SMED30003035

Overview
NameSMED30003035
Smed IDSMED30003035
Length (bp)1691
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30003035 (SMED30003035) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30003035 (SMED30003035) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30003035 (SMED30003035) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30003035 (SMED30003035) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003035

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30003035SMESG000070535.1 dd_Smed_v4_13174_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
tailSMED30003035SMESG000070535.1 dd_Smed_v6_13174_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30003035SMESG000070535.1 dd_Smed_v4_13174_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30003035SMESG000070535.1 dd_Smed_v4_13174_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30003035 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.003648:7149..15344 -8027
v31.012908:17157..25172 -7195
Homology
BLAST of SMED30003035 vs. Ensembl Zebrafish
Match: traf1 (TNF receptor-associated factor 1 [Source:ZFIN;Acc:ZDB-GENE-071120-4])

HSP 1 Score: 50.447 bits (119), Expect = 4.531e-6
Identity = 33/112 (29.46%), Postives = 53/112 (47.32%), Query Frame = -2
Query: 1277 ICNKCNNLIVDAVQTPCGCRYCRYCIEEMVTNGQQVCSGNSKECKSGFLSNISL--------DYRANNKISNLELKCPENECQFRGKLISMDDHLKMCDKKKLKCIFYEMGC 1588
            +C+ CNN++  A QT CG RYC  C+  +V N + +     K   S   S+ S+        D   N +I +L++ C    C +R  L + +DH   C+   + C    +GC
Sbjct:   41 LCSNCNNVLNKARQTVCGHRYCLACVNWLVRNNKDLVCTKCKGEDSNVESDTSVLTPNQFFNDVAINKEILDLKVHCANQGCPWRSTLKNFEDHQSQCEYALIPC---NIGC 149          
BLAST of SMED30003035 vs. TrEMBL
Match: I1ZID8 (TNF receptor associated factor-2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 2.484e-30
Identity = 68/195 (34.87%), Postives = 107/195 (54.87%), Query Frame = -2
Query: 1094 IFHLLSENKFQINENVPGNLICNKCNNLIVDAVQTPCGCRYCRYCIEEMVTNGQQVCSGNSKECKSGFL---SNISLDYRANNKISNLELKCPENECQFRGKLISMDDHLKMCDKKKLKCIFYEMGCKETSLTQGTIDEHFILNNYHHNKILTEIIENLKNEIY-------EMRKSEETNRNQMKSLSENTRLTN 1648
            I  LL    F++   VP NL C+ C NL+V+A Q+ CGCR+C  CI E V+ G   C G + ECK   L   SNI  DYR N KI+ + +KCPE  C+   +L+ +++HL++C  K   C F+ +GC +  +    +  H     + H+K++ +II N++N+ +       E+R+     +N  +S +E   L N
Sbjct:    6 INRLLITYNFEVEGGVPDNLKCDLCKNLLVNACQSRCGCRFCSKCIMEYVSRGNLYCPGGTSECKEENLTICSNIHTDYRVNRKIAKMRVKCPEETCKVYCELVDIEEHLRLCTMKSQNCPFFVLGCNQPKMVIQDLTNHLQNGTFQHSKLIIDIISNMRNDFFGLTTKEVELREDINLIKNHFQSQNEIMMLIN 200          
BLAST of SMED30003035 vs. TrEMBL
Match: I1ZID7 (TNF receptor associated factor-3 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 1.343e-21
Identity = 60/180 (33.33%), Postives = 103/180 (57.22%), Query Frame = -3
Query:   16 SESKTKEIKYYKIMLQQFRQKMDQET-NFESRINQLERCLDNKRNGTFEWTIDNLSERKKQSGMIKSEYFYLKMKPYKMRLGMRLNKIEENSDFGLRILLFIYEDIESEWLEWPFSGNVTIKVTNKNKRNIIKTVTKYCEIPKPKSNEVSSSDRFNFLHSELVKAGLLESNSMTVQCFVE 552
            +E  T E+   +   Q+F+++++ +  N ES + Q      ++ +G F W ++ +S ++K++  + SEYFY K+  +K+ L    N   + ++ G  + LFI+  I+   L WPF  NVTIK+ N++  +  K VTK   I +P  N  + SD F F + EL  AGLL ++S T++CFV+
Sbjct:   40 AEIVTAEVSKLRRDFQEFQERIELKVQNIESYLKQK----IDETSGIFSWNVNGISAKRKENQSMFSEYFYTKVSKHKVSLQFTANVSNDINEIGFNVFLFIFSGIQESKLNWPFQANVTIKIVNRSVPDSSKIVTKCFRIEEPPCN-YNWSDPFYFCYDELSGAGLLLNDSFTIECFVD 214          
BLAST of SMED30003035 vs. TrEMBL
Match: T1E101 (TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.033e-16
Identity = 55/192 (28.65%), Postives = 98/192 (51.04%), Query Frame = -2
Query: 1100 GKFSNIFHLLSE-NKFQINENVPGNLICNKCNNLIVDAVQTPCGCRYCRYCIEEMVTNGQQVCSGNSKECKSGFL---SNISLDYRANNKISNLELKCPENECQFRGKLISMDDHLKMCDKKKLKCIFYEMGCKETSLTQGTIDEHFILNNYHHNKILTEIIENLKNEIYEMRKSEETNRNQMKSLSENTRL 1663
             K  N+  LLS+ N  +++E+V  +L+C  CN L+ DA ++ CGC YC  CI   ++     C G+  ECK  +L    ++  + R + +IS + +KCP   C +  +L+ + +HL  C  + ++C    +GC+E  L +  + +H       H +++      LK+EI     + ET +  +  L E  R+
