Guanine nucleotide binding protein subunit

Overview
NameGuanine nucleotide binding protein subunit
Smed IDSMED30003039
Length (bp)1924
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Guanine nucleotide binding protein subunit (SMED30003039) t-SNE clustered cells

Violin plots show distribution of expression levels for Guanine nucleotide binding protein subunit (SMED30003039) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Guanine nucleotide binding protein subunit (SMED30003039) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Guanine nucleotide binding protein subunit (SMED30003039) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003039

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30003039SMESG000056024.1 SMESG000056023.1 dd_Smed_v4_2931_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
testisSMED30003039SMESG000056023.1 PL05013A2G03ncbi_smed_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
epidermisSMED30003039SMESG000056024.1 SMESG000056023.1 dd_Smed_v4_2931_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
testis primordiumSMED30003039SMESG000056023.1 PL05013A2G03_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Human
Match: GNA13 (G protein subunit alpha 13 [Source:HGNC Symbol;Acc:HGNC:4381])

HSP 1 Score: 235.343 bits (599), Expect = 8.724e-71
Identity = 145/412 (35.19%), Postives = 221/412 (53.64%), Query Frame = 3
Query:  174 CIPKRSRFIGDVDIKHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNIDQLVMK 1409
            C P      G+ +   Q+ KS+EIDK + REK        ILLLG GESGKSTFLKQM++I+G+ F       F+ TIY NV KG+  L+ AR  L+I + +           + H  +            Q +     FL+ +   + +W D GI+ A+++R +       E+ +++L+ LDK+   DY PS +DI+ +R+PT  I E + +I       +DVGGQ  ERK+W + F  + S+LFL++SS FD+     M     N+L E++ +FE ++N + F +VS+I+F NKTD+L EKV  +I  I+  F E+    DPH +  VQ+FLV+ F                   +N+ R          +++ LY HFTTA++  NI  VF  +KDTIL  N+ QL+++
Sbjct:   14 CFPGCLLTSGEAE---QQRKSKEIDKCLSREKTYVKRLVKILLLGAGESGKSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNSN--------QQHGDKMMSFDTRAPMAAQGMVETRVFLQYLPAIRALWADSGIQNAYDRRREF---QLGESVKYFLDNLDKLGEPDYIPSQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSVTSILFLVSSSEFDQVL---MEDRLTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKV--QIVSIKDYFLEF--EGDPHCLRDVQKFLVECF-------------------RNKRRDQ--------QQKPLYHHFTTAINTENIRLVFRDVKDTILHDNLKQLMLQ 377          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Human
Match: GNA12 (G protein subunit alpha 12 [Source:HGNC Symbol;Acc:HGNC:4380])

HSP 1 Score: 229.565 bits (584), Expect = 1.365e-68
Identity = 138/390 (35.38%), Postives = 213/390 (54.62%), Query Frame = 3
Query:  240 EIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNIDQLVMK 1409
            +ID L+ RE+R       ILLLG GESGKSTFLKQM++I+G++F    L  F+DTI+DN+ KG   L+ AR  L I ++  E        +   F+    +  E AT          F   V     +W D GI+EAF++RS+       E+ +++L+ LD+I   +Y PS +DI+ +RK T  I+E +  I       +DVGGQ  +R+KW Q F  + S+LF+++SS +D+     M     N+L E+M +FE ++N + F +VS+I+F NK D+L EKV  K   I+  F ++    DPH +  VQ++LV  F                    ++ R +        + + L+ HFTTA+D  N+  VF+A+KDTILQ N+  ++++
Sbjct:   42 DIDALLARERRAVRRLVKILLLGAGESGKSTFLKQMRIIHGREFDQKALLEFRDTIFDNILKGSRVLVDARDKLGIPWQYSENEKHGMFLMA--FENKAGLPVEPAT----------FQLYVPALSALWRDSGIREAFSRRSEF---QLGESVKYFLDNLDRIGQLNYFPSKQDILLARKATKGIVEHDFVIKKIPFKMVDVGGQRSQRQKWFQCFDGITSILFMVSSSEYDQVL---MEDRRTNRLVESMNIFETIVNNKLFFNVSIILFLNKMDLLVEKV--KTVSIKKHFPDF--RGDPHRLEDVQRYLVQCF--------------------DRKRRN--------RSKPLFHHFTTAIDTENVRFVFHAVKDTILQENLKDIMLQ 381          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Human
Match: GNAQ (G protein subunit alpha q [Source:HGNC Symbol;Acc:HGNC:4390])

HSP 1 Score: 199.519 bits (506), Expect = 1.655e-57
Identity = 122/386 (31.61%), Postives = 201/386 (52.07%), Query Frame = 3
Query:  240 EIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEY-PENFDPHNIVQ-VQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNI 1391
            EI++ ++R+KR       +LLLGTGESGKSTF+KQM++I+G  ++  +  GF   +Y N++  +  ++ A  +L I ++ YE           H +  +E+  EK +  +  +        VD  K +WND GI+E +++R +      S+++++YLN LD++    Y P+ +D++  R PT  IIE   D+       +DVGGQ  ER+KW   F+++ S++FL+A S +D+     +  +  N++ E+  +F  +I   +F + SVI+F NK D+L EK+      + S   +Y PE   P    Q  ++F++  FV    NP +                           + +Y HFT A D  NI  VF A+KDTILQ N+
Sbjct:   24 EIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYK-YEHNKA-------HAQLVREVDVEKVSAFENPY--------VDAIKSLWNDPGIQECYDRRREY---QLSDSTKYYLNDLDRVADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVL---VESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKI------MYSHLVDYFPEYDGPQRDAQAAREFILKMFVDL--NPDS--------------------------DKIIYSHFTCATDTENIRFVFAAVKDTILQLNL 353          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Human
Match: GNA11 (G protein subunit alpha 11 [Source:HGNC Symbol;Acc:HGNC:4379])

HSP 1 Score: 196.823 bits (499), Expect = 1.816e-56
Identity = 124/396 (31.31%), Postives = 206/396 (52.02%), Query Frame = 3
Query:  210 DIKHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFD-PHNIVQ-VQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNI 1391
            ++K  K  + EI+K ++R+KR       +LLLGTGESGKSTF+KQM++I+G  ++  +  GF   +Y N++  +  ++ A  +L I ++ YE+     + I       +E+  EK TT      E ++   V   K +W D GI+E +++R +      S+++++YL  +D+I    Y P+ +D++  R PT  IIE   D+       +DVGGQ  ER+KW   F+++ S++FL+A S +D+     +  +  N++ E+  +F  +I   +F + SVI+F NK D+L +K+      + S   +Y   FD P    Q  ++F++  FV    NP +                           + +Y HFT A D  NI  VF A+KDTILQ N+
Sbjct:   14 EVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGAGYSEEDKRGFTKLVYQNIFTAMQAMIRAMETLKILYK-YEQNKANALLI-------REVDVEKVTT-----FEHQY---VSAIKTLWEDPGIQECYDRRREY---QLSDSAKYYLTDVDRIATLGYLPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVL---VESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEDKI------LYSHLVDYFPEFDGPQRDAQAAREFILKMFVDL--NPDSD--------------------------KIIYSHFTCATDTENIRFVFAAVKDTILQLNL 353          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Human
Match: GNA14 (G protein subunit alpha 14 [Source:HGNC Symbol;Acc:HGNC:4382])

HSP 1 Score: 191.045 bits (484), Expect = 2.313e-54
Identity = 118/392 (30.10%), Postives = 201/392 (51.28%), Query Frame = 3
Query:  216 KHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNI 1391
            K  +  S EI++ ++R+K+       +LLLGTGESGKSTF+KQM++I+G  ++  +  GF   +Y N++  +  ++ A  +L I +            + +  K N +I +E       + S E+    V+  K +W D GI+E +++R +      S+++++YL  +D+I    + P+ +D++  R PT  IIE   D+       +DVGGQ  ER+KW   F+ + S++FL+A S +D+   +    +  N++ E+  +F+ +I   +FL+ SVI+F NK D+L EK+    S + S F EY       ++   + F++  +     NP                           K++ +Y HFT A D  NI  VF A+KDTILQ N+
Sbjct:   12 KESQRISAEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDRKGFTKLVYQNIFTAMQAMIRAMDTLRIQY------------VCEQNKENAQIIREVEVDKVSMLSREQ----VEAIKQLWQDPGIQECYDRRREY---QLSDSAKYYLTDIDRIATPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAE---CDNENRMEESKALFKTIITYPWFLNSSVILFLNKKDLLEEKIM--YSHLISYFPEY--TGPKQDVRAARDFILKLYQD--QNPD--------------------------KEKVIYSHFTCATDTDNIRFVFAAVKDTILQLNL 349          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Celegans
Match: egl-30 (EGL-30; Heterotrimeric G protein alpha subunit [Source:UniProtKB/TrEMBL;Acc:G5EGU1])

HSP 1 Score: 200.29 bits (508), Expect = 2.837e-58
Identity = 127/409 (31.05%), Postives = 213/409 (52.08%), Query Frame = 3
Query:  165 MLPCIPKRSRFIGDVDIKHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNI 1391
            M  C+ + +R         QK  ++EI+K ++R+KR       +LLLGTGESGKSTF+KQM++I+G+ ++  +       +Y NV+  I  ++ A  +L+I F N  E       +++     +E+  E  T+      EE ++  +   K +W D GI+E +++R +      ++++++YL+ L ++ V DY P+ +DI+  R PT  IIE   D+       +DVGGQ  ER+KW   F+++ S++FL+A S +D+     +  +  N++ E+  +F  +I   +F + SVI+F NK D+L EK+    S +   F EY  +  P + +  ++F++  FV    NP A                           + +Y HFT A D  NI  VF A+KDTILQ N+
Sbjct:    1 MACCLSEEAR--------EQKRINQEIEKQLQRDKRNARRELKLLLLGTGESGKSTFIKQMRIIHGQGYSEEDKRAHIRLVYQNVFMAIQSMIRAMDTLDIKFGNESE------ELQEKAAVVREVDFESVTSF-----EEPYVSYI---KELWEDSGIQECYDRRREY---QLTDSAKYYLSDLRRLAVPDYLPTEQDILRVRVPTTGIIEYPFDLEQIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVL---VECDNENRMEESKALFRTIITYPWFTNSSVILFLNKKDLLEEKIL--YSHLADYFPEY--DGPPRDPIAAREFILKMFVDL--NPDA--------------------------DKIIYSHFTCATDTENIRFVFAAVKDTILQHNL 349          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Celegans
Match: gpa-12 (Guanine nucleotide-binding protein alpha-12 subunit [Source:UniProtKB/Swiss-Prot;Acc:Q19572])

HSP 1 Score: 196.823 bits (499), Expect = 6.099e-57
Identity = 130/401 (32.42%), Postives = 218/401 (54.36%), Query Frame = 3
Query:  231 KSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGK-KFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHK-EKATTGQIIWSEE-----EFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQ-VQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNIDQLVMK 1409
            +++ I+K + +E++    + ++LLLG+GESGKSTF+KQM +I+G  +FT+ E+  ++  IY N    +  LL AR+ L I +E+               KR  E+ K  + + G ++   +     E   ++ DF   WND  I++ + QR+       S++ +++   + +I + D+ P+N DI++ RK T  I E   +I+     FIDVGGQ  +R+KW Q F D+ S+LF++AS+ +D+     +     N++ E+  VFE ++N + F +VS+I+F NK D+L EKV    SDIR  FT++  +   H +V+ VQ FLVD F                A  +++ R               + HFTTAVD  NI  VF  ++++IL++N+  L+M+
Sbjct:   11 RTKTIEKELHKERKIMRRQINLLLLGSGESGKSTFVKQMHIIHGAGEFTADEVRAYRQQIYQNAISAMRVLLDARNKLGIAWEDP--------------KRQVEVEKVMRFSVGDLLKGIDFTTFVEVAPIISDF---WNDAAIRKTYEQRNLF---QISDSCQYFFEHIPRIAMPDFYPTNRDILFCRKATRGISEHIFEINKIPFRFIDVGGQRSQRQKWFQCFTDITSILFMVASNEYDQVI---LEDRRTNRVVESRSVFETIVNNRAFSNVSIILFMNKNDLLQEKVPK--SDIRQYFTDFTGD---HTLVRDVQFFLVDKF---------------EASRRDRARP-------------FFYHFTTAVDTENIRRVFRDVRESILEQNLKTLMMQ 355          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Celegans
Match: gpa-16 (Guanine nucleotide-binding protein alpha-16 subunit [Source:UniProtKB/Swiss-Prot;Acc:Q9N2V6])

HSP 1 Score: 176.407 bits (446), Expect = 1.898e-49
Identity = 115/390 (29.49%), Postives = 203/390 (52.05%), Query Frame = 3
Query:  225 KAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTE-YPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNI 1391
            K +S++ID+L+K +    +    +LLLG GESGKST LKQM++I+   +T+ E   F+  +Y N+   +  ++HA   L I+F   +  S+A   +   F          +TTG+     EE + L+   K +W+D GI++A  +RS+      ++++ +YL++LD+I   +Y P+ +DI+ +R  T  I+E +        +  DVGGQ  ERKKW   F+D+ +++F +A S +D    +       N++RE++++F+ + N ++F+  S+I+F NK D+  EK+      +RS  T  +PE    +N  +   ++   F            ++ + G +NQ                +Y  FT A D  NI  VF+A+ D I++ N+
Sbjct:   13 KRRSKKIDRLLKEDGENSMRTIKLLLLGAGESGKSTILKQMRIIHDVGYTTEERKVFRGVVYGNIILSLNAIIHAMEQLKISFTTLDHESDARKLL--MF----------STTGEEDELPEELVVLM---KSVWSDSGIQKAL-ERSR--EYQLNDSAGYYLSQLDRICAPNYIPTQDDILRTRIKTTGIVETQFVYKDRLFLVFDVGGQRSERKKWIHCFEDVTALIFCVALSEYDMVLVEDCQT---NRMRESLKLFDSICNNKWFVETSIILFLNKKDLFEEKI------VRSPLTHCFPEYTGANNYEEASAYIQQQF---------EDMNKRTTGEKNQ---------------EIYTQFTCATDTNNIRFVFDAVTDIIIRDNL 351          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Celegans
Match: goa-1 (Guanine nucleotide-binding protein G(o) subunit alpha [Source:UniProtKB/Swiss-Prot;Acc:P51875])

HSP 1 Score: 173.711 bits (439), Expect = 2.036e-48
Identity = 108/387 (27.91%), Postives = 200/387 (51.68%), Query Frame = 3
Query:  231 KSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNI 1391
            +SR I+K +K +  +      +LLLG GESGKST +KQMK+I+   FT+ +   +K  +Y N  + ++ +L A S+L ++F + +   +A++ + D   R ++            +SEE    L+   K +W D G+++ F++ ++      +++++++L+ L+++    YQP+ +DI+ +R  T  I+E             DVGGQ  ERKKW   F+D+ +++F +A S +D+  ++    E  N++ E++++F+ + N ++F   S+I+F NK D+  EK+  K S +   F EY    D H                     A+ ++Q+ A N++  +              +Y H T A D  NI+ VF+A+ D I+  N+
Sbjct:   15 RSRMIEKNLKEDGMQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAEDYKQYKPVVYSNTVQSLVAILRAMSNLGVSFGSADREVDAKL-VMDVVARMEDTEP---------FSEE----LLSSMKRLWGDAGVQDCFSRSNEY---QLNDSAKYFLDDLERLGEAIYQPTEQDILRTRVKTTGIVEVHFTFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHE---DETTNRMHESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKI--KKSPLTICFPEYSGRQDYH------------------EASAYIQAQFEAKNKSANKE-------------IYCHMTCATDTTNIQFVFDAVTDVIIANNL 348          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Celegans
Match: gpa-4 (Guanine nucleotide-binding protein alpha-4 subunit [Source:UniProtKB/Swiss-Prot;Acc:Q9BIG5])

