCTGGAACTTCATATTATATCTTGCAAGGAGTC
AAATCATCTTTTTTTGAGGATTGTATCAAGAAAAAGGCATTAGAAATGGG
CTTTAAAGATTCAAGCAGTATTGAAGAAGTTCTCAATGGACCGATGAGAC
AGCACTTAAAGCATATGGTTCTCAAAGATCTTCATTTCTCTCAGCCTTGG
TTTCATCATTTTCTTAGGCGTTTAGAAGCGGAAGAAAGACTAGAAAATGC
AGGTCATACAGAAGGTCAATTTCTCGTCCGGCAAAGAAAAGGTGATTGTG
GATTTGTGTTGAGTATCAGCGTGCAAAATCAACCAAAGCACTATAAAATC
ATTAATAAATTTGACAAGCTCCATATCGAAGGTGGACAATATTTTGACTC
CCTAATTGAGTTGATCGATCATTATTATTTCCGCCAAGATGGATTGCTGT
GTAAATTGAGATTCGGAATTGAATGTCCGGGATTCATACGATCGAAAGCT
GAATTTTTGCAATCATTGAACCAATCAAGTGTTGAAAGTGCTCATTCGAC
CATTTGTGGAATGCAAAACGCAGCGAGAATTCAAAGAACAGCCGTAAAGA
CGGATTTATCGAGAATTGTTACGGACAAATACAGAGATATGAGCATTAAT
TCAATTTTCAGACAGAAAAAGTCCGACATGATTTCCGTGTCTAGCGATTT
GATCAGTTTCAGTGAGTGGTCGACGAATCTCCCTCGGCTATTAAATGAGC
CGGTCTCTGCATCATTGAACAATCTCAACAAGGAATTATTTTATCCAAAT
TCTATCACAACCAAAAACGTCTTCCAATGGAATAACAGTATCAGTTCTTC
CACCCAATCATTTGTCAACGACACCCGTCAAACCAATGATACACCAAAGG
TATCAGAGAATGTTATTACACTCGAATACAAAGATAATATTCTTGATCAA
AGTTTGAATGAACCTCAAATTACAGATCAGTTATGGTCAGAACCTGAAAT
AGCTTCATCACGTCAAGTTATTTCTCCATCACTGGAAGTTGAAATTTCCA
GAAATCGAATCAAATCGTCATCAATGCCTCCAAAACTTCAGCCATGGGAC
TTAGGAATATTAGATCCAATGTTGGCTGTTGAAACTCAAAAAATATACGA
TTCTTTATCACTAAATGATATTTCGTTCAACTTACCAATTGATAAAATTG
AAATTAAACAAAAGCTCGGAGGTGGAAATTTCGGATATGTTTATGGAGGA
TTTTATAAAATCAATTTGCTTGAAACGATTCCAGTGGCTGTCAAAATGCT
AAAGAAGGAAATGCATTCCAAAATTGGAGCACACGAAATTATGGAAGAGG
CACGAACAATGTCACAACTGCGTCATAAACATATCGTTAGGTTAATTGGA
GTATGTAAATGTGAGCAGATACTCCTCATCTTGGAGTTAGCTCCATTGGG
ACCAATAAACAAATACTTGAGACGCAATCAATCTCTTTCTGAACAGTCTT
TAATTGAATTAATGAGTCAAGTTTCTAGAGGTATGGCCTATTTAGAAGCA
TCGAAGTTTGTACATAGAGATTTAGCAGCTCGAAATGTGTTACTGGTTAA
TGAGCATTACGCCAAAATCAGTGACTTTGGAATGAGCAAAGCTCTTAATT
ACGGCCAGGATTACTATAGGGCAGCTGCAGCAGGAAAGTGGCCTTTGAAA
TGGTATGCTCCGGAATGCATTTATTACTTCAGATTTGATAGCAAATCTGA
CGTATGGAGTTATGGAATCACTCTATGGGAAGTATTCTCCTACGGAGAAA
GACCATATAAGGATCTGAAAGGCACTCAAATATTATCGATGTTAGATCAA
GGCCAAAGACTTAAAAAACCAATTAATTGTCCAGAATCCATATACGACGT
CATGTTGCAGTGCTGGAGTACTGATGGAGTGCGAAGACCAACTTTTGCAG
AGTTGGTGATGACAATGTCAAGAATCCAAGTTGGACTTTCAACTGGAATT
CATGAACTTGCGGAACAAACAAATTATTTGGCTAATTCTAGTGGTAGCAG
TGTGGCTAAAACGTCTTATGGATCAAGCGAATGCTCGCAGTTTCCTTCTC
CTCCTATATCACTGAAAGAAAACGAGATATGGAGCAAAGAATCAGTTTCT
ACAAATAACCGTGAGTTTGGCGATTGGTAAAATCGAAAAATATTCATATT
TCATCAAGAGTGCAATACTTATTTAGTCATCATAGATTCAAATATATTAT
TTTCTTGGTTCAAATTTTGTTTAAATATTTACTGTACATCGCCCAATGCC
ATCTGGAGAGGAAGAAAGGAAGGAGAGGGAACTTGTCTCTACCTAAGTTT
TGAAAAAAACAGATTTAAAGTATCCTCAGTTAAACATATATGCATTATGT
TATACAGCACAGTAAAACGTTGTATGATAAATTGCCTTTTATGACAAATC
GTCGTTATCGAAATTATTTTTTTATAAATCAGAAGTCAGCTAAATTTCCT
ATTTTAGTGATTTTTTGTCGAACATTTTCAATTAATAAATACTGTGGAAA
AAGAC
back to top

protein sequence of SMED30003048-orf-1

>SMED30003048-orf-1 ID=SMED30003048-orf-1|Name=SMED30003048-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=827bp
MSQGKSPFNILYFHGKITRDRAEDLLMSQGAIEGMFLLRESVNGNYVISI
CHCNKVNHYNIEKQSDGTFQILTGRKFIGPIELVEHHMLHLDGFLTLARL
PLERYPAGTSYYILQGVKSSFFEDCIKKKALEMGFKDSSSIEEVLNGPMR
QHLKHMVLKDLHFSQPWFHHFLRRLEAEERLENAGHTEGQFLVRQRKGDC
GFVLSISVQNQPKHYKIINKFDKLHIEGGQYFDSLIELIDHYYFRQDGLL
CKLRFGIECPGFIRSKAEFLQSLNQSSVESAHSTICGMQNAARIQRTAVK
TDLSRIVTDKYRDMSINSIFRQKKSDMISVSSDLISFSEWSTNLPRLLNE
PVSASLNNLNKELFYPNSITTKNVFQWNNSISSSTQSFVNDTRQTNDTPK
VSENVITLEYKDNILDQSLNEPQITDQLWSEPEIASSRQVISPSLEVEIS