Sbjct:    4 SKLDNVQELLSKYNVKRVDESVNNDLLCILCNKLMRDACESACGCHYCYTCIRIYLSQNHNYCPGDKTECKEDYLNLEGDVFRNIRLSTRISRIVVKCPNIRCNYTSELLRLKEHLDKCTPESVECPCVTIGCEEEPLLKDEMAKHLTDQVLRHTQLIMSFCNELKSEI---NHNNETTKEDISHLKEVLRV 192          
BLAST of SMED30003035 vs. TrEMBL
Match: T1DBK6 (TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.267e-10
Identity = 42/114 (36.84%), Postives = 64/114 (56.14%), Query Frame = -2
Query: 1298 LLSENKFQINENVPGNLICNKCNNLIVDAVQTPCGCRYCRYCIEEMVTNGQQVCSGNSKECKSGFLSNISLDYRANNKISNLELKCPENECQFRGKLISMDDHLKMCDKKKLKC 1639
            L  +NK++   N   NL C  C ++++DA+QT CGCRYC+ CI+  + NG++ C    ++C+S   S I  D   N +IS L++KC    C F   L S+  HL  C+ +   C
Sbjct:   15 LYKDNKWRFTIN--DNLKCVMCQDILLDAIQTDCGCRYCKECIDNYLENGEKECVAEYEDCRSVITSYI-YDRATNKEISLLKVKCLYEGCVFEDTLKSIKGHLDFCEYRNEMC 125          
BLAST of SMED30003035 vs. TrEMBL
Match: A7RJK8 (Predicted protein OS=Nematostella vectensis OX=45351 GN=v1g238777 PE=4 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 4.508e-8
Identity = 40/108 (37.04%), Postives = 64/108 (59.26%), Query Frame = -2
Query: 1292 VPGN--LICNKCNNLIVDAVQTPCGCRYCRYCIEEMVTNGQQV--CSGNSKECKSGFLSNISLDYRANNKISNLELKCPENECQFRGKLISMDDHLKMCDKKKLKCIF 1603
            +P N  LIC  C+ ++ + V T CG  YC+YCIE+   NG++V  C  ++++ K    S I  D + +  + +LE+KC  N C+++G+L     HLK+C  K +KCI 
Sbjct:   22 IPPNDELICAICHMVVNEPVLTSCGHSYCKYCIEKWC-NGKEVVTCPVDNEQLKP---SQIFPDKKTDRIVLSLEVKCTNNPCRWKGELRQKQKHLKICSHKAVKCIL 125          
BLAST of SMED30003035 vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 52.7582 bits (125), Expect = 6.327e-7
Identity = 33/110 (30.00%), Postives = 52/110 (47.27%), Query Frame = -2
Query: 1298 PGNLICNKCNNLIVDAVQTPCGCRYCRYCIEEMVTNGQQVCSGNSKECKSGFLSNISL---------DYRANNKISNLELKCPENECQFRGKLISMDDHLKMCDKKKLKC 1600
            P + +C+ CNN++ +A QT CG RYCR C+  ++ N + +     KE   G  S+ S+         D   N +I  L + C    C +R  L   +DH   C+   + C
Sbjct:   24 PVHFLCSSCNNVLNEAHQTQCGHRYCRACVMWLLRNNKDLICTKCKE-DPGSESDSSMMLTLDHFFSDNAINKEIQELRVHCVNQGCGWRSTLKDFEDHQSQCEYALIPC 132          
BLAST of SMED30003035 vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 52.7582 bits (125), Expect = 7.461e-7
Identity = 33/110 (30.00%), Postives = 52/110 (47.27%), Query Frame = -2
Query: 1298 PGNLICNKCNNLIVDAVQTPCGCRYCRYCIEEMVTNGQQVCSGNSKECKSGFLSNISL---------DYRANNKISNLELKCPENECQFRGKLISMDDHLKMCDKKKLKC 1600
            P + +C+ CNN++ +A QT CG RYCR C+  ++ N + +     KE   G  S+ S+         D   N +I  L + C    C +R  L   +DH   C+   + C
Sbjct:   24 PVHFLCSSCNNVLNEAHQTQCGHRYCRACVMWLLRNNKDLICTKCKE-DPGSESDSSMMLTLDHFFSDNAINKEIQELRVHCVNQGCGWRSTLKDFEDHQSQCEYALIPC 132          
BLAST of SMED30003035 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008091.1 (pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 gene:ENSPMAG00000007312.1 transcript:ENSPMAT00000008091.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.225 bits (134), Expect = 1.051e-8
Identity = 31/99 (31.31%), Postives = 49/99 (49.49%), Query Frame = -2
Query: 1316 GNLICNKCNNLIVDAVQTPCGCRYCRYCIEEMVTNGQQVCSGNSKECKSGFL----SNISLDYRANNKISNLELKCPENECQFRGKLISMD-DHLKMCD 1597
                C  C  L+ DAVQT CG R+C+ CI  ++T+  + C  N     S FL    +    D     ++  L ++C    C++RG+L+  D  H++ CD
Sbjct:    1 ARFACGSCQGLLRDAVQTHCGHRFCKPCIARLITSVHRSC--NDTLMNSNFLVYSPTQFFPDAALRREMGVLPVRCVSEGCEWRGRLLEYDVAHVERCD 97          
BLAST of SMED30003035 vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 50.8322 bits (120), Expect = 6.656e-7
Identity = 31/103 (30.10%), Postives = 50/103 (48.54%), Query Frame = -2
Query: 1283 CNKCNNLIVDAVQTPCGCRYCRYCI--EEMVTNGQQVCSGNSKECKSGFLSNISLDYRANNKISNLELKCPENECQFRGKLISMDDHLKMCDKKKLKCIFYEM 1585
            C  C   + + VQTPCG R+CR CI     + +    C  ++     G L     D  A  +I +L ++CP   C  RG+L ++ +H   C+  ++ C+  EM
Sbjct:   65 CPICLMALREPVQTPCGHRFCRACILHSMRLRDAGPKCPVDNAVLHEGQLFP---DNFAKREILSLTVRCPNKPCGHRGELRALQEHQLRCEYAQVPCVRCEM 164          
BLAST of SMED30003035 vs. Ensembl Nematostella
Match: EDO48394 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJK8])