HSP 1 Score: 173.326 bits (438), Expect = 3.251e-48
Identity = 108/389 (27.76%), Postives = 189/389 (48.59%), Query Frame = 3
Query:  225 KAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNI 1391
            K +S+ ID+ ++ +  + +    +LLLG GESGKST ++QM++++   F   E   ++  ++ N+ + +L +L A   LNI+F +     +A + I  HF     +H   A       SE   L+L D  K +W D+G+K+   +  +      ++++ +Y N LD+I    Y P+ +DI+ +R  +  I+E        C    DVGGQ  ERKKW   F  + +V+F +A S +D         +  N++ E+M++F+ ++N  +F   S+I+F NK D+  E++  + + +   F EY        I +   F+                         Q R  I  +   P ++ +Y HFT A D  NI  VF+A+ D I++ N+
Sbjct:   12 KKRSKLIDEQLRHDHERCVGEIKLLLLGAGESGKSTIVRQMRILHETGFNKQEQMAYRPVVFSNMVQSMLAILKAMQPLNISFTDAAREEDARMFI-SHF-----LHVNNAE-----LSEAFSLELSDLMKQLWMDEGVKKCVKRAHEY---QLNDSAEYYFNALDRISSSSYLPTQDDILRARVKSTGIVETTFMYKDLCFKMFDVGGQRSERKKWIHCFDSVTAVIFCVALSEYD---LRLAEDQTMNRMHESMQLFDSIVNNCWFTETSIILFLNKMDIFEERI--RYTPLTVCFPEYQGGM---TITETSTFI-------------------------QSRFEILNKRQTPAQKEIYSHFTCATDTNNIRFVFDAVTDIIIRNNL 353          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Fly
Match: cta (gene:FBgn0000384 transcript:FBtr0111126)

HSP 1 Score: 213.386 bits (542), Expect = 6.326e-62
Identity = 129/397 (32.49%), Postives = 213/397 (53.65%), Query Frame = 3
Query:  222 QKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVF-QDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNIDQLVMK 1409
            Q+ KS+EIDK +++EK  F  +  +LLLG GESGKSTFLKQM++I+G  F    L  ++  IY NV +G+  LL AR  LNI + +                R ++ +  K      +    +F++       +W D+GI+ A     +      S++  ++L+++ ++   DY P+++DI+  RK T  + E  + +     VF+DVGGQ  +R+KW + F   + S++FL++SS FD+   +       N+L E+  +F+ ++N   F  +S+I+F NKTD+L +KV N  +DIR  +  +  N +PH+++ VQ F++  F+S                                    +Y HFTTA+D RNI  VFN++KDTILQRN++ L+++
Sbjct:  111 QRYKSKEIDKFLEKEKHTFRRQVKLLLLGAGESGKSTFLKQMRIIHGVNFDYELLLEYQSVIYQNVIRGMQVLLDAREKLNIAWGSD--------------GREQDAYDAKLMECNSL-DVPKFMEYAPPISRLWQDRGIRRA---FERRREFQISDSVSYFLDEIQRLATPDYVPTHKDILHCRKATKGVYEFCVKVQNIPFVFVDVGGQRTQRQKWTRCFDSSVTSIIFLVSSSEFDQVLAEDRKT---NRLEESKNIFDTIVNNATFKGISIILFLNKTDLLEQKVCNPETDIRWYYPHF--NGNPHSVLDVQNFILQMFMS---------------------------VRRSSSISRIYHHFTTAIDTRNINVVFNSVKDTILQRNLNALMLQ 457          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Fly
Match: cta (gene:FBgn0000384 transcript:FBtr0334157)

HSP 1 Score: 213.386 bits (542), Expect = 6.326e-62
Identity = 129/397 (32.49%), Postives = 213/397 (53.65%), Query Frame = 3
Query:  222 QKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVF-QDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNIDQLVMK 1409
            Q+ KS+EIDK +++EK  F  +  +LLLG GESGKSTFLKQM++I+G  F    L  ++  IY NV +G+  LL AR  LNI + +                R ++ +  K      +    +F++       +W D+GI+ A     +      S++  ++L+++ ++   DY P+++DI+  RK T  + E  + +     VF+DVGGQ  +R+KW + F   + S++FL++SS FD+   +       N+L E+  +F+ ++N   F  +S+I+F NKTD+L +KV N  +DIR  +  +  N +PH+++ VQ F++  F+S                                    +Y HFTTA+D RNI  VFN++KDTILQRN++ L+++
Sbjct:  111 QRYKSKEIDKFLEKEKHTFRRQVKLLLLGAGESGKSTFLKQMRIIHGVNFDYELLLEYQSVIYQNVIRGMQVLLDAREKLNIAWGSD--------------GREQDAYDAKLMECNSL-DVPKFMEYAPPISRLWQDRGIRRA---FERRREFQISDSVSYFLDEIQRLATPDYVPTHKDILHCRKATKGVYEFCVKVQNIPFVFVDVGGQRTQRQKWTRCFDSSVTSIIFLVSSSEFDQVLAEDRKT---NRLEESKNIFDTIVNNATFKGISIILFLNKTDLLEQKVCNPETDIRWYYPHF--NGNPHSVLDVQNFILQMFMS---------------------------VRRSSSISRIYHHFTTAIDTRNINVVFNSVKDTILQRNLNALMLQ 457          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Fly
Match: Galphaq (gene:FBgn0004435 transcript:FBtr0087832)

HSP 1 Score: 198.364 bits (503), Expect = 1.693e-57
Identity = 120/389 (30.85%), Postives = 207/389 (53.21%), Query Frame = 3
Query:  216 KHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQ 1382
            K QK  ++EI+K ++R+KR       +LLLGTGESGKSTF+KQM++I+G  ++  +  G+   ++ N++  +  ++ A   L I++   E +  A++ +         I  E  TT      E+ +L  +   K +W+D GI+E +++R +      ++++++YL+ L +I   DY P+ +DI+ +R PT  I+E   D+ G     +DVGGQ  ER+KW   F+++ S++FL+A S +D+  ++    +  N++ E+  +F  +I   +F + SVI+F NK D+L EK+    S +   F EY      H     +QF++  +++   +P                            +R  Y HFTTA D  NI+ VF A+KDTI+Q
Sbjct:   10 KEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMS--------IDYETVTT-----FEDPYLNAI---KTLWDDAGIQECYDRRREY---QLTDSAKYYLSDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFES---DNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIM--YSHLVDYFPEYDGPKQDH--AAAKQFVLKKYLACNPDP----------------------------ERQCYSHFTTATDTENIKLVFCAVKDTIMQ 344          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Fly
Match: Galphaq (gene:FBgn0004435 transcript:FBtr0087833)

HSP 1 Score: 193.741 bits (491), Expect = 1.082e-55
Identity = 121/394 (30.71%), Postives = 208/394 (52.79%), Query Frame = 3
Query:  216 KHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEY-PENFDPH-NIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNI 1391
            K QK  ++EI+K ++R+KR       +LLLGTGESGKSTF+KQM++I+G  ++  +  G+   ++ N++  +  ++ A   L I++   E +  A++ +         I  E  TT      E+ +L  +   K +W+D GI+E +++R +      ++++++YL  LD++    Y P+ +DI+  R PT  IIE   D+       +DVGGQ  ER+KW   F+++ S++FL+A S +D+  ++    +  N++ E+  +F  +I   +F + SVI+F NK D+L EK+      + S   +Y PE   P  + +  ++F++  FV    NP +                          ++ +Y HFT A D  NI  VF A+KDTILQ N+
Sbjct:   10 KEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMS--------IDYETVTT-----FEDPYLNAI---KTLWDDAGIQECYDRRREY---QLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFE---SDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKI------MYSHLVDYFPEYDGPQRDAITAREFILRMFVDL--NPDS--------------------------EKIIYSHFTCATDTENIRFVFAAVKDTILQSNL 347          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Fly
Match: Galphaq (gene:FBgn0004435 transcript:FBtr0087830)

HSP 1 Score: 193.741 bits (491), Expect = 1.082e-55
Identity = 121/394 (30.71%), Postives = 208/394 (52.79%), Query Frame = 3
Query:  216 KHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEY-PENFDPH-NIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNI 1391
            K QK  ++EI+K ++R+KR       +LLLGTGESGKSTF+KQM++I+G  ++  +  G+   ++ N++  +  ++ A   L I++   E +  A++ +         I  E  TT      E+ +L  +   K +W+D GI+E +++R +      ++++++YL  LD++    Y P+ +DI+  R PT  IIE   D+       +DVGGQ  ER+KW   F+++ S++FL+A S +D+  ++    +  N++ E+  +F  +I   +F + SVI+F NK D+L EK+      + S   +Y PE   P  + +  ++F++  FV    NP +                          ++ +Y HFT A D  NI  VF A+KDTILQ N+
Sbjct:   10 KEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMS--------IDYETVTT-----FEDPYLNAI---KTLWDDAGIQECYDRRREY---QLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFE---SDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKI------MYSHLVDYFPEYDGPQRDAITAREFILRMFVDL--NPDS--------------------------EKIIYSHFTCATDTENIRFVFAAVKDTILQSNL 347          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Zebrafish
Match: gna12a (guanine nucleotide binding protein (G protein) alpha 12a [Source:ZFIN;Acc:ZDB-GENE-050221-1])

HSP 1 Score: 245.358 bits (625), Expect = 1.201e-74
Identity = 148/398 (37.19%), Postives = 224/398 (56.28%), Query Frame = 3
Query:  216 KHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNIDQLVMK 1409
            +  K +SREID ++KRE+R       ILLLG GESGKSTFLKQM++I+GK+F    L  F+DTI++NV KG+  L+ AR  L I+++N E        +   F+    +  E  T          F   V   + +WND GI+EA+ +RS+      SE+ +++L+ LD+I    Y PS +DI+ +RK T  I+E +  I       +DVGGQ  +R+KW Q F  + S+LF+++SS +D+     M     N+L E+M +FE ++N + F +VS+I+F NK D+L EKV  K+S I   F+++    DPH +V VQ +LV  F                    N+ R +        + + L+ HFTTA+D  NI  VF+A+KDTILQ N+  ++++
Sbjct:   38 REAKRRSREIDSMLKRERRSIRRLVKILLLGAGESGKSTFLKQMRIIHGKEFDQKALLDFRDTIFENVIKGMRVLVDARDKLGISWQNSENEKHGMFVMS--FENKAGMAVEPCT----------FQLYVPALQALWNDSGIQEAYGRRSEF---QLSESVKYFLDNLDRIGQLSYVPSRQDILLARKATKGIVEHDFVIKKIPFKMVDVGGQRSQRQKWFQCFDGITSILFMVSSSEYDQVL---MEDRRTNRLVESMNIFETIVNNKLFSNVSIILFLNKMDLLVEKV-RKVS-ICKHFSDF--RGDPHRLVDVQAYLVQCF--------------------NRKRRN--------RIKPLFHHFTTAIDTENIRFVFHAVKDTILQENLKDIMLQ 385          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Zebrafish
Match: gna13a (guanine nucleotide binding protein (G protein), alpha 13a [Source:ZFIN;Acc:ZDB-GENE-030131-5024])

HSP 1 Score: 242.276 bits (617), Expect = 1.148e-73
Identity = 150/413 (36.32%), Postives = 225/413 (54.48%), Query Frame = 3
Query:  174 CIPKRSRFIGDVDIKHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKV-TNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNIDQLVMK 1409
            CIP      G++D   Q  KS+EIDK + REK        ILLLG GESGKSTFLKQM++I+G+ F       F+ TIY NV KG+  L+ AR  L+I + N E  +  E  +              +   + +   + FL  +   + +W D GI+ A+++R +       E+ +++L+ +DK+   DY PS +DI+ +RKPT  I E E +I       +DVGGQ  ERK+W + F  + S+LFL++SS +D+     M     N+L E++ +FE ++N + F +VS+I+F NKTD+L +KV T  I D  SEFT      +PHN+  VQ+FLV+ F                   +N+ R          +++ LY HFTTA++  NI  VF  +KDTIL  N+ QL+++
Sbjct:   13 CIPNCLLSSGEID---QIRKSKEIDKSLSREKTYVKKLVKILLLGAGESGKSTFLKQMRIIHGQDFDQRAKEEFRATIYSNVIKGVRVLVDAREKLHIPWGNPENQAHGETVM--------AFDTRSSLMAKGMMETKVFLNFLPAIRALWQDSGIQNAYDRRREF---QLGESVKYFLDNVDKLGQLDYLPSQKDILLARKPTKGIHEYEFEIKNVPFKMVDVGGQRSERKRWFECFDSVTSILFLVSSSEYDQVL---MEDRQTNRLTESLNIFETIVNNRVFANVSIILFLNKTDLLEDKVKTVNIKDYFSEFTG-----EPHNLQDVQKFLVECF-------------------RNKRREQ--------QQKPLYHHFTTAINTENIRLVFRDVKDTILHDNLKQLMLQ 376          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Zebrafish
Match: gna13b (guanine nucleotide binding protein (G protein), alpha 13b [Source:ZFIN;Acc:ZDB-GENE-030131-8277])

HSP 1 Score: 228.024 bits (580), Expect = 3.620e-68
Identity = 143/413 (34.62%), Postives = 224/413 (54.24%), Query Frame = 3
Query:  174 CIPKRSRFIGDVDIKHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTN-KISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNIDQLVMK 1409
            C P  + F+   D + Q  KS+EID+ + +EK        ILLLG GESGKSTFLKQM++I+G  F   +   F+ TIY NV KG+  L+ AR  L+I + N    + A+I +                  Q +   + FL+ +   + +W D GI+ A+++R +       E+ +++L+ LDK+   DY P+ +DI+ +RKPT  I E + +I       +DVGGQ  ER++W + F+ + S+LFL++SS +D+     M     N+L E++ +FE ++N + F +VS+I+F NKTD+L EKV +  I D   EFT+     DP  +  V+ FLV+ F                   +N+ R          +++ LY HFTTA++  NI  VF  +KDTIL  N+ QL+++
Sbjct:   14 CFP--NCFLDSSDAE-QLRKSKEIDREIFKEKTFVKRLVKILLLGAGESGKSTFLKQMRIIHGDDFDKGDKEEFRGTIYSNVMKGVRVLVDAREKLHIPWGNPSNQTHADIMM--------AFDTRSTMVSQGMLETKLFLQYLPSIRALWADIGIQHAYDRRREF---QLGESVKYFLDNLDKLGAPDYLPTQQDILLARKPTKGIHEYDFEIKNVPFKMVDVGGQRSERRRWFECFESVTSILFLVSSSEYDQVL---MEDRQTNRLMESLNIFETIVNNRVFNNVSIILFLNKTDLLEEKVKSVSIQDYFPEFTD-----DPWCLGDVKNFLVECF-------------------RNKRRDQ--------QQKPLYHHFTTAINTENIRLVFRDVKDTILHDNLKQLMLQ 377          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Zebrafish
Match: gna11b (guanine nucleotide binding protein (G protein), alpha 11b (Gq class) [Source:ZFIN;Acc:ZDB-GENE-041121-9])

HSP 1 Score: 201.06 bits (510), Expect = 2.635e-58
Identity = 125/394 (31.73%), Postives = 206/394 (52.28%), Query Frame = 3
Query:  216 KHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFD-PHNIVQ-VQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNI 1391
            K  K  + EIDK ++R+KR       +LLLGTGESGKSTF+KQM++I+G  +T  +  GF   +Y N++  +  ++ A  +L I ++ YE+     + +       KE+  EK  +    +        ++  K++W+D GI+EA+++R +      S+++++YL+ LD+I    Y P+ +D++  R PT  IIE   D+       +DVGGQ  ER+KW   F+++ S++FL+A S +D+     +  +  N++ E+  +F  +I   +F + SVI+F NK D+L EK++       S   +Y   FD P    Q  ++F++  FV    NP +                           + +Y HFT A D  NI  VF A+KDTILQ N+
Sbjct:   16 KESKRINAEIDKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGAGYTDEDKRGFTKLVYQNIFTSMQAMIRATETLKIGYK-YEQNKANAMLV-------KEVDIEKVMSFDHPY--------INAVKMLWSDPGIQEAYDRRREY---QLSDSTKYYLSDLDRIAESSYLPTQQDVLRVRIPTTGIIEYPFDLQSIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVL---VESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIS------YSHLVDYFPEFDGPQRDAQAAREFILKMFVDL--NPDSD--------------------------KIIYSHFTCATDTENIRFVFAAVKDTILQLNL 353          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Zebrafish
Match: gna11a (guanine nucleotide binding protein (G protein), alpha 11a (Gq class) [Source:ZFIN;Acc:ZDB-GENE-050208-597])