RNRIKSSSMPPKLQPWDLGILDPMLAVETQKIYDSLSLNDISFNLPIDKI
EIKQKLGGGNFGYVYGGFYKINLLETIPVAVKMLKKEMHSKIGAHEIMEE
ARTMSQLRHKHIVRLIGVCKCEQILLILELAPLGPINKYLRRNQSLSEQS
LIELMSQVSRGMAYLEASKFVHRDLAARNVLLVNEHYAKISDFGMSKALN
YGQDYYRAAAAGKWPLKWYAPECIYYFRFDSKSDVWSYGITLWEVFSYGE
RPYKDLKGTQILSMLDQGQRLKKPINCPESIYDVMLQCWSTDGVRRPTFA
ELVMTMSRIQVGLSTGIHELAEQTNYLANSSGSSVAKTSYGSSECSQFPS
PPISLKENEIWSKESVSTNNREFGDW*
back to top
Aliases
The feature 'Tyrosine-protein kinase' has the following synonyms
Synonym
syk
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
Vocabulary: INTERPRO
TermDefinition
IPR036860SH2_dom_sf
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR000980SH2
IPR020635Tyr_kinase_cat_dom
IPR008266Tyr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0004713protein tyrosine kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004715non-membrane spanning protein tyrosine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000980SH2 domainPRINTSPR00401SH2DOMAINcoord: 76..90
score: 29.67
coord: 12..26
score: 45.64
coord: 33..43
score: 51.8
coord: 55..65
score: 38.44
IPR000980SH2 domainSMARTSM00252SH2_5coord: 10..93
e-value: 1.6E-21
score: 87.5
coord: 165..248
e-value: 5.1E-19
score: 79.2
IPR000980SH2 domainPFAMPF00017SH2coord: 167..242
e-value: 5.5E-15
score: 55.2
coord: 12..87
e-value: 4.8E-17
score: 61.8
IPR000980SH2 domainPROSITEPS50001SH2coord: 167..257
score: 17.063
IPR000980SH2 domainPROSITEPS50001SH2coord: 12..102
score: 17.908
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPRINTSPR00109TYRKINASEcoord: 614..632
score: 63.18
coord: 727..749
score: 45.76
coord: 578..591
score: 32.62
coord: 664..674
score: 51.89
coord: 683..705
score: 58.14
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPFAMPF07714Pkinase_Tyrcoord: 500..755
e-value: 4.7E-87
score: 291.5
IPR020635Tyrosine-protein kinase, catalytic domainSMARTSM00219tyrkin_6coord: 500..756
e-value: 2.6E-113
score: 392.4
NoneNo IPR availablePIRSFPIRSF000615TyrPK_CSF1-Rcoord: 357..448
e-value: 170.0
score: -2.4
coord: 592..823
e-value: 1.1E-50
score: 170.3
coord: 488..600
e-value: 1.1E-8
score: 31.4
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 581..795
e-value: 6.3E-52
score: 178.1
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 487..580
e-value: 3.2E-23
score: 83.5
NoneNo IPR availablePANTHERPTHR24418:SF369TYROSINE-PROTEIN KINASE ZAP-70coord: 10..267
coord: 484..775
NoneNo IPR availablePANTHERPTHR24418TYROSINE-PROTEIN KINASEcoord: 484..775
NoneNo IPR availablePANTHERPTHR24418TYROSINE-PROTEIN KINASEcoord: 10..267
NoneNo IPR availableCDDcd00173SH2coord: 166..242
e-value: 2.77999E-16
score: 72.103
IPR036860SH2 domain superfamilyGENE3DG3DSA:3.30.505.10coord: 157..261
e-value: 2.5E-23
score: 84.0
coord: 5..107
e-value: 2.3E-22
score: 80.8
IPR036860SH2 domain superfamilySUPERFAMILYSSF55550SH2 domaincoord: 154..255
IPR036860SH2 domain superfamilySUPERFAMILYSSF55550SH2 domaincoord: 11..104
IPR008266Tyrosine-protein kinase, active sitePROSITEPS00109PROTEIN_KINASE_TYRcoord: 620..632
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 506..532
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 500..759
score: 37.828
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 494..774