HSP 1 Score: 67.3958 bits (163), Expect = 6.235e-12
Identity = 40/108 (37.04%), Postives = 64/108 (59.26%), Query Frame = -2
Query: 1292 VPGN--LICNKCNNLIVDAVQTPCGCRYCRYCIEEMVTNGQQV--CSGNSKECKSGFLSNISLDYRANNKISNLELKCPENECQFRGKLISMDDHLKMCDKKKLKCIF 1603
            +P N  LIC  C+ ++ + V T CG  YC+YCIE+   NG++V  C  ++++ K    S I  D + +  + +LE+KC  N C+++G+L     HLK+C  K +KCI 
Sbjct:   22 IPPNDELICAICHMVVNEPVLTSCGHSYCKYCIEKWC-NGKEVVTCPVDNEQLKP---SQIFPDKKTDRIVLSLEVKCTNNPCRWKGELRQKQKHLKICSHKAVKCIL 125          
BLAST of SMED30003035 vs. Ensembl Nematostella
Match: EDO48773 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI91])

HSP 1 Score: 58.9214 bits (141), Expect = 2.998e-9
Identity = 47/155 (30.32%), Postives = 74/155 (47.74%), Query Frame = -3
Query:  175 SKNM-KNVDKSESKTKEIKYYKIMLQQFRQKMDQETNFESRINQLERCL-----------DNKRNGTFEWTIDNLSERKKQS-----GMIKSEYFYLKMKPYKMRLGMRLNKIEENSDFGLRILLFIYEDIESEW---LEWPFSGNVTIKVTNKN 579
            S NM + VD   S+  E + +   L+  R+  D +T+ + RI +L   L               NGTF W +DN  + ++ S       I S  FY  M  YKM L M LN +  +   G  + LFI+  ++ +W   LEWPF G +T+ + +++
Sbjct:  269 SANMQREVDMLGSRGDEYRQFLAYLE--RKVEDVKTSSDRRIAELTHKLMRLETREIELEGRVCNGTFIWKLDNFRQCREGSIAGLTAAIHSPPFYTSMYGYKMCLRMNLNGV--DGGLGEHVSLFIHM-MQGDWDGILEWPFIGRITLSILDQS 418          
BLAST of SMED30003035 vs. Ensembl Nematostella
Match: EDO43806 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXN6])

HSP 1 Score: 49.2914 bits (116), Expect = 2.878e-7
Identity = 37/133 (27.82%), Postives = 59/133 (44.36%), Query Frame = -2
Query: 1238 QINENVPGNLICNKCNNLIVDAVQTPCGCRYCRYCIEEMV---TNGQQVCSGNSKECKSGFLSNISLDYRA-NNKISNLELKCP--ENECQFRGKLISMDDHLKMCDKKKLKCIFYEMGCKETSLTQGTIDEH 1618
            Q  E V  NL+C  C  ++  AV TPCG  +C  C+E  +       + C  +   C++      ++   A    +  L + CP  +N C+   KL  ++ HLK C    ++C     GC    L +G + EH
Sbjct:    7 QFIEKVDPNLLCGICAEVLERAVLTPCGHSFCGVCLETWMNAKLGENEKCPASCPSCRADLYQGDTIPVLALRGIVDGLIVHCPNADNGCKLVLKLEGVEGHLKSCSHAPVQCC----GCS-AFLKRGELAEH 134          
BLAST of SMED30003035 vs. Ensembl Nematostella
Match: EDO38901 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBN3])

HSP 1 Score: 50.447 bits (119), Expect = 3.829e-7
Identity = 32/104 (30.77%), Postives = 51/104 (49.04%), Query Frame = -2
Query: 1325 KFQINENVPGNLICNKCNNLIVDAVQTPCGCRYCRYCIEEMVTNGQQVCSG--NSKECKSGFLSNISLDYRANNKISNLELKCPENE--CQFRGKLISMDDHLK 1624
            K+   + +  +  C+KC  ++ DAVQT CG RYC  CI  +V+ G   CS   NS   KS +      D  A+ ++ +L + C      C + G+L     H++
Sbjct:   28 KYTDKDTIEASHRCSKCGFILKDAVQTDCGHRYCLSCISPLVSQGSTRCSAVCNSTVVKSKWFR----DKIADREVLDLPVHCVNQHLGCPWEGELRHRQAHIE 127          
BLAST of SMED30003035 vs. Ensembl Nematostella
Match: EDO38873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBN4])