HSP 1 Score: 200.675 bits (509), Expect = 3.594e-58
Identity = 126/394 (31.98%), Postives = 207/394 (52.54%), Query Frame = 3
Query:  216 KHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFD-PHNIVQ-VQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNI 1391
            K  K  + EIDK ++R+KR       +LLLGTGESGKSTF+KQM++I+G  +T  +  G+   +Y N++  +  ++ A   L I F           R ED+ K+N  + +E     ++   E+ ++  ++    +W D GI+EA+++R +      S+++++YLN L++I  + Y P+ +D++  R PT  IIE   D+       +DVGGQ  ER+KW   F+++ S++FL+A S +D+     +  +  N++ E+  +F  +I   +F + SVI+F NK D+L EK+      + S   +Y   FD P N  Q  ++F++  FV    NP +                           + +Y HFT A D  NI  VF A+KDTILQ N+
Sbjct:   16 KESKRINAEIDKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYTDEDKRGYTKLVYQNIFTSMQAMIRATEHLKIPF-----------RFEDN-KKNALLVRE-VDVEKVCSFEQPYVAAINK---LWMDPGIQEAYDRRREY---QLSDSTKYYLNDLERISSRGYMPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVL---VESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKI------LCSHLVDYFPEFDGPQNDAQSAREFILKMFVDL--NPDS--------------------------DKIIYSHFTCATDTENIRFVFAAVKDTILQHNL 353          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Xenopus
Match: gna13 (guanine nucleotide binding protein (G protein), alpha 13 [Source:NCBI gene;Acc:100145489])

HSP 1 Score: 233.417 bits (594), Expect = 4.242e-70
Identity = 141/396 (35.61%), Postives = 218/396 (55.05%), Query Frame = 3
Query:  222 QKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNIDQLVMK 1409
            Q+ KS+EID+ + REK        ILLLG GESGKSTFLKQM++I+G+ F       F+ TIY NV KGI  L+ AR  L+I + +       E+ +              A   Q +   + F+  +   + +W D GI+ A+++R +       E+ +++L+ LDK+  KDY PS +DI+ +R+PT  I E + +I       +DVGGQ  ERK+W + F  + S+LFL++SS +D+     M     N+L E++ +FE ++N + F +VS+I+F NKTD+L EKV  +I  I+  F ++    DPH +  VQ+FLV+ F                   +N+ R          +++ LY HFTTA++  NI  VF  +KDTIL  N+ QL+++
Sbjct:   27 QQRKSKEIDRCLSREKTYVKRLVKILLLGAGESGKSTFLKQMRIIHGQDFDLRAKEEFRATIYSNVIKGIRVLVDAREKLHIPWGDPANQKHGEVMMA--------FDTRSAMVAQGMVETQVFVSHLLSIRSLWADTGIQTAYDRRREF---QLGESVKYFLDNLDKLGDKDYLPSQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSVTSILFLVSSSEYDQVL---MEDRQTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKV--RIVSIKDYFADFEG--DPHCLEDVQKFLVNCF-------------------RNKRRDQ--------QQKPLYHHFTTAINTENIRLVFRDVKDTILHDNLKQLMLQ 377          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Xenopus
Match: gnaq (guanine nucleotide binding protein (G protein), q polypeptide [Source:NCBI gene;Acc:733773])

HSP 1 Score: 203.756 bits (517), Expect = 4.228e-59
Identity = 125/386 (32.38%), Postives = 203/386 (52.59%), Query Frame = 3
Query:  240 EIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEY-PENFDPHNIVQ-VQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNI 1391
            EI++ ++R+KR       +LLLGTGESGKSTF+KQM++I+G  ++  +  GF   +Y N++  +  ++ A  +L I ++ YE      + I       +E+  EK  + +  +        VD  K +WND GI+EA+++R +      S+++++YLN LD+I  + Y PS +D++  R PT  IIE   D+       +DVGGQ  ER+KW   F+++ S++FL+A S +D+     +  +  N++ E+  +F  +I   +F + SVI+F NK D+L EK+      + S   +Y PE   P    Q  ++F++  FV    NP +                           + +Y HFT A D  NI  VF A+KDTILQ N+
Sbjct:   24 EIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYK-YEHNKGHALLI-------REVDVEKVASFENPY--------VDAIKYLWNDPGIQEAYDRRREY---QLSDSTKYYLNDLDRIASQGYLPSQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVL---VESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKI------MYSHLVDYFPEYDGPQRDAQAAREFILKMFVDL--NPDS--------------------------DKIIYSHFTCATDTENIRFVFAAVKDTILQLNL 353          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Xenopus
Match: gnaq (guanine nucleotide binding protein (G protein), q polypeptide [Source:NCBI gene;Acc:733773])

HSP 1 Score: 203.371 bits (516), Expect = 4.745e-59
Identity = 125/386 (32.38%), Postives = 203/386 (52.59%), Query Frame = 3
Query:  240 EIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEY-PENFDPHNIVQ-VQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNI 1391
            EI++ ++R+KR       +LLLGTGESGKSTF+KQM++I+G  ++  +  GF   +Y N++  +  ++ A  +L I ++ YE      + I       +E+  EK  + +  +        VD  K +WND GI+EA+++R +      S+++++YLN LD+I  + Y PS +D++  R PT  IIE   D+       +DVGGQ  ER+KW   F+++ S++FL+A S +D+     +  +  N++ E+  +F  +I   +F + SVI+F NK D+L EK+      + S   +Y PE   P    Q  ++F++  FV    NP +                           + +Y HFT A D  NI  VF A+KDTILQ N+
Sbjct:   21 EIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYK-YEHNKGHALLI-------REVDVEKVASFENPY--------VDAIKYLWNDPGIQEAYDRRREY---QLSDSTKYYLNDLDRIASQGYLPSQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVL---VESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKI------MYSHLVDYFPEYDGPQRDAQAAREFILKMFVDL--NPDS--------------------------DKIIYSHFTCATDTENIRFVFAAVKDTILQLNL 350          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Xenopus
Match: gna11 (guanine nucleotide binding protein (G protein), alpha 11 (Gq class) [Source:NCBI gene;Acc:394755])

HSP 1 Score: 192.586 bits (488), Expect = 4.779e-55
Identity = 120/415 (28.92%), Postives = 213/415 (51.33%), Query Frame = 3
Query:  153 VD*LMLPCIPKRSRFIGDVDIKHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFD-PH-NIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNI 1391
            +D +M  C+ +        ++K  K  + EI+K ++R+K+       +LLLGTGESGKSTF+KQM++I+G  ++  +  GF   ++ N++  +  ++ A  +L I ++  +  + A++         +E+  EK  T +  +        V+  K +W+D GI+E +++R +      S+++++YL  +D+I    Y P+ +D++  R PT  IIE   D+       +DVGGQ  ER+KW   F+++ S++FL+A S +D+     +  +  N++ E+  +F  +I   +F + SVI+F NK D+L +K+      + S   +Y   FD P  +    ++F++  FV    NP +                           + +Y HFT A D  NI  VF A+KDTILQ N+
Sbjct:    3 LDSMMACCLSE--------EVKESKRINAEIEKQLRRDKKDSRRELKLLLLGTGESGKSTFIKQMRIIHGSGYSEEDKRGFTKLVFQNIFTAMQSMIRAMDTLKIPYKCEQNKANAQVV--------REVDVEKVCTFEQPY--------VNAIKNLWSDPGIQECYDRRREY---QLSDSAKYYLTDVDRISKPGYLPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVL---VESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEDKI------MYSHLVDYFPEFDGPQRDAATAREFILKMFVDL--NPDSD--------------------------KIIYSHFTCATDTENIRFVFAAVKDTILQHNL 353          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Xenopus
Match: adprh (ADP-ribosylarginine hydrolase [Source:Xenbase;Acc:XB-GENE-5783598])

HSP 1 Score: 186.422 bits (472), Expect = 1.030e-52
Identity = 118/386 (30.57%), Postives = 202/386 (52.33%), Query Frame = 3
Query:  240 EIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEY-PENFDPHNIVQ-VQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNI 1391
            EI+K ++R+KR       +LLLGTGESGKSTF+KQM++I+G  +T  +  GF   +Y N++  +  ++ A  +L I + + E+  E  + +       +E+  +K ++ +         K V+  K +W D+GI+E +++R +      S+++++YL+ +D+I    + P+ +D++  R PT  IIE   D+       +DVGGQ  ER+KW   F+++ S++FL+A S +D+   +    +  N++ E+  +F  +I   +F + SVI+F NK D+L EK+      + S   +Y PE   P    Q  + F++  +     NP                           K++ +Y HFT A D  NI  VF A+KDTILQ N+
Sbjct:   19 EIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYTDEDRKGFTKLVYQNIFTSMQAMIRAMDTLRIQYSS-EQNMENALTV-------REVEVDKVSSLE--------RKHVEAIKKLWEDEGIQECYDRRREY---QLSDSTKYYLSDIDRISNPSFIPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQVLAE---CDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLQEKI------MYSHLIDYFPEFTGPKQDSQSARDFILKLYQD--QNPD--------------------------KEKVIYSHFTCATDTENIRFVFAAVKDTILQLNL 348          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Mouse
Match: Gna13 (guanine nucleotide binding protein, alpha 13 [Source:MGI Symbol;Acc:MGI:95768])

HSP 1 Score: 237.654 bits (605), Expect = 8.850e-72
Identity = 142/396 (35.86%), Postives = 216/396 (54.55%), Query Frame = 3
Query:  222 QKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNIDQLVMK 1409
            Q+ KS+EIDK + REK        ILLLG GESGKSTFLKQM++I+G+ F       F+ TIY NV KG+  L+ AR  L+I + + +         + H  +            Q +     FL+ +   + +W D GI+ A+++R +       E+ +++L+ LDK+ V DY PS +DI+ +R+PT  I E + +I       +DVGGQ  ERK+W + F  + S+LFL++SS FD+     M     N+L E++ +FE ++N + F +VS+I+F NKTD+L EKV  ++  I+  F E+    DPH +  VQ+FLV+ F                            G+    ++R LY HFTTA++  NI  VF  +KDTIL  N+ QL+++
Sbjct:   27 QQRKSKEIDKCLSREKTYVKRLVKILLLGAGESGKSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNKN--------QLHGDKLMAFDTRAPMAAQGMVETRVFLQYLPAIRALWEDSGIQNAYDRRREF---QLGESVKYFLDNLDKLGVPDYIPSQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSVTSILFLVSSSEFDQVL---MEDRQTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKV--QVVSIKDYFLEF--EGDPHCLRDVQKFLVECF---------------------------RGKRRDQQQRPLYHHFTTAINTENIRLVFRDVKDTILHDNLKQLMLQ 377          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Mouse
Match: Gna12 (guanine nucleotide binding protein, alpha 12 [Source:MGI Symbol;Acc:MGI:95767])

HSP 1 Score: 229.95 bits (585), Expect = 8.150e-69
Identity = 139/390 (35.64%), Postives = 214/390 (54.87%), Query Frame = 3
Query:  240 EIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNIDQLVMK 1409
            +ID L+ RE+R       ILLLG GESGKSTFLKQM++I+G++F    L  F+DTI+DN+ KG   L+ AR  L I +++ E        +   F+    +  E AT          F   V     +W D GI+EAF++RS+       E+ +++L+ LD+I   +Y PS +DI+ +RK T  I+E +  I       +DVGGQ  +R+KW Q F  + S+LF+++SS +D+     M     N+L E+M +FE ++N + F +VS+I+F NK D+L EKV  K   I+  F ++    DPH +  VQ++LV  F                    ++ R +        + + L+ HFTTA+D  NI  VF+A+KDTILQ N+  ++++
Sbjct:   40 DIDALLARERRAVRRLVKILLLGAGESGKSTFLKQMRIIHGREFDQKALLEFRDTIFDNILKGSRVLVDARDKLGIPWQHSENEKHGMFLMA--FENKAGLPVEPAT----------FQLYVPALSALWRDSGIREAFSRRSEF---QLGESVKYFLDNLDRIGQLNYFPSKQDILLARKATKGIVEHDFVIKKIPFKMVDVGGQRSQRQKWFQCFDGITSILFMVSSSEYDQVL---MEDRRTNRLVESMNIFETIVNNKLFFNVSIILFLNKMDLLVEKV--KSVSIKKHFPDFKG--DPHRLEDVQRYLVQCF--------------------DRKRRN--------RSKPLFHHFTTAIDTENIRFVFHAVKDTILQENLKDIMLQ 379          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Mouse
Match: Gna12 (guanine nucleotide binding protein, alpha 12 [Source:MGI Symbol;Acc:MGI:95767])

HSP 1 Score: 206.068 bits (523), Expect = 1.077e-60
Identity = 133/382 (34.82%), Postives = 199/382 (52.09%), Query Frame = 3
Query:  264 EKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNIDQLVMK 1409
            E+R       ILLLG GESGKSTFLKQM++I+G++F    L  F+DTI+DN+ KG   L+ AR  L I +++ E        +   F+    +  E AT          F   V     +W D GI+EAF++RS+           F LN         Y PS +DI+ +RK T  I+E +  I       +DVGGQ  +R+KW Q F  + S+LF+++SS +D+     M     N+L E+M +FE ++N + F +VS+I+F NK D+L EKV  K   I+  F ++    DPH +  VQ++LV  F                    ++ R +        + + L+ HFTTA+D  NI  VF+A+KDTILQ N+  ++++
Sbjct:    2 ERRAVRRLVKILLLGAGESGKSTFLKQMRIIHGREFDQKALLEFRDTIFDNILKGSRVLVDARDKLGIPWQHSENEKHGMFLMA--FENKAGLPVEPAT----------FQLYVPALSALWRDSGIREAFSRRSE-----------FQLN---------YFPSKQDILLARKATKGIVEHDFVIKKIPFKMVDVGGQRSQRQKWFQCFDGITSILFMVSSSEYDQVL---MEDRRTNRLVESMNIFETIVNNKLFFNVSIILFLNKMDLLVEKV--KSVSIKKHFPDFKG--DPHRLEDVQRYLVQCF--------------------DRKRRN--------RSKPLFHHFTTAIDTENIRFVFHAVKDTILQENLKDIMLQ 316          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Mouse
Match: Gnaq (guanine nucleotide binding protein, alpha q polypeptide [Source:MGI Symbol;Acc:MGI:95776])

HSP 1 Score: 199.904 bits (507), Expect = 8.080e-58
Identity = 122/386 (31.61%), Postives = 201/386 (52.07%), Query Frame = 3
Query:  240 EIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEY-PENFDPHNIVQ-VQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNI 1391
            EI++ ++R+KR       +LLLGTGESGKSTF+KQM++I+G  ++  +  GF   +Y N++  +  ++ A  +L I ++ YE           H +  +E+  EK +  +  +        VD  K +WND GI+E +++R +      S+++++YLN LD++    Y P+ +D++  R PT  IIE   D+       +DVGGQ  ER+KW   F+++ S++FL+A S +D+     +  +  N++ E+  +F  +I   +F + SVI+F NK D+L EK+      + S   +Y PE   P    Q  ++F++  FV    NP +                           + +Y HFT A D  NI  VF A+KDTILQ N+
Sbjct:   24 EIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYK-YEHNKA-------HAQLVREVDVEKVSAFENPY--------VDAIKSLWNDPGIQECYDRRREY---QLSDSTKYYLNDLDRVADPSYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVL---VESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKI------MYSHLVDYFPEYDGPQRDAQAAREFILKMFVDL--NPDS--------------------------DKIIYSHFTCATDTENIRFVFAAVKDTILQLNL 353          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Mouse
Match: Gna11 (guanine nucleotide binding protein, alpha 11 [Source:MGI Symbol;Acc:MGI:95766])

HSP 1 Score: 197.593 bits (501), Expect = 4.925e-57
Identity = 123/396 (31.06%), Postives = 208/396 (52.53%), Query Frame = 3
Query:  210 DIKHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFD-PHNIVQ-VQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNI 1391
            ++K  K  + EI+K ++R+KR       +LLLGTGESGKSTF+KQM++I+G  ++  +  GF   +Y N++  +  ++ A  +L I ++ YE+     + I       +E+  EK TT      E ++   V+  K +W+D G++E +++R +      S+++++YL  +D+I    Y P+ +D++  R PT  IIE   D+       +DVGGQ  ER+KW   F+++ S++FL+A S +D+     +  +  N++ E+  +F  +I   +F + SVI+F NK D+L +K+      + S   +Y   FD P    Q  ++F++  FV    NP +                           + +Y HFT A D  NI  VF A+KDTILQ N+
Sbjct:   14 EVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGAGYSEEDKRGFTKLVYQNIFTAMQAMVRAMETLKILYK-YEQNKANALLI-------REVDVEKVTT-----FEHQY---VNAIKTLWSDPGVQECYDRRREF---QLSDSAKYYLTDVDRIATVGYLPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVL---VESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEDKI------LHSHLVDYFPEFDGPQRDAQAAREFILKMFVDL--NPDS--------------------------DKIIYSHFTCATDTENIRFVFAAVKDTILQLNL 353          
BLAST of Guanine nucleotide binding protein subunit vs. UniProt/SwissProt
Match: sp|Q6Q7Y5|GNA13_RAT (Guanine nucleotide-binding protein subunit alpha-13 OS=Rattus norvegicus OX=10116 GN=Gna13 PE=1 SV=1)

HSP 1 Score: 238.81 bits (608), Expect = 2.233e-71
Identity = 142/396 (35.86%), Postives = 217/396 (54.80%), Query Frame = 3
Query:  222 QKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNIDQLVMK 1409
            Q+ KS+EIDK + REK        ILLLG GESGKSTFLKQM++I+G+ F       F+ TIY NV KG+  L+ AR  L+I + + +         + H  +            Q +     FL+ +   + +W+D GI+ A+++R +       E+ +++L+ LDK+ V DY PS +DI+ +R+PT  I E + +I       +DVGGQ  ERK+W + F  + S+LFL++SS FD+     M     N+L E++ +FE ++N + F +VS+I+F NKTD+L EKV  ++  I+  F E+    DPH +  VQ+FLV+ F                            G+    ++R LY HFTTA++  NI  VF  +KDTIL  N+ QL+++
Sbjct:   27 QQRKSKEIDKCLSREKTYVKRLVKILLLGAGESGKSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNKN--------QVHGDKLMAFDTRAPMAAQGMVETRVFLQYLPAIRALWDDSGIQNAYDRRREF---QLGESVKYFLDNLDKLGVPDYIPSQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSVTSILFLVSSSEFDQVL---MEDRLTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKV--QVVSIKDYFLEFEG--DPHCLRDVQKFLVECF---------------------------RGKRRDQQQRPLYHHFTTAINTENIRLVFRDVKDTILHDNLKQLMLQ 377          
BLAST of Guanine nucleotide binding protein subunit vs. UniProt/SwissProt
Match: sp|P27601|GNA13_MOUSE (Guanine nucleotide-binding protein subunit alpha-13 OS=Mus musculus OX=10090 GN=Gna13 PE=1 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 6.191e-71
Identity = 142/396 (35.86%), Postives = 216/396 (54.55%), Query Frame = 3
Query:  222 QKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNIDQLVMK 1409
            Q+ KS+EIDK + REK        ILLLG GESGKSTFLKQM++I+G+ F       F+ TIY NV KG+  L+ AR  L+I + + +         + H  +            Q +     FL+ +   + +W D GI+ A+++R +       E+ +++L+ LDK+ V DY PS +DI+ +R+PT  I E + +I       +DVGGQ  ERK+W + F  + S+LFL++SS FD+     M     N+L E++ +FE ++N + F +VS+I+F NKTD+L EKV  ++  I+  F E+    DPH +  VQ+FLV+ F                            G+    ++R LY HFTTA++  NI  VF  +KDTIL  N+ QL+++
Sbjct:   27 QQRKSKEIDKCLSREKTYVKRLVKILLLGAGESGKSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNKN--------QLHGDKLMAFDTRAPMAAQGMVETRVFLQYLPAIRALWEDSGIQNAYDRRREF---QLGESVKYFLDNLDKLGVPDYIPSQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSVTSILFLVSSSEFDQVL---MEDRQTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKV--QVVSIKDYFLEF--EGDPHCLRDVQKFLVECF---------------------------RGKRRDQQQRPLYHHFTTAINTENIRLVFRDVKDTILHDNLKQLMLQ 377          
BLAST of Guanine nucleotide binding protein subunit vs. UniProt/SwissProt
Match: sp|Q14344|GNA13_HUMAN (Guanine nucleotide-binding protein subunit alpha-13 OS=Homo sapiens OX=9606 GN=GNA13 PE=1 SV=2)

HSP 1 Score: 235.343 bits (599), Expect = 4.190e-70
Identity = 145/412 (35.19%), Postives = 221/412 (53.64%), Query Frame = 3
Query:  174 CIPKRSRFIGDVDIKHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNIDQLVMK 1409
            C P      G+ +   Q+ KS+EIDK + REK        ILLLG GESGKSTFLKQM++I+G+ F       F+ TIY NV KG+  L+ AR  L+I + +           + H  +            Q +     FL+ +   + +W D GI+ A+++R +       E+ +++L+ LDK+   DY PS +DI+ +R+PT  I E + +I       +DVGGQ  ERK+W + F  + S+LFL++SS FD+     M     N+L E++ +FE ++N + F +VS+I+F NKTD+L EKV  +I  I+  F E+    DPH +  VQ+FLV+ F                   +N+ R          +++ LY HFTTA++  NI  VF  +KDTIL  N+ QL+++
Sbjct:   14 CFPGCLLTSGEAE---QQRKSKEIDKCLSREKTYVKRLVKILLLGAGESGKSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNSN--------QQHGDKMMSFDTRAPMAAQGMVETRVFLQYLPAIRALWADSGIQNAYDRRREF---QLGESVKYFLDNLDKLGEPDYIPSQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSVTSILFLVSSSEFDQVL---MEDRLTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKV--QIVSIKDYFLEF--EGDPHCLRDVQKFLVECF-------------------RNKRRDQ--------QQKPLYHHFTTAINTENIRLVFRDVKDTILHDNLKQLMLQ 377          
BLAST of Guanine nucleotide binding protein subunit vs. UniProt/SwissProt
Match: sp|Q63210|GNA12_RAT (Guanine nucleotide-binding protein subunit alpha-12 OS=Rattus norvegicus OX=10116 GN=Gna12 PE=1 SV=3)

HSP 1 Score: 231.876 bits (590), Expect = 1.044e-68
Identity = 140/390 (35.90%), Postives = 213/390 (54.62%), Query Frame = 3
Query:  240 EIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNIDQLVMK 1409
            +ID L+ RE+R       ILLLG GESGKSTFLKQM++I+G++F    L  F+DTI+DN+ KG   L+ AR  L I +++ E        +   F+    +  E AT          F   V     +W D GI+EAF++RS+       E+ +++L+ LD+I   +Y PS +DI+ +RK T  I+E +  I       +DVGGQ  +R+KW Q F  + S+LF+++SS +D+     M     N+L E+M +FE ++N + F +VS+I+F NK D+L EKV  K   I+  F ++    DPH +  VQ++LV  F                   +N+G+              L+ HFTTA+D  NI  VF+A+KDTILQ N+  ++++
Sbjct:   40 DIDALLARERRAVRRLVKILLLGAGESGKSTFLKQMRIIHGREFDQKALLEFRDTIFDNILKGSRVLVDARDKLGIPWQHSENEKHGMFLMA--FENKAGLPVEPAT----------FQLYVPALSALWRDSGIREAFSRRSEF---QLGESVKYFLDNLDRIGQLNYFPSKQDILLARKATKGIVEHDFVIKKIPFKMVDVGGQRSQRQKWFQCFDGITSILFMVSSSEYDQVL---MEDRRTNRLVESMNIFETIVNNKLFFNVSIILFLNKMDLLVEKV--KSVSIKKHFPDFKG--DPHRLEDVQRYLVQCF---------------DRKRRNRGKP-------------LFHHFTTAIDTENIRFVFHAVKDTILQENLKDIMLQ 379          
BLAST of Guanine nucleotide binding protein subunit vs. UniProt/SwissProt
Match: sp|P27600|GNA12_MOUSE (Guanine nucleotide-binding protein subunit alpha-12 OS=Mus musculus OX=10090 GN=Gna12 PE=1 SV=3)

HSP 1 Score: 229.95 bits (585), Expect = 5.701e-68
Identity = 139/390 (35.64%), Postives = 214/390 (54.87%), Query Frame = 3
Query:  240 EIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNIDQLVMK 1409
            +ID L+ RE+R       ILLLG GESGKSTFLKQM++I+G++F    L  F+DTI+DN+ KG   L+ AR  L I +++ E        +   F+    +  E AT          F   V     +W D GI+EAF++RS+       E+ +++L+ LD+I   +Y PS +DI+ +RK T  I+E +  I       +DVGGQ  +R+KW Q F  + S+LF+++SS +D+     M     N+L E+M +FE ++N + F +VS+I+F NK D+L EKV  K   I+  F ++    DPH +  VQ++LV  F                    ++ R +        + + L+ HFTTA+D  NI  VF+A+KDTILQ N+  ++++
Sbjct:   40 DIDALLARERRAVRRLVKILLLGAGESGKSTFLKQMRIIHGREFDQKALLEFRDTIFDNILKGSRVLVDARDKLGIPWQHSENEKHGMFLMA--FENKAGLPVEPAT----------FQLYVPALSALWRDSGIREAFSRRSEF---QLGESVKYFLDNLDRIGQLNYFPSKQDILLARKATKGIVEHDFVIKKIPFKMVDVGGQRSQRQKWFQCFDGITSILFMVSSSEYDQVL---MEDRRTNRLVESMNIFETIVNNKLFFNVSIILFLNKMDLLVEKV--KSVSIKKHFPDFKG--DPHRLEDVQRYLVQCF--------------------DRKRRN--------RSKPLFHHFTTAIDTENIRFVFHAVKDTILQENLKDIMLQ 379          
BLAST of Guanine nucleotide binding protein subunit vs. TrEMBL
Match: A0A4Z2DKC1 (Guanine nucleotide-binding protein subunit alpha-13 OS=Schistosoma japonicum OX=6182 GN=EWB00_000053 PE=4 SV=1)

HSP 1 Score: 459.914 bits (1182), Expect = 1.051e-153
Identity = 229/416 (55.05%), Postives = 308/416 (74.04%), Query Frame = 3
Query:  213 IKHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEET--SEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDN---PGAHPRSQYSAGN-QNQGR-ASIAGQAGVP-----------KKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNIDQLVM 1406
            I+ Q+ +++EI+  +K+EK +F  R  ILLLGTGESGKSTFLKQMK+INGK FT+ E+   KD IYDN+YKG+LFLL AR SLNI + +  ++  + A  +IE HF   + + +E+A   Q +W EEEFL++V   + IW D+ ++ AF++RSK++TE+FSEN+R+YLN+L+ I V++Y+P++EDIVWSRKPT+SIIEEEI++H + +VFIDVGGQTKER+KWCQ F DM SVLFLIASSH+DE Y D+++KE+RNKLREAM VFE LIN   F  VS+IIFFNKTD+L EK+ ++IS+IR EF  YP   DP ++  VQ FLVD F S VD+   P    RS  S  +  N G+ +S+  Q  VP           +KR +YRHFTTAVD+RNIET+FNAM+DT+LQ N+ +++M
Sbjct:   24 IRWQRKRNKEIEIELKKEKSRFRRRQMILLLGTGESGKSTFLKQMKIINGKHFTNQEIEQLKDIIYDNIYKGVLFLLQARESLNIPWSSGHDSVAAHASRQIETHFNETRSMRRERARLSQPLWLEEEFLEIVPLLRAIWADESVRLAFDKRSKIITENFSENTRYYLNRLNYIGVENYRPTDEDIVWSRKPTESIIEEEINVHSSSLVFIDVGGQTKERRKWCQCFSDMTSVLFLIASSHYDEHYQDRLTKEFRNKLREAMIVFEGLINHIAFRRVSIIIFFNKTDILKEKLNSRISNIRDEFPNYPVKMDPFHLQDVQTFLVDVFASLVDHNFLPDTCGRSSLSHSSFNNTGKYSSLQRQNSVPISANLTHKRPIRKRMVYRHFTTAVDRRNIETIFNAMQDTVLQNNLRRIMM 439          
BLAST of Guanine nucleotide binding protein subunit vs. TrEMBL
Match: A0A094ZSX3 (Guanine nucleotide-binding protein subunit alpha-12 OS=Schistosoma haematobium OX=6185 GN=MS3_06267 PE=4 SV=1)

HSP 1 Score: 446.432 bits (1147), Expect = 1.901e-148
Identity = 235/434 (54.15%), Postives = 310/434 (71.43%), Query Frame = 3
Query:  168 LPCI--PKRSRFIGDVDI-KHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENY--EETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDN---PGAHPRS--QYSAGNQNQGRASIAGQAGVP-----------KKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNIDQLVM 1406
            L C   PK S  I D +I K Q+ ++REI+K +K+EK +   R  ILLLGTGESGKSTFLKQMK+INGK FT+ E+   KD IYDN+YKG+LFLL AR SLNI +        ++A   IE HFK  + + +E++  GQ +W EEEFL++V     IW D+G++ AF+QRSK++TE+FSEN+R+YLN+L+ I V++Y+P++EDIVWSRKPT+SIIEEEI++H + +VFIDVGGQTKER+KWCQ F DM SVLFLIA SH+DE Y D+++KE+RNKL EAM VFE LIN   F  VS+IIFFNKTD+L EK+ ++ S+IR EF  YP   DP  +  VQ F+V+ F S V++   P    RS   +S+ N     +S+  Q  VP           +KR +YRHFTTAVD+RNIETVFNAM+DT+LQ N+ +++M
Sbjct:    8 LACCAFPKES--IDDREIIKWQQKRNREIEKELKKEKSRLRQRQMILLLGTGESGKSTFLKQMKIINGKHFTNQEIEQLKDIIYDNIYKGVLFLLQARESLNIPWAGGLGSAAAQASREIEAHFKETRMMRRERSRLGQPLWLEEEFLEIVPSLNAIWGDEGVRLAFDQRSKIITENFSENTRYYLNRLNHIGVENYRPTDEDIVWSRKPTESIIEEEINVHSSSLVFIDVGGQTKERRKWCQCFADMTSVLFLIACSHYDEHYQDRLTKEFRNKLHEAMVVFEGLINHIAFRRVSIIIFFNKTDILKEKLNSRTSNIRDEFPNYPVKMDPFRLQDVQTFMVEVFASLVNHNFPPDTQARSSLSHSSFNNTAKCSSLHRQNSVPMSTNVTFTAPVRKRMVYRHFTTAVDRRNIETVFNAMQDTVLQNNLRRIMM 439          
BLAST of Guanine nucleotide binding protein subunit vs. TrEMBL
Match: G4VRC1 (Putative gtp-binding protein alpha subunit, gna OS=Schistosoma mansoni OX=6183 GN=Smp_074510 PE=4 SV=1)