HSP 1 Score: 50.447 bits (119), Expect = 1.518e-6
Identity = 36/121 (29.75%), Postives = 55/121 (45.45%), Query Frame = -2
Query: 1235 ICNKCNNLIVDAVQTPCGCRYCRYCIEEMVTNGQQVCSGNSKECKSGFLSNISL-DYRANNKISNLELKC--PENECQFRGKLISMDDHLKMCDKKKLKCIFYEMGCKETSLTQGTIDEHF 1588
            +C KC  ++ DAVQT CG RYC  CI  +++ G   C      C S      +  D  A+ +I  L + C    + C + G+L    +H   C+   + C+  E G K   L+   + EH 
Sbjct:   23 LCAKCRLIVKDAVQTACGHRYCSPCISPLLSRGPIQCD----VCGSTITKPETFRDKFADREILELHVHCVNQPHGCPWEGELRHRQNHHTKCEFNPISCVHPECGKK---LSVAKLPEHL 136          
BLAST of SMED30003035 vs. Planmine SMEST
Match: SMESG000070535.1 (SMESG000070535.1)

HSP 1 Score: 664.84 bits (1714), Expect = 0.000e+0
Identity = 343/360 (95.28%), Postives = 347/360 (96.39%), Query Frame = -3
Query:   10 KNESWRLEVQFLKNENSKLENRVSTLEKEFINKISEMEANLSKSLEPVIEENKTIKDEKQEFQCRIHIALENIWKKINEIDSRIDIQCANKETFLMNDEINSIKVDFKSLLEKVNPVENNDNKVTXXXXXXXXXXXXKIVNINSLQMEIEEISKKIEVLQFNFERHTSKCSKNMKNVDKSESKTKEIKYYKIMLQQFRQKMDQETNFESRINQLERCLDNKRNGTFEWTIDNLSERKKQSGMIKSEYFYLKMKPYKMRLGMRLNKIEENSDFGLRILLFIYEDIESEWLEWPFSGNVTIKVTNKNKRNIIKTVTKYCEIPKPKSNEVSSSDRFNFLHSELVKAGLLESNSMTVQCFVELK 1089
            KNESWRLEVQ LKNENSKLENRVSTLEKEFINKISEMEANLSKSLEPVIEENKT+KDE QEF+CRIHIALENIWKKI+EIDSRIDIQCANKETFLMNDEINSIKVDFKSLLEKVNPVENN+NKVTKSEE    K    IVNINSLQMEIEEISKKIEVLQFNFERHTSKCSKNMKNVDKSESKTKEIKYYKIMLQQFRQKMDQETNFESRINQLERCLDNKRNGTFEWTIDNLSERKKQSGMIKSEYFYLKMKPYKMRLGMRLN IEENSDFGLRILLFIYEDIESEWLEWPFSGNVTIKVTNKNKRNI KTVTKYCEIPKPKSNE SSSDRFNFLHSELVKAGLLESNSMTVQCFVELK
Sbjct:  198 KNESWRLEVQLLKNENSKLENRVSTLEKEFINKISEMEANLSKSLEPVIEENKTMKDEVQEFKCRIHIALENIWKKIDEIDSRIDIQCANKETFLMNDEINSIKVDFKSLLEKVNPVENNENKVTKSEEKGLSK----IVNINSLQMEIEEISKKIEVLQFNFERHTSKCSKNMKNVDKSESKTKEIKYYKIMLQQFRQKMDQETNFESRINQLERCLDNKRNGTFEWTIDNLSERKKQSGMIKSEYFYLKMKPYKMRLGMRLNNIEENSDFGLRILLFIYEDIESEWLEWPFSGNVTIKVTNKNKRNISKTVTKYCEIPKPKSNEASSSDRFNFLHSELVKAGLLESNSMTVQCFVELK 553          

HSP 2 Score: 409.838 bits (1052), Expect = 0.000e+0
Identity = 196/198 (98.99%), Postives = 198/198 (100.00%), Query Frame = -2
Query: 1088 MDDYCEGKFSNIFHLLSENKFQINENVPGNLICNKCNNLIVDAVQTPCGCRYCRYCIEEMVTNGQQVCSGNSKECKSGFLSNISLDYRANNKISNLELKCPENECQFRGKLISMDDHLKMCDKKKLKCIFYEMGCKETSLTQGTIDEHFILNNYHHNKILTEIIENLKNEIYEMRKSEETNRNQMKSLSENTRLTNVK 1681
            MDDYCEGKFSNIFHLLSENKFQINENVPGNLICNKCNNLIVDAVQTPCGCRYCRYCIEEMVTNGQQVCSGNSKECKSGFLSNISLDYRANNKISNLELKCPENECQFRGKLISMDDHLKMCDKKKLKCIFYEMGCKETSLTQGTIDEHFILNNYHHNKILTEIIEN+KNEIYEMRKSEET+RNQMKSLSENTRLTNVK
Sbjct:    1 MDDYCEGKFSNIFHLLSENKFQINENVPGNLICNKCNNLIVDAVQTPCGCRYCRYCIEEMVTNGQQVCSGNSKECKSGFLSNISLDYRANNKISNLELKCPENECQFRGKLISMDDHLKMCDKKKLKCIFYEMGCKETSLTQGTIDEHFILNNYHHNKILTEIIENIKNEIYEMRKSEETSRNQMKSLSENTRLTNVK 198          
BLAST of SMED30003035 vs. Planmine SMEST
Match: SMESG000070535.1 (SMESG000070535.1)