HSP 1 Score: 445.277 bits (1144), Expect = 4.830e-148
Identity = 235/434 (54.15%), Postives = 310/434 (71.43%), Query Frame = 3
Query:  168 LPCI--PKRSRFIGDVDI-KHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENY--EETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDN---PGAHPRS--QYSAGNQNQGRASIAGQAGVP-----------KKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNIDQLVM 1406
            L C   PK S  I D +I K Q+ ++REI+K +K+EK +   R  ILLLGTGESGKSTFLKQMK+INGK FT+ E+   KD IYDN+YKG+LFLL AR SLNI +        ++A   IE HFK  + + +E++  GQ +W EEEFL++V     IW D+ ++ AF+QRSK++TE+FSEN+R+YLN+L+ I V++Y+P++EDIVWSRKPT+SIIEEEI++H + +VFIDVGGQTKER+KWCQ F DM SVLFLIASSH+DE Y D+++KE+RNKL EAM VFE LIN   F  VS+IIFFNKTD+L EK+ ++ S+IR EF  YP   DP  +  VQ F+V+ F S V++   P    RS   +S+ N     +S+  Q  VP           +KR +YRHFTTAVD+RNIETVFNAM+DT+LQ N+ +++M
Sbjct:    8 LACCAFPKES--IDDREIIKWQQKRNREIEKELKKEKSRLRQRQMILLLGTGESGKSTFLKQMKIINGKHFTNQEIEQLKDIIYDNIYKGVLFLLQARESLNIPWAGGLGSAAAQASREIEAHFKETRMMRRERSRLGQPLWLEEEFLEIVPSLNAIWEDESVRLAFDQRSKIITENFSENTRYYLNRLNHIGVENYRPTDEDIVWSRKPTESIIEEEINVHSSSLVFIDVGGQTKERRKWCQCFADMTSVLFLIASSHYDEHYQDRLTKEFRNKLHEAMVVFEGLINHIAFRRVSIIIFFNKTDILKEKLNSRTSNIRDEFPNYPVKMDPFRLQDVQTFMVEVFASLVNHNFPPDTQARSSLSHSSFNNTAKCSSLHRQNSVPISTNVTFTAPVRKRMVYRHFTTAVDRRNIETVFNAMQDTVLQNNLRRIMM 439          
BLAST of Guanine nucleotide binding protein subunit vs. TrEMBL
Match: A0A430QQB5 (Guanine nucleotide-binding protein subunit alpha-12 OS=Schistosoma bovis OX=6184 GN=DC041_0006021 PE=4 SV=1)

HSP 1 Score: 444.121 bits (1141), Expect = 1.699e-147
Identity = 234/434 (53.92%), Postives = 309/434 (71.20%), Query Frame = 3
Query:  168 LPCI--PKRSRFIGDVDI-KHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENY--EETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDN---PGAHPRS--QYSAGNQNQGRASIAGQAGVP-----------KKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNIDQLVM 1406
            L C   PK S  I D +I K Q+ ++REI+K +K+EK +   R  ILLLGTGESGKSTFLKQMK+INGK FT+ E+   KD IYDN+YKG+LFLL AR SLNI +        ++A   IE HFK  + + +E++  GQ +W EEEFL++V     IW D+ ++ AF+QRSK++TE+FSEN+R+YLN+L+ I V++Y+P++EDIVWSRKPT+SIIEEEI++H + +VFIDVGGQTKER+KWCQ F DM SVLFLIA SH+DE Y D+++KE+RNKL EAM VFE LIN   F  VS+IIFFNKTD+L EK+ ++ S+IR EF  YP   DP  +  VQ F+V+ F S V++   P    RS   +S+ N     +S+  Q  VP           +KR +YRHFTTAVD+RNIETVFNAM+DT+LQ N+ +++M
Sbjct:    8 LACCAFPKES--IDDREIIKWQQKRNREIEKELKKEKTRLRQRQMILLLGTGESGKSTFLKQMKIINGKHFTNQEIEQLKDIIYDNIYKGVLFLLQARESLNIPWAGGLGSAAAQASREIEAHFKETRMMRRERSRLGQPLWLEEEFLEIVPSLNAIWGDESVRLAFDQRSKIITENFSENTRYYLNRLNHIGVENYRPTDEDIVWSRKPTESIIEEEINVHSSSLVFIDVGGQTKERRKWCQCFADMTSVLFLIACSHYDEHYQDRLTKEFRNKLHEAMVVFEGLINHIAFRRVSIIIFFNKTDILKEKLNSRTSNIRDEFPNYPVKMDPFRLQDVQTFMVEVFASLVNHNFPPDTQARSSLSHSSFNNTAKCSSLHRQNSVPMSTNVTFTAPVRKRMVYRHFTTAVDRRNIETVFNAMQDTVLQNNLRRIMM 439          
BLAST of Guanine nucleotide binding protein subunit vs. TrEMBL
Match: A0A4S2LBM0 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009885 PE=4 SV=1)

HSP 1 Score: 439.884 bits (1130), Expect = 1.381e-145
Identity = 220/430 (51.16%), Postives = 304/430 (70.70%), Query Frame = 3
Query:  213 IKHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIR--IEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDN-PGAHPRS--------------------------QYSAGNQNQGRASIAGQAGVP---KKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNIDQLVM 1406
            ++ Q+ +++EI++ +++E  +   R  ILLLGTGESGKSTFLKQMK+INGK+F++ E+   +D IYDN+YKG+LFLL AR +L+I +E  +++  A+    +E+HF+ ++  H+E+      +WSEEEFL+LV   + IW D  I++AF+QRSK++TE+FSEN+R+YLN+L  I +KDY P++EDIVWSRKPT SIIEEEI +H A +VF+DVGGQTKER+KWC  F D+ S+LFL+A SH+DE Y DK++KE+RNKLREAM VFE LIN   F  VS+IIFFNKTD+L EKV++++S+IR EF  +P  FDP  +  VQ F+V++F S V + PGA   +                          + SA    Q   SIA Q   P   +KR LYRHFTTAVD+RNIETVF+AM+DT+LQ N+ +++M
Sbjct:   25 LRWQRRRNKEIERELRKEAERRRRRQMILLLGTGESGKSTFLKQMKIINGKRFSANEMEQLRDIIYDNIYKGVLFLLQARENLDIPWETGDQSPAAQAAELMEEHFRAHRAEHRERVRLNTPVWSEEEFLQLVPSIQAIWADGSIRKAFDQRSKIITENFSENTRYYLNRLHYIGIKDYVPTDEDIVWSRKPTTSIIEEEIVVHNASLVFVDVGGQTKERRKWCHCFSDVTSILFLVACSHYDEHYQDKVTKEFRNKLREAMIVFEGLINHAAFRRVSIIIFFNKTDILKEKVSSRLSNIRDEFPNFPAKFDPFKLQDVQNFMVEAFASLVSSMPGADSLALPNIGRGSLSGSSFSGTKDLNASGVRRTSAPATAQPSMSIAAQNVAPMPVRKRMLYRHFTTAVDRRNIETVFHAMQDTVLQNNLRRIMM 454          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Cavefish
Match: gna12a (G protein subunit alpha 12 [Source:NCBI gene;Acc:103024018])

HSP 1 Score: 236.498 bits (602), Expect = 2.029e-71
Identity = 142/398 (35.68%), Postives = 222/398 (55.78%), Query Frame = 3
Query:  216 KHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNIDQLVMK 1409
            +  K +SREID ++ RE+R       ILLLG GESGKSTFLKQM++I+G++F    L  F+DTI+ N+ KG+  L+ AR  L ++++N E        +    K  K +   +  T Q+          V   + +W D GI+EA+ +RS+      SE+ +++L+ LD+I   +Y PS +DI+ +RK T  I+E +  I       +DVGGQ  +R+KW Q F  + S+LF+++SS +D+     M     N+L E+M +FE ++N + F +VS+I+F NK D+L EKV  K+S I   F+++    DPH +  VQ +LV  F                    N+ R +        + + L+ HFTTA+D  NI  VF+A+KDTILQ N+  ++++
Sbjct:   37 REAKRRSREIDAMLARERRSVRRLVKILLLGAGESGKSTFLKQMRIIHGQEFDQKALLDFRDTIFHNIIKGMRVLVDARDKLGVSWQNSENEKHGMFVMSFENKPGKSV---EVCTFQL---------YVPALQALWGDSGIQEAYGRRSEF---QLSESVKYFLDNLDRIGQLNYVPSRQDILLARKATKGIVEHDFIIKKIPFKMVDVGGQRSQRQKWFQCFDGITSILFMVSSSEYDQVL---MEDRRTNRLVESMNIFETIVNNKLFSNVSIILFLNKMDLLVEKVA-KVS-INKYFSDF--RGDPHRLEDVQAYLVQCF--------------------NRKRRN--------RHKPLFHHFTTAIDTENIRFVFHAVKDTILQENLKDIMLQ 384          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Cavefish
Match: gna13a (guanine nucleotide-binding protein subunit alpha-13-like [Source:NCBI gene;Acc:103022306])

HSP 1 Score: 234.958 bits (598), Expect = 7.728e-71
Identity = 146/413 (35.35%), Postives = 227/413 (54.96%), Query Frame = 3
Query:  168 LPCIPKRSRFIGDVDIKHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNIDQLVM 1406
            L CIP  + F+ + +++ Q+ KS+EID+ + REK        ILLLG GESGKSTFLKQM++I+G+ F       F+ TIY NV KG+  L+ AR  L+I + +    +  E+ +              +   Q I   + FL  +   + +W D GI+ A+++R +       E+ +++L+ LD+I   DY P+ +DI+ +RKPT  I E + +I       +DVGGQ  ER++W + F  + SVLFL++SS FD+     M     N+L E++ +FE ++N + F + S+I+F NK D+L EKV  K+  I+  F EY E  +PH++ +V++FLV+ F S         R Q                     ++ LY HFTTA++  NI  VF  +KDTIL  N+ QL++
Sbjct:   11 LVCIP--ACFLSNNEVEQQR-KSKEIDRYISREKTYVKRLVKILLLGAGESGKSTFLKQMRIIHGQDFDQRAKEEFRATIYSNVIKGVRVLVDAREKLHIPWGDPSNQAHGEVMM--------GFDTRSSMMVQGIVETKVFLHYLPSIRSLWADSGIQTAYDRRREF---QLGESVKYFLDGLDRIGQLDYLPTQQDILLARKPTKGIHEYDFEIKNVPFKMVDVGGQRSERRRWFECFDCVTSVLFLVSSSEFDQVL---MEDRQTNRLTESLSIFETIVNNRVFSNASIILFLNKMDLLEEKV--KLVSIKDYFPEYTE--EPHDLSEVKKFLVECFRS-------KRREQ---------------------QKPLYNHFTTAINTENIRFVFRDVKDTILHENLKQLML 374          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Cavefish
Match: gna13b (guanine nucleotide binding protein (G protein), alpha 13b [Source:ZFIN;Acc:ZDB-GENE-030131-8277])

HSP 1 Score: 228.794 bits (582), Expect = 4.710e-68
Identity = 145/402 (36.07%), Postives = 217/402 (53.98%), Query Frame = 3
Query:  174 CIPKRSRFIGDVDIKHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKV-TNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTI 1376
            C PK     G+ +   Q  KS+EIDK + ++K        ILLLG GESGKSTFLKQM++I+G+ F       F+ TIY NV KGI  L+ AR  L+I +         E  +    + +K +H    T        + FL+ +   + +W D GI+ A+++R +       E+ +++L+ LDK+ + DY PS +DI+ +RKPT  I E + +I       +DVGGQ  ER++W + F  + S+LFL++SS FD+     M     N+L E++ +FE ++N + F +VS+I+F NKTD+L EKV T  I D  S+FT      DPHN+ +V+ FLV  F                   +N+ R          +++ LY HFTTA++  NI  VF  +KDTI
Sbjct:   14 CFPKCLLNSGEAE---QLRKSKEIDKSISKDKTYVKRLVKILLLGAGESGKSTFLKQMRIIHGQDFDQRAKEDFRATIYSNVIKGIRVLVDAREKLHIQWGEPSNQEHGETVMAFDTRSSKMMHGMVET--------KIFLQYLPSIRSLWADSGIQHAYDRRREF---QLGESVKYFLDNLDKLGMPDYLPSQQDILLARKPTKGIHEYDFEIKNVPFKMVDVGGQRSERRRWFECFDSVTSILFLVSSSEFDQVL---MEDRLTNRLMESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKVKTVAIKDYFSDFTG-----DPHNLEEVKDFLVTCF-------------------RNKRRDQ--------QQKPLYHHFTTAINTENIRLVFRDVKDTI 366          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Cavefish
Match: gna13b (guanine nucleotide binding protein (G protein), alpha 13b [Source:ZFIN;Acc:ZDB-GENE-030131-8277])

HSP 1 Score: 208.764 bits (530), Expect = 7.354e-61
Identity = 140/402 (34.83%), Postives = 205/402 (51.00%), Query Frame = 3
Query:  174 CIPKRSRFIGDVDIKHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKV-TNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTI 1376
            C PK     G+ +   Q  KS+EIDK + ++K        ILLLG GESGKSTFLKQM++I+G+ F       F+ TIY NV KGI  L+ AR  L+I +         E  +    + +K +H    T        + FL+ +   + +W D GI+ A+++R +                       DY PS +DI+ +RKPT  I E + +I       +DVGGQ  ER++W + F  + S+LFL++SS FD+     M     N+L E++ +FE ++N + F +VS+I+F NKTD+L EKV T  I D  S+FT      DPHN+ +V+ FLV  F                   +N+ R          +++ LY HFTTA++  NI  VF  +KDTI
Sbjct:   14 CFPKCLLNSGEAE---QLRKSKEIDKSISKDKTYVKRLVKILLLGAGESGKSTFLKQMRIIHGQDFDQRAKEDFRATIYSNVIKGIRVLVDAREKLHIQWGEPSNQEHGETVMAFDTRSSKMMHGMVET--------KIFLQYLPSIRSLWADSGIQHAYDRRREFQL--------------------DYLPSQQDILLARKPTKGIHEYDFEIKNVPFKMVDVGGQRSERRRWFECFDSVTSILFLVSSSEFDQVL---MEDRLTNRLMESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKVKTVAIKDYFSDFTG-----DPHNLEEVKDFLVTCF-------------------RNKRRDQ--------QQKPLYHHFTTAINTENIRLVFRDVKDTI 349          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Cavefish
Match: gna11b (guanine nucleotide-binding protein subunit alpha-11 [Source:NCBI gene;Acc:103033252])

HSP 1 Score: 201.83 bits (512), Expect = 1.164e-58
Identity = 125/394 (31.73%), Postives = 207/394 (52.54%), Query Frame = 3
Query:  216 KHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFD-PHNIVQ-VQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNI 1391
            K  K  + EIDK ++R+KR       +LLLGTGESGKSTF+KQM++I+G  +T  +  GF   +Y N++  +  ++ A  +L I ++ YE+     + +       KE+  EK ++    ++           K++W+D GI+EA+++R +      S+++++YL+ LD+I   +Y P+ +D++  R PT  IIE   D+       +DVGGQ  ER+KW   F+++ S++FL+A S +D+     +  +  N++ E+  +F  +I   +F + SVI+F NK D+L EK++       S   +Y   FD P    Q  ++F++  FV    NP +                           + +Y HFT A D  NI  VF A+KDTILQ N+
Sbjct:   16 KESKRINAEIDKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYTDEDKRGFTKLVYQNIFTSMQSMIRATETLKIGYK-YEQNKANAMLV-------KEVDIEKVSSFDQPYTSA--------IKMLWSDPGIQEAYDRRREY---QLSDSTKYYLSDLDRIAESNYLPTQQDVLRVRIPTTGIIEYPFDLQSIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVL---VESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIS------YSHLVDYFPEFDGPQRDAQAAREFILKMFVDL--NPDSD--------------------------KIIYSHFTCATDTENIRFVFAAVKDTILQLNL 353          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007349.1 (pep scaffold:Pmarinus_7.0:GL488470:4533:13151:-1 gene:ENSPMAG00000006632.1 transcript:ENSPMAT00000007349.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 179.874 bits (455), Expect = 1.324e-51
Identity = 112/369 (30.35%), Postives = 189/369 (51.22%), Query Frame = 3
Query:  294 ILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQ---QFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNI 1391
            +  +GTGESGKSTF+KQM++I+G  +T  +   F   ++ NV+  +  ++ A  +L I + N    + A++         +E+  EK     I   ++ +++ V   + +W D GI+E +++R +      ++++++YLN L +I   +Y P+ +DI+  R PT  IIE   D+       +DVGGQ  ER+KW   F+++ S++FL+A S +D+   +  S+   N++ E+  +F  +I   +F + SVI+F NK D+L EK+      I S   +Y  +FD  N    Q   +F++  FV    NP                            ++ +Y HFT A D  NI  VF A+KD ILQ N+
Sbjct:    1 LFCVGTGESGKSTFIKQMRIIHGSGYTEDDKRSFIKLVHQNVFSAMQAMIRAMETLGIPYANAGNQAHAQLL--------REVDVEK-----ICSLDKPYIEAV---RCLWADPGIEECYDRRREF---QLTDSAKYYLNDLARISAVNYLPTQQDILRVRIPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDSE---NRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKI------IHSHLVDYFPDFDVRNQFDPQAAREFILRMFVEL--NPDT--------------------------EKVIYSHFTCATDTENIRFVFAAVKDAILQLNL 313          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007354.1 (pep scaffold:Pmarinus_7.0:GL488470:4533:13151:-1 gene:ENSPMAG00000006632.1 transcript:ENSPMAT00000007354.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 179.104 bits (453), Expect = 2.085e-51
Identity = 112/368 (30.43%), Postives = 190/368 (51.63%), Query Frame = 3
Query:  294 ILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFD-PHNIVQ-VQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNI 1391
            +  +GTGESGKSTF+KQM++I+G  +T  +   F   ++ NV+  +  ++ A  +L I + N    + A++         +E+  EK     I   ++ +++ V   + +W D GI+E +++R +      ++++++YLN L +I   +Y P+ +DI+  R PT  IIE   D+       +DVGGQ  ER+KW   F+++ S++FL+A S +D+   +  S+   N++ E+  +F  +I   +F + SVI+F NK D+L EK+      I S   +Y  +FD P    Q  ++F++  FV    NP                            ++ +Y HFT A D  NI  VF A+KD ILQ N+
Sbjct:    1 LFCVGTGESGKSTFIKQMRIIHGSGYTEDDKRSFIKLVHQNVFSAMQAMIRAMETLGIPYANAGNQAHAQLL--------REVDVEK-----ICSLDKPYIEAV---RCLWADPGIEECYDRRREF---QLTDSAKYYLNDLARISAVNYLPTQQDILRVRIPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDSE---NRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKI------IHSHLVDYFPDFDGPQQDPQAAREFILRMFVEL--NPDT--------------------------EKVIYSHFTCATDTENIRFVFAAVKDAILQLNL 312          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007638.1 (pep scaffold:Pmarinus_7.0:GL482059:22195:26033:1 gene:ENSPMAG00000006878.1 transcript:ENSPMAT00000007638.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 163.31 bits (412), Expect = 7.383e-46
Identity = 104/350 (29.71%), Postives = 176/350 (50.29%), Query Frame = 3
Query:  300 LLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEY-PENFDPHNIVQ-VQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNI 1343
            L GTGESGKSTF+KQM++I+G  +T  +  GF   +Y N++  +  +  A  +L I +  YE   E       H +  +E+  EK  +    +        V+  + +W+D GI+E +++R +      S+++++YL+ +D+I   +Y P+ +D++  R PT  IIE   D+       +DVGGQ  ER+KW   F+++ S++FL+A S +D+   +  ++   N++ E+  +F  +I   +F S SVI+F NK D+L EK+      + S   +Y PE   P    Q  ++F++  FV    NP +                           + +Y HFT A D  NI
Sbjct:    1 LAGTGESGKSTFIKQMRIIHGSGYTEEDRRGFIKLVYQNIFIAMQAMCRAMETLKIPY-TYEYNKE-------HAQLVREVDIEKVCSFDKPY--------VEAVRCLWDDPGIEECYDRRREY---QLSDSTKYYLSAIDRISGPNYLPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLAESDNE---NRMEESKALFRTIITYPWFHSSSVILFLNKKDLLEEKI------MYSHLVDYFPEFEGPQRDAQAAREFILKMFVDL--NPDS--------------------------DKIIYSHFTCATDTENI 294          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Sea Lamprey
Match: gnai3 (guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 [Source:ZFIN;Acc:ZDB-GENE-070713-6])

HSP 1 Score: 162.925 bits (411), Expect = 4.004e-45
Identity = 108/388 (27.84%), Postives = 189/388 (48.71%), Query Frame = 3
Query:  231 KSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFT-EYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNI 1391
            +SR ID+ ++ +  K      +LLLG GESGKST +KQMK+I+   +T  E   +K  +Y N  + ++ ++ A  +L I+F +     +A         R   +    A  G +        +L    K +W D G++  F +  +      ++++ +YLN L++I    Y P+ +D++ +R  T  I+E             DVGGQ  ERKKW   F+ + +++F +A S +D    +    E  N++ E+M++F+ + N ++F+  S+I+F NK D+  EKV      IRS  T  YPE    +                 +   A+ ++Q+   N N+ + S          + +Y HFT A D +N++ VF+A+ D I++ N+
Sbjct:   15 RSRMIDRNLREDGEKASREVKLLLLGAGESGKSTIVKQMKIIHEAGYTEEECKQYKAVVYSNTIQSVIAIIRAMGNLRIDFGDAGRADDA---------RQLFVLAGSAEDGLMT------PELAQVIKRLWADPGVQACFRRAREY---QLNDSAAYYLNDLERISQPSYVPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAE---DEEMNRMHESMKLFDSICNNKWFIETSIILFLNKKDLFEEKV------IRSPLTICYPEYTGGNT---------------YEEAAAYIQTQFE--NLNKRKES----------KEIYTHFTCATDTKNVQFVFDAVTDVIIKNNL 348          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Sea Lamprey
Match: gna12a (guanine nucleotide binding protein (G protein) alpha 12a [Source:ZFIN;Acc:ZDB-GENE-050221-1])

HSP 1 Score: 152.91 bits (385), Expect = 4.507e-43
Identity = 89/242 (36.78%), Postives = 137/242 (56.61%), Query Frame = 3
Query:  687 SENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKV-TNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNIDQLVMK 1409
             E+ +++L+ LD++   +Y PS +D++ +RK T  I+E + DI       +DVGGQ  +R+KW Q F+ + S+LFL++SS FD+     M     N+L E+M +FE ++N + F  VS+I+F NKTD+L EKV T  I+D   +F        PH +  VQ+FLV SF S                 + + RA+            L+ HFTTA+D  NI  VF A++DTIL+ N+ QL+++
Sbjct:    1 GESVKYFLDNLDRLGEMNYLPSRQDVLLARKATKGIVEHDFDIKNIPFKMVDVGGQRSQRQKWFQCFEGVTSILFLVSSSEFDQVL---MEDRKTNRLVESMNIFETIVNNRTFQGVSIILFLNKTDLLAEKVRTTSIADYFPDFVG-----TPHQLEDVQRFLVRSFDS-----------------KRRERAT-----------PLFHHFTTAIDTENIRYVFEAVRDTILRDNLKQLMLQ 206          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Yeast
Match: GPA2 (Nucleotide binding alpha subunit of the heterotrimeric G protein; interacts with the receptor Gpr1p, has signaling role in response to nutrients; required for the recruitment of Ras-GTP at the plasma membrane and in the nucleus [Source:SGD;Acc:S000000822])

HSP 1 Score: 136.346 bits (342), Expect = 5.099e-35
Identity = 99/367 (26.98%), Postives = 180/367 (49.05%), Query Frame = 3
Query:  294 ILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFI-DVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNI 1391
            +LLLG GESGKST L+Q+K+++   F+  E+  +   IY N+ +    L+ AR+  N+N E      E E+  +D   R          TGQ     E+   ++     + + + +    N     + +S    + +++    +I   +Y+P+ +DI+ SR+ T  I +  ID+     + I DVGGQ  ERKKW   F ++  V+F ++ S +D+     M  + +N+ +E++ +F++++N ++F   SV++F NK D+  EK++ K+  + + F +Y    D   I +  ++++  FV                      RA+++          +Y H T A D  NI  VF A+K+TIL+  +
Sbjct:  126 VLLLGAGESGKSTVLQQLKILHQNGFSEQEIKEYIPLIYQNLLEIGRNLIQARTRFNVNLE-----PECELTQQD-LSRTMSYEMPNNYTGQF---PEDIAGVISTLWALPSTQDLVNGPNASKFYLMDS----TPYFMENFTRITSPNYRPTQQDILRSRQMTSGIFDTVIDMGSDIKMHIYDVGGQRSERKKWIHCFDNVTLVIFCVSLSEYDQTL---MEDKNQNRFQESLVLFDNIVNSRWFARTSVVLFLNKIDLFAEKLS-KVP-MENYFPDYTGGSD---INKAAKYILWRFVQL-------------------NRANLS----------IYPHVTQATDTSNIRLVFAAIKETILENTL 442          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Yeast
Match: GPA1 (Subunit of the G protein involved in pheromone response; GTP-binding alpha subunit of the heterotrimeric G protein; negatively regulates the mating pathway by sequestering G(beta)gamma and by triggering an adaptive response; activates Vps34p at the endosome; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001047])

HSP 1 Score: 101.679 bits (252), Expect = 2.426e-23
Identity = 58/173 (33.53%), Postives = 97/173 (56.07%), Query Frame = 3
Query:  612 FKLIWN-DKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEY 1127
             K +WN DKGIK+ F + ++   E    ++ +Y + ++K    +Y  ++EDI+  R  T  I E E +I  +    +D GGQ  ERKKW   F+ + +VLF++A S +D+  ++    E  N++ E++ +F+ L+N ++F     I+F NK D+  EKV  K   IR  F +Y
Sbjct:  245 IKQLWNNDKGIKQCFARSNEFQLEG---SAAYYFDNIEKFASPNYVCTDEDILKGRIKTTGITETEFNIGSSKFKVLDAGGQRSERKKWIHCFEGITAVLFVLAMSEYDQMLFE---DERVNRMHESIMLFDTLLNSKWFKDTPFILFLNKIDLFEEKV--KSMPIRKYFPDY 409          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Nematostella
Match: EDO47993 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKI8])

HSP 1 Score: 234.572 bits (597), Expect = 1.828e-71
Identity = 143/398 (35.93%), Postives = 223/398 (56.03%), Query Frame = 3
Query:  222 QKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQII--WSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNIDQLVMK 1409
            Q+A+S++IDK + +EK +   +  ILLLG GESGKSTFLKQM++I GK F +  L  +K  +Y N+ KG+  L  AR  L I+++                  + E+H E+  T Q       E FL+  +  + +W D GI+++F++R +       +++R++L+ LD+I   DY P+ +D++ SRK T  I+E E  I       +DVGGQ  +R KW Q F ++ S+LFL++SS +D+     M     N+L E+  +FE ++N ++F +VS+I+F NKTD+LTEKV  K ++I+  F  +    DPH +  VQ F++  F S         R + S                    + L+ HFTTAVD  NI+ VF+A+KDTILQ N+  L+++
Sbjct:   15 QRAQSQKIDKQIAQEKAQLRRQVKILLLGAGESGKSTFLKQMRIIYGKDFDADALQEYKPVVYSNILKGMKVLADARRKLRIDWD----------------APDNEMHAERILTLQAPPRIDTEFFLQYAESVRRLWTDAGIRDSFDRRREF---QLGDSTRYFLDHLDRICRADYIPTKQDMLHSRKATKGIVEHEFMIKSIPFKMVDVGGQRSQRAKWFQCFDEVTSILFLVSSSAYDQVL---MEDRTTNRLVESCNIFETIVNNKFFANVSIILFLNKTDLLTEKV--KHTNIKDFFPAF--QGDPHKLEDVQNFILQMFDS--------KRRERS--------------------KALFHHFTTAVDTENIKFVFHAVKDTILQENLKALMLQ 358          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Nematostella
Match: EDO41465 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S470])

HSP 1 Score: 187.963 bits (476), Expect = 5.807e-54
Identity = 123/395 (31.14%), Postives = 204/395 (51.65%), Query Frame = 3
Query:  216 KHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAE-IRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFD-PHNIVQ-VQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNI 1391
            K +K  + EI+K ++++KR       +LLLGTGESGKSTF+KQM++I+G+ ++  +  G+   +Y N+   +  L  A  +L I +++     +A  IR  D          +  TT      E E+ +     K +W+D G++E +++R +      S+++++YL  LD++   DY P+ +D++ +R PT  IIE   D+       +DVGGQ  ER+KW   F+++ S++FL+A S +D+   +  S+   N++ E+  +F  +I   +F + S+I+F NK D+L EK+      + S   EY   FD P    Q  ++F++  FV    NP                             + +Y HFT A D  NI  VF A+KDTILQ N+
Sbjct:   10 KERKRINAEIEKQIRQDKRNQRRELKLLLLGTGESGKSTFIKQMRIIHGQGYSDEDKRGYIPLVYQNIITAMHSLTRAMETLKIPYKDSSNLEKASYIRTVD---------PKNVTTF-----EREYYEAT---KSLWSDAGMQECYDRRREY---QLSDSAKYYLTDLDRLAKPDYLPTEQDVLRARAPTSGIIEYPFDLETIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDSE---NRMEESKALFRTIITYPWFQNSSIILFLNKKDLLEEKI------MFSHLVEYFPEFDGPQCDAQAAREFILKMFVDL--NPDTD--------------------------KIIYSHFTCATDTENIRFVFAAVKDTILQLNL 347          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Nematostella
Match: EDO32540 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUS4])

HSP 1 Score: 164.081 bits (414), Expect = 3.258e-45
Identity = 106/388 (27.32%), Postives = 192/388 (49.48%), Query Frame = 3
Query:  228 AKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNI 1391
            A+S+ I+K +K E  +      +LLLG GESGKST +KQM++I+   F+  +   ++  ++ N    +L ++ A   L I+FEN     +A++ + D   R  +             +E    +L +  + +W D G+++ F++  +       +++++YL+ L +I   +Y+ + +D++ +R  T  I+E + D         DVGGQ  ERKKW   F+D+ ++++ +A S +D         E  N++ E++++FE +IN ++F+  SVI+F NK D+  EK++     +      +PE   P               S  D    + R Q+ + N N              ++ +Y H T A D +NI  VFNA+ DTI+  N+
Sbjct:   14 ARSKAIEKNLKLEGARAERDVKLLLLGAGESGKSTIVKQMRIIHDHGFSPEDYIQYRPLVFSNTIYSLLTIIRAMDKLRIDFENDARLMDAKL-VFDVIARADD-------------TEPFTPELTESMERLWKDAGVQQCFHRSREY---QLGDSAKYYLDSLQRIGAPNYEATEQDLLRTRVKTTGIVEVQFDYKRLHFKLFDVGGQRSERKKWIHCFEDVTAIIYCVALSAYD---LTLEEDESTNRMEESLKLFESIINNKWFVDTSVILFLNKKDLFEEKISKFPLTLC-----FPEYSGP---------------STFDEGAKYIRKQFESKNLND-------------EKEIYTHLTCATDTQNINFVFNAVTDTIIANNL 348          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Nematostella
Match: EDO49692 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG04])

HSP 1 Score: 162.54 bits (410), Expect = 1.132e-44
Identity = 103/392 (26.28%), Postives = 189/392 (48.21%), Query Frame = 3
Query:  216 KHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNI 1391
            K    +S+ IDK ++ +  +      +LLLG GESGKST +KQMK+I+   ++  E   +K  +Y N  + ++ ++ A  +L I F + +   +A           +E+     +   + ++ E    L+   K +W+D GI+  F +  +      ++++ +YLN LD++   DY P+ +D++ +R  T  I+E             DVGGQ  ERKKW   F+ + +++F +A S +D    +    E  N++ E+M++F+ + N ++F   S+I+F NK D+  EK+    S +   F EY  +                  +  +   A+ + Q+   N+ +              + +Y HFT A D  NI+ VF+A+ D I++ N+
Sbjct:   10 KAAAERSKMIDKNLRADGERAAREVKLLLLGAGESGKSTIVKQMKIIHEHGYSKEECTQYKQVVYSNTIQSMIAIIRAMGTLKIEFGHPDRADDA-----------REMFALAGSMEDVKFTAE----LISIMKRLWSDSGIQACFARSREY---QLNDSASYYLNALDRLGSPDYVPTEQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAE---DEEMNRMMESMKLFDSICNNKWFTDTSIILFLNKKDLFAEKIVK--SPLTICFPEYTGS------------------NTYEEAAAYIQMQFENLNKRK------------DTKEIYTHFTCATDTNNIQFVFDAVTDVIIKNNL 348          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Nematostella
Match: EDO49193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHA6])