HSP 1 Score: 664.455 bits (1713), Expect = 0.000e+0
Identity = 343/360 (95.28%), Postives = 347/360 (96.39%), Query Frame = -3
Query:   10 KNESWRLEVQFLKNENSKLENRVSTLEKEFINKISEMEANLSKSLEPVIEENKTIKDEKQEFQCRIHIALENIWKKINEIDSRIDIQCANKETFLMNDEINSIKVDFKSLLEKVNPVENNDNKVTXXXXXXXXXXXXKIVNINSLQMEIEEISKKIEVLQFNFERHTSKCSKNMKNVDKSESKTKEIKYYKIMLQQFRQKMDQETNFESRINQLERCLDNKRNGTFEWTIDNLSERKKQSGMIKSEYFYLKMKPYKMRLGMRLNKIEENSDFGLRILLFIYEDIESEWLEWPFSGNVTIKVTNKNKRNIIKTVTKYCEIPKPKSNEVSSSDRFNFLHSELVKAGLLESNSMTVQCFVELK 1089
            KNESWRLEVQ LKNENSKLENRVSTLEKEFINKISEMEANLSKSLEPVIEENKT+KDE QEF+CRIHIALENIWKKI+EIDSRIDIQCANKETFLMNDEINSIKVDFKSLLEKVNPVENN+NKVTKSEE    K    IVNINSLQMEIEEISKKIEVLQFNFERHTSKCSKNMKNVDKSESKTKEIKYYKIMLQQFRQKMDQETNFESRINQLERCLDNKRNGTFEWTIDNLSERKKQSGMIKSEYFYLKMKPYKMRLGMRLN IEENSDFGLRILLFIYEDIESEWLEWPFSGNVTIKVTNKNKRNI KTVTKYCEIPKPKSNE SSSDRFNFLHSELVKAGLLESNSMTVQCFVELK
Sbjct:  216 KNESWRLEVQLLKNENSKLENRVSTLEKEFINKISEMEANLSKSLEPVIEENKTMKDEVQEFKCRIHIALENIWKKIDEIDSRIDIQCANKETFLMNDEINSIKVDFKSLLEKVNPVENNENKVTKSEEKGLSK----IVNINSLQMEIEEISKKIEVLQFNFERHTSKCSKNMKNVDKSESKTKEIKYYKIMLQQFRQKMDQETNFESRINQLERCLDNKRNGTFEWTIDNLSERKKQSGMIKSEYFYLKMKPYKMRLGMRLNNIEENSDFGLRILLFIYEDIESEWLEWPFSGNVTIKVTNKNKRNISKTVTKYCEIPKPKSNEASSSDRFNFLHSELVKAGLLESNSMTVQCFVELK 571          

HSP 2 Score: 415.616 bits (1067), Expect = 0.000e+0
Identity = 199/201 (99.00%), Postives = 201/201 (100.00%), Query Frame = -2
Query: 1088 YEHMDDYCEGKFSNIFHLLSENKFQINENVPGNLICNKCNNLIVDAVQTPCGCRYCRYCIEEMVTNGQQVCSGNSKECKSGFLSNISLDYRANNKISNLELKCPENECQFRGKLISMDDHLKMCDKKKLKCIFYEMGCKETSLTQGTIDEHFILNNYHHNKILTEIIENLKNEIYEMRKSEETNRNQMKSLSENTRLTNVK 1690
            YEHMDDYCEGKFSNIFHLLSENKFQINENVPGNLICNKCNNLIVDAVQTPCGCRYCRYCIEEMVTNGQQVCSGNSKECKSGFLSNISLDYRANNKISNLELKCPENECQFRGKLISMDDHLKMCDKKKLKCIFYEMGCKETSLTQGTIDEHFILNNYHHNKILTEIIEN+KNEIYEMRKSEET+RNQMKSLSENTRLTNVK
Sbjct:   16 YEHMDDYCEGKFSNIFHLLSENKFQINENVPGNLICNKCNNLIVDAVQTPCGCRYCRYCIEEMVTNGQQVCSGNSKECKSGFLSNISLDYRANNKISNLELKCPENECQFRGKLISMDDHLKMCDKKKLKCIFYEMGCKETSLTQGTIDEHFILNNYHHNKILTEIIENIKNEIYEMRKSEETSRNQMKSLSENTRLTNVK 216          
BLAST of SMED30003035 vs. Planmine SMEST
Match: SMESG000024592.1 (SMESG000024592.1)