HSP 1 Score: 155.221 bits (391), Expect = 8.632e-42
Identity = 113/396 (28.54%), Postives = 195/396 (49.24%), Query Frame = 3
Query:  243 IDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLING-KKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKV---TNKISDIRSEFTEY-------PENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNIDQ 1397
            I++ +K +K  +   H +LLLG GESGKST +KQM++++    FT  E     + I  N+   IL +  A S+L         T   ++   ++  R   +H E AT     +  E +    +  K++W D G+ E + + ++       + ++++L+++D I+ +DY P+ +D++  R  T  IIE   ++        DVGGQ  ER+KW Q F D+ +++F++A S ++    +  S+   N+L+E++ +F+ + N ++  ++SVI+F NK D+L +KV    +KI D   +F  Y        E  D   + + + F+ D F+                      R S A   G   K   Y HFT AVD  NI  VFN  +D I + ++ Q
Sbjct:   26 IERQLKEDKIAYRATHRLLLLGAGESGKSTIVKQMRILHDVHGFTELEKRQKIEDIKKNIRDAILTITGAMSTL---------TPPVKLANPNNQFRLDYVH-EVATAPDFDYPPEFY----EHTKILWQDAGVLECYERSNEY---QLIDCAQYFLDRVDTIQQQDYLPTEQDLLRCRVLTSGIIETRFEVDRVKFHMFDVGGQRDERRKWIQCFNDVTAIIFVVACSSYNLVLREDASQ---NRLKESLELFKSIWNNRWLRTISVILFLNKQDLLKDKVRAGKSKIEDYFPDFARYRTPPDATAEPGDEEAVTRAKYFIRDEFL----------------------RISTASGDG---KHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQ 376          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Medaka
Match: gna12a (G protein subunit alpha 12 [Source:NCBI gene;Acc:101166935])

HSP 1 Score: 251.521 bits (641), Expect = 5.027e-77
Identity = 147/398 (36.93%), Postives = 222/398 (55.78%), Query Frame = 3
Query:  216 KHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNIDQLVMK 1409
            +  K +SREID ++ RE+R       ILLLG GESGKSTFLKQM++ING++F    L  F+DTIY+N+ KG+  L+ AR  L I +++ E   +  +           +   +   G       EF   V     +W D GI++A+ +RS+      SE+ +++L+ LD+I   +Y PS +DI+++RK T  I+E +  I       +DVGGQ  +R+KW Q F  + S+LF+++SS +D+     M     N+L E+M +FE ++N + FL+VS+I+F NKTD+L EK+  +  DIR  F E+    DP  +  VQ FLV SF               S   +N+G+              L+ HFTTAVD  NI  VF+A+KDTILQ N+  ++++
Sbjct:   37 REAKRRSREIDAMLARERRAVRRLVKILLLGAGESGKSTFLKQMRIINGQEFDQKALLDFRDTIYENILKGMRVLVDARDKLGITWQSCENEKQGML-----------VMSWEGRVGASGVEPSEFQLYVMALSSLWADAGIQQAYARRSEF---QLSESVKYFLDNLDRIGQLNYIPSRQDILFARKATKGIVEHDFVIKKIPFKMVDVGGQRSQRQKWFQCFDGITSILFMVSSSEYDQVL---MEDRRTNRLVESMNIFETIVNNKLFLNVSIILFLNKTDLLVEKI--RTVDIRKNFPEF--RGDPRRLEDVQAFLVQSF---------------SRKRRNRGKP-------------LFHHFTTAVDTENIRFVFHAVKDTILQENLKDIMLQ 385          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Medaka
Match: ENSORLT00000036724.1 (guanine nucleotide-binding protein subunit alpha-13-like [Source:NCBI gene;Acc:101175626])

HSP 1 Score: 221.476 bits (563), Expect = 7.055e-66
Identity = 145/419 (34.61%), Postives = 218/419 (52.03%), Query Frame = 3
Query:  150 FVD*LMLPCIPKRSRFIGDVDIKHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKV-TNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNIDQLV 1403
             VD L   C+P  S     V++K Q  KS+EID+ + REK+       ILLLG GESGKSTFLKQM++I+G  F       FK TIY NV KGI  L+ AR  L+I + + + ++        H  +   I+   A          +F++ +   + +W D GI+ A+++R +       E  +++L+ LDK+   DY PS +DI+ +RKPT  I E +  I       +DVGGQ   R++W + F  + S+LFL++SS +D+     M     N+L E++ +FE ++N + F  +S+I+F NKTD+L EKV T K+ D   E+T  PE    H++  +Q F+VD F           R++    +  Q                LY HFTTA++  NI  VF  +KD I   N+   V
Sbjct:    1 MVDSLPTRCLPVCS--FNCVELKKQTRKSKEIDENLSREKKYVKRLVKILLLGAGESGKSTFLKQMRIIHGDDFDQRARQEFKPTIYSNVIKGIRVLVDAREKLHIPWGDPKNST--------HGDKVMAINTRSAMMANGQLETADFVEYLPAIRALWADSGIQNAYDRRREF---QLGEAVKYFLDNLDKLSEPDYLPSQQDILLARKPTKGIHEYDFVIKNVPFKMVDVGGQRFVRRRWVECFDSVTSILFLLSSSEYDQVL---MEDRQTNRLCESLNIFETIVNNRVFADISIILFLNKTDLLEEKVKTVKLKDYFPEYTG-PE----HSLPDIQGFMVDCF-----------RAKRRNNSHEQ----------------LYHHFTTAINTENIRLVFQNVKDIIFYGNLKGCV 371          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Medaka
Match: ENSORLT00000023491.2 (guanine nucleotide-binding protein subunit alpha-13 [Source:NCBI gene;Acc:101162018])

HSP 1 Score: 214.157 bits (544), Expect = 3.054e-63
Identity = 142/413 (34.38%), Postives = 213/413 (51.57%), Query Frame = 3
Query:  174 CIPKRSRFIGDVDIKHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKV-TNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNIDQLVMK 1409
            C+P      G+V+   Q  KS++IDK + REK+       ILLLG GESGKSTFLKQM++I+G  F       FK TIY NV KGI  L+ AR  L+I + + + ++        H  +   I+   A          +F++ +   + +W D GI+ A+++R +                       DY PS +DI+ +RKPT  I E +  I       +DVGGQ  ER++W + F  + S+LFL++SS +D+     M     N+L E++ +FE ++N + F +VS+I+F NKTD+L EKV T K+ D   E+T  PE    H++  +Q F+VD F           R++   G Q                + LY HFTTA++  NI  VF  +KDTIL  N+ QL+++
Sbjct:   14 CLPVCLLNSGEVE---QIQKSKKIDKNLSREKKYVKRLVKILLLGAGESGKSTFLKQMRIIHGDDFDQRARQEFKPTIYSNVIKGIRVLVDAREKLHIPWGDPKNST--------HGDKVMAINTRSAMMANGQLETADFVEYLPAIRALWADSGIQNAYDRRREFQL--------------------DYLPSQQDILLARKPTKGIHEYDFVIKNVPFKMVDVGGQRSERRRWFECFDSVTSILFLVSSSEYDQVL---MEDRQTNRLCESLNIFETIVNNRVFANVSIILFLNKTDLLEEKVKTVKLKDYFPEYTG-PE----HSLPDIQGFMVDCF-----------RAKRRDGPQ----------------KLLYHHFTTAINTENIRLVFRDVKDTILHDNLKQLMLQ 360          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Medaka
Match: ENSORLT00000033394.1 (guanine nucleotide-binding protein G(q) subunit alpha [Source:NCBI gene;Acc:101158934])

HSP 1 Score: 201.445 bits (511), Expect = 1.362e-58
Identity = 128/417 (30.70%), Postives = 214/417 (51.32%), Query Frame = 3
Query:  153 VD*LMLPCIPKRSRFIGDVDIKHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEY-PENFDPHNIVQV-QQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNIDQ 1397
            +D +M  C+ + +        K  K  + EI+K ++R+KR       +LLLGTGESGKSTF+KQM++I+G  +T  +  GF   +Y N++  +  ++HA  +LNI ++ YEE     + + D                 I   E+ ++K +   +++W+D GI EA+++R +      S+++++YL+ LD+I    Y P+ +D++  R PT  IIE   D+       +DVGGQ  ER+KW   F+++ S++FL+A S +D+     +  +  N++ E+  +F  +I   +F + SVI+F NK D+L EK+      + S   +Y PE   P    Q  ++F++  F+    NP                             + +Y HFT A D  NI  VF A+KDTILQ N+ +
Sbjct:    3 LDSMMACCLSEEA--------KESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYTEEDKRGFTKLVYQNIFTSMQAMIHAAENLNIPYK-YEENKNNALLVRD------------VDVEMISRFEQPYIKAI---RMLWSDPGIMEAYDRRREY---QLSDSTKYYLSALDRIADPSYLPTQQDVLRVRIPTTGIIEYPFDLQSIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVL---VESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKI------MYSHLVDYFPEFEGPRRDAQAGREFILKMFLDL--NPD----------------------------KVIYSHFTCATDTENIRFVFAAVKDTILQFNLKE 353          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Medaka
Match: ENSORLT00000043083.1 (guanine nucleotide-binding protein G(q) subunit alpha [Source:NCBI gene;Acc:101158934])

HSP 1 Score: 201.445 bits (511), Expect = 1.362e-58
Identity = 128/417 (30.70%), Postives = 214/417 (51.32%), Query Frame = 3
Query:  153 VD*LMLPCIPKRSRFIGDVDIKHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEY-PENFDPHNIVQV-QQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNIDQ 1397
            +D +M  C+ + +        K  K  + EI+K ++R+KR       +LLLGTGESGKSTF+KQM++I+G  +T  +  GF   +Y N++  +  ++HA  +LNI ++ YEE     + + D                 I   E+ ++K +   +++W+D GI EA+++R +      S+++++YL+ LD+I    Y P+ +D++  R PT  IIE   D+       +DVGGQ  ER+KW   F+++ S++FL+A S +D+     +  +  N++ E+  +F  +I   +F + SVI+F NK D+L EK+      + S   +Y PE   P    Q  ++F++  F+    NP                             + +Y HFT A D  NI  VF A+KDTILQ N+ +
Sbjct:    3 LDSMMACCLSEEA--------KESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYTEEDKRGFTKLVYQNIFTSMQAMIHAAENLNIPYK-YEENKNNALLVRD------------VDVEMISRFEQPYIKAI---RMLWSDPGIMEAYDRRREY---QLSDSTKYYLSALDRIADPSYLPTQQDVLRVRIPTTGIIEYPFDLQSIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVL---VESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKI------MYSHLVDYFPEFEGPRRDAQAGREFILKMFLDL--NPD----------------------------KVIYSHFTCATDTENIRFVFAAVKDTILQFNLKE 353          
BLAST of Guanine nucleotide binding protein subunit vs. Planmine SMEST
Match: SMESG000056024.1 (SMESG000056024.1)

HSP 1 Score: 855.129 bits (2208), Expect = 0.000e+0
Identity = 414/415 (99.76%), Postives = 414/415 (99.76%), Query Frame = 3
Query:  165 MLPCIPKRSRFIGDVDIKHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNIDQLVMK 1409
            MLPCIPKRSRFIGDVDIKHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLING KFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNIDQLVMK
Sbjct:    1 MLPCIPKRSRFIGDVDIKHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGIKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNIDQLVMK 415          
BLAST of Guanine nucleotide binding protein subunit vs. Planmine SMEST
Match: SMESG000040143.1 (SMESG000040143.1)

HSP 1 Score: 452.595 bits (1163), Expect = 8.836e-155
Identity = 228/419 (54.42%), Postives = 307/419 (73.27%), Query Frame = 3
Query:  165 MLPCIP-KRSRFIGDVDIKHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACI-VFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNP-GAHPRSQYSAGNQNQGRASIAGQAG--VPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNIDQLVM 1406
            M  C    + +F  ++D+K QK+ S+ IDK +K E+RK L +  ILLLGTGESGKSTFLKQMK+I G+KFT  E+  FKD IYDN++KG+LFL+ AR+ LNI++ + E  + AE  IE +F   K IH+++  + Q++W E EFL++V   K IWNDK I++ F +RS+++TE+FSEN+R+YLNK+D+I   +Y P++EDIVW+RKPT+SIIE EI++    I VFIDVGGQTKER+KWCQ+F DM SVLFLIA SHFDE Y D+ + + RNKL+EAM VFE+LIN   FL VSV++FFNKTD+L+EK+ +  S+I  +F ++P+  DP+N+V VQ F+VDSFV  +DNP G   R+ Y   N   G   +       +P KRT+YRHFTTAVD+ NIE VF AMKDTILQ NI +++M
Sbjct:    1 MFTCFKNSKKKFYKEIDLKSQKSFSKLIDKSLKIERRKNLMKQHILLLGTGESGKSTFLKQMKIICGQKFTVYEIESFKDIIYDNIFKGVLFLIDARAQLNIDWNDNETANSAE-EIERYFDETKLIHRQRRQSKQLLWKENEFLEIVPRLKAIWNDKSIQQTFLRRSEIITETFSENTRYYLNKIDEIGTLNYFPTDEDIVWTRKPTESIIETEIEVSNDIILVFIDVGGQTKERRKWCQLFHDMKSVLFLIACSHFDEEYMDRFTLQKRNKLKEAMFVFEELINQNAFLRVSVLLFFNKTDILSEKIKSHQSNIGKDFQDFPDESDPYNLVDVQMFIVDSFVKLIDNPYGNDKRASYIRSNSVSGNKRVVSPVPMQIP-KRTIYRHFTTAVDKSNIEKVFIAMKDTILQNNIRKIMM 417          
BLAST of Guanine nucleotide binding protein subunit vs. Planmine SMEST
Match: SMESG000023274.1 (SMESG000023274.1)

HSP 1 Score: 192.586 bits (488), Expect = 1.935e-55
Identity = 125/397 (31.49%), Postives = 198/397 (49.87%), Query Frame = 3
Query:  216 KHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATT---GQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFD-PHNIVQ-VQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNI 1391
            K Q   ++EI+K +KR+K+       +LLLGTGESGKSTF+KQM++I+G  ++  +   F   IY N+Y     L+ A   L I +EN +    A        K  ++I  E  TT     I+ +           + +WND G+KE +++R +      ++++++YL+ LD+I   DY P+ +DI+  R PT  IIE   D+       +DVGGQ  ER+KW   F+ + S++FL+A S +D+     +  +  N++ E+  +F  +I   +F   SVI+F NK D+L EK+        S   +Y   F+ P    +  + F++  FV    +P                            ++ +Y HFT A D  NI  VF A+KDTILQ N+
Sbjct:   10 KEQSRINKEIEKQLKRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGTGYSDDDKRSFIKLIYQNIYLATYTLIRAMEVLKIPYENPDNLEYA--------KDLRDIDYETVTTFEPSHIVAT-----------RSLWNDSGVKECYDRRREY---QLTDSAKYYLDDLDRIVTPDYLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFESVTSIMFLVALSEYDQVL---VESDNENRMEESKALFRTIITYPWFQDSSVILFLNKKDLLEEKIQ------YSHLVDYFPQFEGPQRDAEAARDFILKMFVDLNPDP----------------------------EKIIYSHFTCATDTENIRFVFAAVKDTILQLNL 347          
BLAST of Guanine nucleotide binding protein subunit vs. Planmine SMEST
Match: SMESG000022892.1 (SMESG000022892.1)

HSP 1 Score: 189.889 bits (481), Expect = 1.957e-54
Identity = 123/394 (31.22%), Postives = 202/394 (51.27%), Query Frame = 3
Query:  216 KHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEY-PENFDPHNIVQVQQ-FLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNI 1391
            K QK  ++EI+K +K++K++      +LLLGTGESGKSTF+KQM++I+G  ++  +   F   +Y N+Y  I  L+ A  +L I++ N E  S        +    K I  E  +T +           V   K +W D G+KE +++R +      ++++++YL+ LD+I   ++ P+ +DI+  R PT  IIE   D+       +DVGGQ  ER+KW   F+++ S++FL+A S +D+     +  +  N++ E+  +F  +I   +F + SVI+F NK D+L EK+      I S   +Y PE   P    +  + F++  F+    NP                           +++ +Y HFT   D  NI  VF A+KDTILQ N+
Sbjct:   10 KEQKRINKEIEKQLKKDKKESRRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRSFIKLVYQNIYLAIYTLILAMENLAISYSNPENLS--------YIDEIKNIDYESVSTLEP--------DHVIAIKSLWADVGVKECYDRRREF---QLTDSAKYYLDSLDRIATPNFLPTLQDILRVRVPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQ---GLVESDNDNRMEESKALFRTIITYPWFHNASVILFLNKKDLLEEKI------IYSHLVDYFPEYEGPQRDAEAARDFILKMFIEL--NPD--------------------------QEKIIYSHFTCGTDTENIRFVFAAVKDTILQCNL 347          
BLAST of Guanine nucleotide binding protein subunit vs. Planmine SMEST
Match: SMESG000026774.1 (SMESG000026774.1)