HSP 1 Score: 151.754 bits (382), Expect = 3.180e-40
Identity = 69/181 (38.12%), Postives = 112/181 (61.88%), Query Frame = -2
Query: 1118 KFSNIFHLLSENKFQINENVPGNLICNKCNNLIVDAVQTPCGCRYCRYCIEEMVTNGQQVCSGNSKECKSGFLSNISLDYRANNKISNLELKCPENECQFRGKLISMDDHLKMCDKKKLKCIFYEMGCKETSLTQGTIDEHFILNNYHHNKILTEIIENLKNEIYEMRKSEETNRNQMKSL 1660
            K  +IF L+ +N F+  EN+  +L C  C  ++++A Q+PCGC +C+ CIEE + N  ++C G S+ECK  FL+N+ +DY+ANN++  L +KCPE  C ++ KL +MD+HL+ C KK +KC +Y++GC E ++    + +H     Y HN ++  I   +K  I  +   EE +   + SL
Sbjct:    6 KLDSIFELIMKNDFEAIENISEDLKCTLCEKILMNAYQSPCGCSFCQKCIEEFIQNEPKLCPGKSEECKQQFLTNLQIDYKANNRVQKLIVKCPEKTCLYKCKLSNMDNHLRFCSKKSVKCPYYDLGCDEVAIATDKVIDHIQSEIYSHNSMILGINNQMKQSIEMLAHHEEIHEENITSL 186          

HSP 2 Score: 90.5077 bits (223), Expect = 3.278e-19
Identity = 52/154 (33.77%), Postives = 85/154 (55.19%), Query Frame = -3
Query:   10 GTFEWTIDNLSERKKQSGMIKSEYFYLKMKPYKMRLGMRLNKIEENSDFGLRILLFIYEDIESEWLEWPFSGNVTIKVTNKNKRNIIKTVTKYCEIPKPK------------SNEVSSSD-----RFNFLHSELVKAGLLESNSMTVQCFVELK 420
            G+  W+I+ +++ +K+ G ++SEYFYL    YKM+L +  N     +  GL I ++IY   +   ++WPF G VTIKV NK         +KYC I   +             + + S D     +F+FL++EL  +G+L++N +TV+C VE+K
Sbjct:  275 GSILWSIEKINKCRKKGGSVESEYFYLGYNKYKMKLLLYANGTGNVTGSGLSIYIYIYPCTKHSKVDWPFKGLVTIKVLNKLDTFASVKQSKYCIIDNFEEGLDDAEGSLFMDDSIDSCDYQWDNQFDFLYNELSASGVLDNNIITVECNVEIK 428          
BLAST of SMED30003035 vs. Planmine SMEST
Match: SMESG000024592.1 (SMESG000024592.1)

HSP 1 Score: 143.665 bits (361), Expect = 1.697e-37
Identity = 65/171 (38.01%), Postives = 106/171 (61.99%), Query Frame = -2
Query: 1118 ENKFQINENVPGNLICNKCNNLIVDAVQTPCGCRYCRYCIEEMVTNGQQVCSGNSKECKSGFLSNISLDYRANNKISNLELKCPENECQFRGKLISMDDHLKMCDKKKLKCIFYEMGCKETSLTQGTIDEHFILNNYHHNKILTEIIENLKNEIYEMRKSEETNRNQMKSL 1630
            +N F+  EN+  +L C  C  ++++A Q+PCGC +C+ CIEE + N  ++C G S+ECK  FL+N+ +DY+ANN++  L +KCPE  C ++ KL +MD+HL+ C KK +KC +Y++GC E ++    + +H     Y HN ++  I   +K  I  +   EE +   + SL
Sbjct:    2 KNDFEAIENISEDLKCTLCEKILMNAYQSPCGCSFCQKCIEEFIQNEPKLCPGKSEECKQQFLTNLQIDYKANNRVQKLIVKCPEKTCLYKCKLSNMDNHLRFCSKKSVKCPYYDLGCDEVAIATDKVIDHIQSEIYSHNSMILGINNQMKQSIEMLAHHEEIHEENITSL 172          

HSP 2 Score: 89.3521 bits (220), Expect = 7.683e-19
Identity = 49/146 (33.56%), Postives = 84/146 (57.53%), Query Frame = -3
Query:   10 GTFEWTIDNLSERKKQSGMIKSEYFYLKMKPYKMRLGMRLNKIEENSDFGLRILLFIYEDIESEWLEWPFSGNVTIKVTNKNKRNIIKTVTKYCEIPKPKS----NEVSSSD-----RFNFLHSELVKAGLLESNSMTVQCFVELK 420
            G+  W+I+ +++ +K+ G ++SEYFYL    YKM+L +  N     +  GL I ++IY   +   ++WPF G VTIKV NK        +  +  + +  S    + + S D     +F+FL++EL  +G+L++N +TV+C VE+K
Sbjct:  261 GSILWSIEKINKCRKKGGSVESEYFYLGYNKYKMKLLLYANGTGNVTGSGLSIYIYIYPCTKHSKVDWPFKGLVTIKVLNK--------LDTFASVKQKGSLFMDDSIDSCDYQWDNQFDFLYNELSASGVLDNNIITVECNVEIK 398          
BLAST of SMED30003035 vs. Planmine SMEST
Match: SMESG000049767.1 (SMESG000049767.1)

HSP 1 Score: 121.709 bits (304), Expect = 3.358e-37
Identity = 61/184 (33.15%), Postives = 103/184 (55.98%), Query Frame = -2
Query: 1115 FSNIFHLLSENKFQINENVPGNLICNKCNNLIVDAVQTPCGCRYCRYCIEEMVTNGQQVCSGNSKECKS---GFLSNISLDYRANNKISNLELKCPENECQFRGKLISMDDHLKMCDKKKLKCIFYEMGCKETSLTQGTIDEHFILNNYHHNKILTEIIENLKNEIYEMRKSEETNRNQMKSLS 1657
            F+ ++ ++ EN+F+    +   LIC  C  L+  A QTPCGC +C  CIE+ +    + C G+S  C++    F  N++ D   N KIS   +KCP  +C+ + +LI M+DH++ C+K+ + C F  +GC+   +    I+ H    NY H+K+L  +I N +NE+  +R   +  R +M  +S
Sbjct:   28 FTELWKMMRENEFESANEISSELICIICKRLMRKACQTPCGCHFCSDCIEQYLDEDDKFCPGDSNFCQAKMINFTKNVTEDPAVNIKISKRIVKCPRQKCEIQTELIMMEDHMRTCNKRPISCPFISIGCERNEIANDEINFHLNETNYCHSKLLIGVINNFRNEMESLRTENKKLRLRMCKMS 211          

HSP 2 Score: 53.5286 bits (127), Expect = 3.358e-37
Identity = 82/355 (23.10%), Postives = 155/355 (43.66%), Query Frame = -3
Query:   94 RLEVQFLKNENSKLENRVSTLEKEFIN--KISEMEAN----------LSKSLEPVIEENKTIKDEKQEFQCR----------IHIALENIWKKINEIDSRIDIQCANKETFLMNDEINSIKVDFKSLLEKVNPVENNDNKVTXXXXXXXXXXXXKIVNINSLQMEIEEI----SKKIEVLQFNFERHTSKCSKNMKNVDKSESKTKEIKYYKIMLQQFRQKMDQETNFESRINQLERCLDNKRNGTFEWTIDNLSERKKQSGMIKSEYFYLKMKPYKMRLGMRLNKIEENSDFG-LRILLFIYEDIESEWLEWPFSGNVTIKVTNKNKRNIIKT-VTKYCEIPKPKSNEVSSSDR 1074
            R E+  L  EN K   ++ T+E +  N  K+  MEAN          L+  +E V  EN++++DE  E              I +   N+ +K+ E+++R        E  L+N+E+  +K +++S+         + +  T +E             IN ++M+IE I     ++ + L+ N E+   + +KN++ ++K  ++ ++I+                  +E+ +          + G FEW ID +SE+++   +I S+ FY +   YKM L +         D+G + +  ++        L+WPF  +V + V +    NII +   KY + P        +SDR
Sbjct:  229 RDEMTELSKENRKFRQQIDTIELQSENRQKMGRMEANDMKNTKKIEDLNNVIEKVKNENESLRDEMTELSKENRKFRQQIDTIELQSANLQQKMGEMEAREQENGGKIE--LLNEEMVVLKNEYRSM---------SSHMATNAEA------------INQIRMQIERIEINSQQQSDALKQNCEQQQLQANKNLE-MEKCANEIRQIQ--------------STFGYENLL----------KPGFFEWEIDKISEQRRNE-LIYSKPFYFRPFGYKMCLAVIFR-----GDYGDIGVYFYLMRGDFDNNLDWPFKYSVAVDVIDSANGNIIHSESVKYSDCPDDAEWRKPASDR 529          
The following BLAST results are available for this feature:
BLAST of SMED30003035 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003035 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003035 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003035 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
traf14.531e-629.46TNF receptor-associated factor 1 [Source:ZFIN;Acc:... [more]
back to top
BLAST of SMED30003035 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003035 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003035 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003035 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZID82.484e-3034.87TNF receptor associated factor-2 (Fragment) OS=Sch... [more]
I1ZID71.343e-2133.33TNF receptor associated factor-3 (Fragment) OS=Sch... [more]
T1E1011.033e-1628.65TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
T1DBK62.267e-1036.84TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A7RJK84.508e-837.04Predicted protein OS=Nematostella vectensis OX=453... [more]
back to top
BLAST of SMED30003035 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
traf16.327e-730.00TNF receptor-associated factor 1-like [Source:NCBI... [more]
traf17.461e-730.00TNF receptor-associated factor 1-like [Source:NCBI... [more]
back to top
BLAST of SMED30003035 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000008091.11.051e-831.31pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 ... [more]
traf66.656e-730.10TNF receptor-associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of SMED30003035 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003035 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO483946.235e-1237.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487732.998e-930.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438062.878e-727.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO389013.829e-730.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388731.518e-629.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30003035 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003035 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070535.10.000e+095.28SMESG000070535.1[more]
SMESG000070535.10.000e+095.28SMESG000070535.1[more]
SMESG000024592.13.180e-4038.12SMESG000024592.1[more]
SMESG000024592.11.697e-3738.01SMESG000024592.1[more]
SMESG000049767.13.358e-3733.15SMESG000049767.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003035 ID=SMED30003035|Name=SMED30003035|organism=Schmidtea mediterranea sexual|type=transcript|length=1691bp
AGCAAATTATTTTAATTCAACAAAGCATTGGACAGTCATAGAGTTTGACT
CCAATAATCCCGCTTTCACTAGTTCGGAATGCAAGAAATTGAAACGGTCA
CTAGAACTTACTTCATTGGACTTTGGTTTGGGAATTTCACAGTATTTTGT
GACAGTTTTGATAATATTTCTCTTGTTTTTGTTTGTCACCTTAATAGTTA
CGTTGCCAGAAAAGGGCCATTCTAGCCACTCACTTTCAATGTCTTCATAA
ATGAATAACAAAATCCTCAACCCAAAATCGGAATTCTCCTCTATTTTGTT
CAGTCTCATCCCCAGTCTCATTTTATACGGCTTCATTTTCAAATAAAAAT
ATTCACTTTTTATCATACCAGACTGTTTCTTTCTTTCACTTAAATTGTCA
ATGGTCCACTCAAATGTTCCATTTCGTTTGTTGTCCAAGCATCTTTCCAG
CTGATTTATCCTTGACTCAAAATTTGTTTCTTGGTCCATTTTCTGTCTAA
ACTGTTGCAGCATTATTTTATAATATTTTATTTCTTTGGTTTTTGATTCG
CTTTTATCGACATTTTTCATATTCTTTGAGCATTTGCTGGTATGTCTTTC
AAAGTTAAATTGCAGAACCTCAATTTTCTTCGAGATTTCCTCAATTTCCA
TCTGTAAAGAATTTATGTTTACAATTTTTGATAAACCTTTCTCTTTTTTA
CTCTCTTCACTTTTGGTTACTTTGTTATCGTTATTTTCAACAGGATTAAC
TTTCTCCAATAAACTTTTGAAGTCGACTTTTATAGAGTTGATCTCATCAT
TCATCAAAAATGTTTCTTTATTTGCGCACTGTATATCAATTCGCGAATCA
ATTTCGTTTATTTTTTTCCAAATATTTTCCAGTGCAATGTGAATTCTGCA
CTGAAATTCTTGCTTTTCGTCCTTTATCGTTTTATTCTCTTCAATTACAG
GTTCTAAACTTTTCGAAAGGTTTGCCTCCATTTCACTGATTTTGTTGATG
AATTCTTTTTCTAAAGTTGACACTCGGTTTTCCAATTTTGAATTTTCATT
TTTTAAAAATTGGACTTCCAAGCGCCATGATTCATTTTTTTACATTTGTC
AGACGGGTATTTTCCGATAAGGATTTCATTTGATTTCTATTTGTTTCCTC
ACTTTTGCGCATTTCGTAAATCTCATTTTTTAAATTTTCTATTATTTCTG
TTAATATTTTATTATGATGATAATTATTTAAAATAAAATGTTCATCGATT
GTCCCTTGAGTTAATGAGGTTTCTTTGCATCCCATTTCATAGAAGATGCA
TTTCAACTTCTTTTTGTCGCACATTTTCAAATGGTCGTCCATGCTTATTA
ATTTTCCACGAAACTGACACTCATTTTCTGGACACTTCAATTCCAAGTTT
GATATCTTATTGTTTGCCCTGTAGTCAAGTGAAATGTTAGATAGGAAACC
TGATTTGCATTCTTTTGAATTTCCGGAACATACTTGCTGTCCATTGGTAA
CCATTTCTTCTATACAGTACCGGCAATATCTGCACCCGCACGGCGTTTGA
ACGGCATCAACTATCAGATTGTTGCACTTGTTGCAAATGAGATTTCCCGG
CACATTTTCATTGATTTGAAATTTATTTTCTGAAAGCAAATGAAAAATAT
TGGAAAATTTACCTTCACAATAATCATCCATGTGTTCGTAA
back to top