HSP 1 Score: 184.496 bits (467), Expect = 1.848e-52
Identity = 120/398 (30.15%), Postives = 200/398 (50.25%), Query Frame = 3
Query:  201 GDVDIKHQKAKSREIDKLMKREKRKFLTRHSILLLGTGESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLNINFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLK-LVDDFKLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDIVWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFLIASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKTDVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGAHPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAMKDTILQRNI 1391
            G V  K Q+ K++EI++ ++++  K +    +LLLG GE GKST LKQM +I+GK +   E   +   IY NV + ++ +L+A  +L I+ EN  E    E +I   + RN E              E EF K L     L+W D  ++  + +  +      ++++ +YL+ LD++    Y P+ +D++ SR  T  I+E             DVGGQ  ERKKW   F+ + ++LFL+A S +D    +  S    N++ E+MR+F+ + N Q+F++ S+I+F NK D+  EKV    S +   F EY                  +  +  +   A+ +SQ+   N+ +            + +T+Y HFT A D  NI+ VF+A+ D I++ N+
Sbjct:    5 GSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMEN--EAMIEESKIVQKYMRNAE--------------EGEFPKELGSALALLWKDDSVQNCYARAKEY---QLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSS---TNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVK--SPLTVCFPEY------------------TGANIYEEASAYIQSQFEELNKKK------------ETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNL 348          
The following BLAST results are available for this feature:
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GNA138.724e-7135.19G protein subunit alpha 13 [Source:HGNC Symbol;Acc... [more]
GNA121.365e-6835.38G protein subunit alpha 12 [Source:HGNC Symbol;Acc... [more]
GNAQ1.655e-5731.61G protein subunit alpha q [Source:HGNC Symbol;Acc:... [more]
GNA111.816e-5631.31G protein subunit alpha 11 [Source:HGNC Symbol;Acc... [more]
GNA142.313e-5430.10G protein subunit alpha 14 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egl-302.837e-5831.05EGL-30; Heterotrimeric G protein alpha subunit [S... [more]
gpa-126.099e-5732.42Guanine nucleotide-binding protein alpha-12 subuni... [more]
gpa-161.898e-4929.49Guanine nucleotide-binding protein alpha-16 subuni... [more]
goa-12.036e-4827.91Guanine nucleotide-binding protein G(o) subunit al... [more]
gpa-43.251e-4827.76Guanine nucleotide-binding protein alpha-4 subunit... [more]
back to top
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cta6.326e-6232.49gene:FBgn0000384 transcript:FBtr0111126[more]
cta6.326e-6232.49gene:FBgn0000384 transcript:FBtr0334157[more]
Galphaq1.693e-5730.85gene:FBgn0004435 transcript:FBtr0087832[more]
Galphaq1.082e-5530.71gene:FBgn0004435 transcript:FBtr0087833[more]
Galphaq1.082e-5530.71gene:FBgn0004435 transcript:FBtr0087830[more]
back to top
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gna12a1.201e-7437.19guanine nucleotide binding protein (G protein) alp... [more]
gna13a1.148e-7336.32guanine nucleotide binding protein (G protein), al... [more]
gna13b3.620e-6834.62guanine nucleotide binding protein (G protein), al... [more]
gna11b2.635e-5831.73guanine nucleotide binding protein (G protein), al... [more]
gna11a3.594e-5831.98guanine nucleotide binding protein (G protein), al... [more]
back to top
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gna134.242e-7035.61guanine nucleotide binding protein (G protein), al... [more]
gnaq4.228e-5932.38guanine nucleotide binding protein (G protein), q ... [more]
gnaq4.745e-5932.38guanine nucleotide binding protein (G protein), q ... [more]
gna114.779e-5528.92guanine nucleotide binding protein (G protein), al... [more]
adprh1.030e-5230.57ADP-ribosylarginine hydrolase [Source:Xenbase;Acc:... [more]
back to top
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gna138.850e-7235.86guanine nucleotide binding protein, alpha 13 [Sour... [more]
Gna128.150e-6935.64guanine nucleotide binding protein, alpha 12 [Sour... [more]
Gna121.077e-6034.82guanine nucleotide binding protein, alpha 12 [Sour... [more]
Gnaq8.080e-5831.61guanine nucleotide binding protein, alpha q polype... [more]
Gna114.925e-5731.06guanine nucleotide binding protein, alpha 11 [Sour... [more]
back to top
BLAST of Guanine nucleotide binding protein subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6Q7Y5|GNA13_RAT2.233e-7135.86Guanine nucleotide-binding protein subunit alpha-1... [more]
sp|P27601|GNA13_MOUSE6.191e-7135.86Guanine nucleotide-binding protein subunit alpha-1... [more]
sp|Q14344|GNA13_HUMAN4.190e-7035.19Guanine nucleotide-binding protein subunit alpha-1... [more]
sp|Q63210|GNA12_RAT1.044e-6835.90Guanine nucleotide-binding protein subunit alpha-1... [more]
sp|P27600|GNA12_MOUSE5.701e-6835.64Guanine nucleotide-binding protein subunit alpha-1... [more]
back to top
BLAST of Guanine nucleotide binding protein subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2DKC11.051e-15355.05Guanine nucleotide-binding protein subunit alpha-1... [more]
A0A094ZSX31.901e-14854.15Guanine nucleotide-binding protein subunit alpha-1... [more]
G4VRC14.830e-14854.15Putative gtp-binding protein alpha subunit, gna OS... [more]
A0A430QQB51.699e-14753.92Guanine nucleotide-binding protein subunit alpha-1... [more]
A0A4S2LBM01.381e-14551.16Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gna12a2.029e-7135.68G protein subunit alpha 12 [Source:NCBI gene;Acc:1... [more]
gna13a7.728e-7135.35guanine nucleotide-binding protein subunit alpha-1... [more]
gna13b4.710e-6836.07guanine nucleotide binding protein (G protein), al... [more]
gna13b7.354e-6134.83guanine nucleotide binding protein (G protein), al... [more]
gna11b1.164e-5831.73guanine nucleotide-binding protein subunit alpha-1... [more]
back to top
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007349.11.324e-5130.35pep scaffold:Pmarinus_7.0:GL488470:4533:13151:-1 g... [more]
ENSPMAT00000007354.12.085e-5130.43pep scaffold:Pmarinus_7.0:GL488470:4533:13151:-1 g... [more]
ENSPMAT00000007638.17.383e-4629.71pep scaffold:Pmarinus_7.0:GL482059:22195:26033:1 g... [more]
gnai34.004e-4527.84guanine nucleotide binding protein (G protein), al... [more]
gna12a4.507e-4336.78guanine nucleotide binding protein (G protein) alp... [more]
back to top
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
GPA25.099e-3526.98Nucleotide binding alpha subunit of the heterotrim... [more]
GPA12.426e-2333.53Subunit of the G protein involved in pheromone res... [more]
back to top
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO479931.828e-7135.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414655.807e-5431.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO325403.258e-4527.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO496921.132e-4426.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491938.632e-4228.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gna12a5.027e-7736.93G protein subunit alpha 12 [Source:NCBI gene;Acc:1... [more]
ENSORLT00000036724.17.055e-6634.61guanine nucleotide-binding protein subunit alpha-1... [more]
ENSORLT00000023491.23.054e-6334.38guanine nucleotide-binding protein subunit alpha-1... [more]
ENSORLT00000033394.11.362e-5830.70guanine nucleotide-binding protein G(q) subunit al... [more]
ENSORLT00000043083.11.362e-5830.70guanine nucleotide-binding protein G(q) subunit al... [more]
back to top
BLAST of Guanine nucleotide binding protein subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056024.10.000e+099.76SMESG000056024.1[more]
SMESG000040143.18.836e-15554.42SMESG000040143.1[more]
SMESG000023274.11.935e-5531.49SMESG000023274.1[more]
SMESG000022892.11.957e-5431.22SMESG000022892.1[more]
SMESG000026774.11.848e-5230.15SMESG000026774.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003039 ID=SMED30003039|Name=Guanine nucleotide binding protein subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=1924bp
CTTATTTAAATTAATAAACTTATGTAAAAATAAATTTTATAATTAAGTTA
TTCAAATTAAAATTTATAGAAAGATTACTTTTTATTTTAAGCACTTTTCT
AGTTTATGCCCTACATAATAAATTAAATAAATAATCTTTAATAAGAACAT
TTGTAGATTAATTGATGCTTCCTTGTATTCCTAAAAGATCTCGATTTATA
GGCGATGTTGATATTAAACATCAAAAAGCGAAAAGTCGCGAAATTGATAA
ATTAATGAAAAGAGAAAAACGAAAATTTTTAACCAGGCATAGTATTCTAC
TGCTTGGAACAGGCGAAAGTGGTAAAAGCACATTTCTTAAACAAATGAAA
TTAATAAACGGAAAAAAATTTACATCTGCGGAATTAGCTGGATTTAAAGA
CACAATTTATGATAATGTCTATAAAGGAATATTATTTTTACTTCATGCAC
GCTCTAGTTTGAACATTAACTTTGAAAATTATGAAGAAACATCAGAAGCT
GAAATACGCATTGAAGATCATTTTAAACGAAATAAAGAAATTCACAAAGA
AAAGGCAACAACAGGACAGATAATTTGGTCAGAAGAGGAATTCTTAAAAT
TAGTAGACGATTTTAAATTAATATGGAATGACAAAGGTATAAAAGAAGCA
TTTAATCAGCGTTCAAAATTGATGACCGAAAGTTTCAGTGAAAATTCTCG
GTTCTATTTGAATAAGCTAGACAAGATTAGAGTGAAGGATTATCAACCTA
GTAACGAAGATATTGTTTGGTCTCGTAAACCTACCGACTCCATTATCGAA
GAAGAAATTGATATTCACGGAGCTTGTATTGTATTTATTGACGTTGGTGG
TCAAACAAAAGAACGAAAGAAATGGTGTCAAGTGTTTCAGGACATGAATA
GTGTTTTATTTCTTATTGCCAGCAGTCATTTTGATGAGTTTTATTATGAC
AAAATGTCTAAAGAATACAGAAATAAATTACGAGAAGCTATGCGAGTATT
TGAAGATTTAATCAACGTTCAATATTTTCTATCTGTTTCTGTTATAATAT
TCTTTAATAAAACTGATGTTCTAACTGAAAAGGTTACTAACAAAATATCC
GACATTCGTAGTGAATTTACTGAATATCCTGAAAACTTTGACCCACATAA
CATTGTTCAAGTTCAGCAGTTTTTAGTTGATTCGTTTGTATCCTTTGTTG
ATAACCCAGGTGCTCACCCCAGATCGCAATACAGTGCTGGAAATCAGAAT
CAAGGCAGAGCTTCGATAGCAGGTCAGGCCGGGGTTCCGAAAAAACGAAC
TCTGTATCGCCATTTTACTACCGCGGTAGATCAGCGAAATATCGAAACGG
TATTTAACGCCATGAAAGATACAATATTACAGCGCAACATTGACCAGTTG
GTTATGAAATAACAAAAATGTTGTTTATAATTTATATATCAACTCGTTTT
ATTTTAATTGCTATAGTACTATTAAAATTATTTTGTTTTAATTCACACAG
AGTGTTTAAAATAAAGATATTATTTTATCATTCTTTAGACATGATGTTGA
TTTATGGAAAAACTTAAATTGTATTTATATTTTTAATATAAATTTTTAAG
TGCAAAAAAAATGATGTTTTATTTGTTATGAAATCAGAATATTGCGCTTA
ATGTTCACGAAATTTTGTTGTCTGAATTGTAAAATATTATTATATTTATA
ACAATTTAATAAATGTAATATATCTACCAAAAATCTTGAAGTGTGCTGCC
TGATATCAAAATCCGGTATTATTGTTGAGTCTGAAATTAAAATTATTATT
TTCAGTTTATTTGTTTAGAATGATGTATAAAAAAATTTCAAACGTATTTA
TTATCTGTGATTCTATCAAATAAACACCTTTCAAGTTGCTTTACTTAGAT
GTTTTTGTTCAAGGAAAAGTTTTG
back to top

protein sequence of SMED30003039-orf-1

>SMED30003039-orf-1 ID=SMED30003039-orf-1|Name=SMED30003039-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=416bp
MLPCIPKRSRFIGDVDIKHQKAKSREIDKLMKREKRKFLTRHSILLLGTG
ESGKSTFLKQMKLINGKKFTSAELAGFKDTIYDNVYKGILFLLHARSSLN
INFENYEETSEAEIRIEDHFKRNKEIHKEKATTGQIIWSEEEFLKLVDDF
KLIWNDKGIKEAFNQRSKLMTESFSENSRFYLNKLDKIRVKDYQPSNEDI
VWSRKPTDSIIEEEIDIHGACIVFIDVGGQTKERKKWCQVFQDMNSVLFL
IASSHFDEFYYDKMSKEYRNKLREAMRVFEDLINVQYFLSVSVIIFFNKT
DVLTEKVTNKISDIRSEFTEYPENFDPHNIVQVQQFLVDSFVSFVDNPGA
HPRSQYSAGNQNQGRASIAGQAGVPKKRTLYRHFTTAVDQRNIETVFNAM
KDTILQRNIDQLVMK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000208testis
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR001019Gprotein_alpha_su
IPR011025GproteinA_insert
IPR027417P-loop_NTPase
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
Vocabulary: molecular function
TermDefinition
GO:0019001guanyl nucleotide binding
GO:0031683G-protein beta/gamma-subunit complex binding
GO:0003924GTPase activity
GO:0004871signal transducer activity
GO:0000166nucleotide binding
GO:0005525GTP binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001019Guanine nucleotide binding protein (G-protein), alpha subunitPRINTSPR00318GPROTEINAcoord: 193..215
score: 36.07
coord: 244..272
score: 17.03
coord: 43..58
score: 71.35
coord: 222..239
score: 53.55
coord: 293..302
score: 51.87
IPR001019Guanine nucleotide binding protein (G-protein), alpha subunitSMARTSM00275galpha_1coord: 21..414
e-value: 3.2E-83
score: 292.5
IPR001019Guanine nucleotide binding protein (G-protein), alpha subunitPFAMPF00503G-alphacoord: 22..404
e-value: 5.8E-68
score: 229.6
IPR001019Guanine nucleotide binding protein (G-protein), alpha subunitPANTHERPTHR10218GTP-BINDING PROTEIN ALPHA SUBUNITcoord: 17..344
IPR001019Guanine nucleotide binding protein (G-protein), alpha subunitPANTHERPTHR10218GTP-BINDING PROTEIN ALPHA SUBUNITcoord: 375..414
IPR001019Guanine nucleotide binding protein (G-protein), alpha subunitCDDcd00066G-alphacoord: 42..408
e-value: 1.28442E-84
score: 258.996
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 26..406
e-value: 4.3E-83
score: 281.1
NoneNo IPR availablePANTHERPTHR10218:SF205GUANINE NUCLEOTIDE-BINDING PROTEIN SUBUNIT ALPHA HOMOLOGcoord: 375..414
NoneNo IPR availablePANTHERPTHR10218:SF205GUANINE NUCLEOTIDE-BINDING PROTEIN SUBUNIT ALPHA HOMOLOGcoord: 17..344
NoneNo IPR availablePROSITEPS51882G_ALPHAcoord: 40..415
score: 59.904
IPR011025G protein alpha subunit, helical insertionGENE3DG3DSA:1.10.400.10coord: 70..206
e-value: 4.3E-83
score: 281.1
IPR011025G protein alpha subunit, helical insertionSUPERFAMILYSSF47895Transducin (alpha subunit), insertion domaincoord: 69..204
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 42..409