protein sequence of SMED30003035-orf-1

>SMED30003035-orf-1 ID=SMED30003035-orf-1|Name=SMED30003035-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=203bp
YEHMDDYCEGKFSNIFHLLSENKFQINENVPGNLICNKCNNLIVDAVQTP
CGCRYCRYCIEEMVTNGQQVCSGNSKECKSGFLSNISLDYRANNKISNLE
LKCPENECQFRGKLISMDDHLKMCDKKKLKCIFYEMGCKETSLTQGTIDE
HFILNNYHHNKILTEIIENLKNEIYEMRKSEETNRNQMKSLSENTRLTNV
KK*
back to top

protein sequence of SMED30003035-orf-2

>SMED30003035-orf-2 ID=SMED30003035-orf-2|Name=SMED30003035-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=325bp
MEANLSKSLEPVIEENKTIKDEKQEFQCRIHIALENIWKKINEIDSRIDI
QCANKETFLMNDEINSIKVDFKSLLEKVNPVENNDNKVTKSEESKKEKGL
SKIVNINSLQMEIEEISKKIEVLQFNFERHTSKCSKNMKNVDKSESKTKE
IKYYKIMLQQFRQKMDQETNFESRINQLERCLDNKRNGTFEWTIDNLSER
KKQSGMIKSEYFYLKMKPYKMRLGMRLNKIEENSDFGLRILLFIYEDIES
EWLEWPFSGNVTIKVTNKNKRNIIKTVTKYCEIPKPKSNEVSSSDRFNFL
HSELVKAGLLESNSMTVQCFVELK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000421tail
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR013083Znf_RING/FYVE/PHD
IPR001293Znf_TRAF
IPR008974TRAF-like
IPR002083MATH/TRAF_dom
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001293Zinc finger, TRAF-typePFAMPF02176zf-TRAFcoord: 97..142
e-value: 3.7E-6
score: 27.5
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 18..134
e-value: 3.7E-17
score: 64.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 187..202
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 181..202
NoneNo IPR availablePANTHERPTHR10131:SF129TNF RECEPTOR-ASSOCIATED FACTOR 6coord: 26..125
coord: 116..196
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 28..79
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 26..125
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 116..196