Protein kinase N3

Overview
NameProtein kinase N3
Smed IDSMED30003027
Length (bp)1081
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase N3 (SMED30003027) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase N3 (SMED30003027) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase N3 (SMED30003027) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase N3 (SMED30003027) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003027

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30003027SMESG000014962.1 SmedASXL_018551SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase N3 vs. Ensembl Human
Match: PRKCA (protein kinase C alpha [Source:HGNC Symbol;Acc:HGNC:9393])

HSP 1 Score: 134.42 bits (337), Expect = 4.127e-34
Identity = 93/295 (31.53%), Postives = 143/295 (48.47%), Query Frame = 2
Query:  143 SPNNNINFPLLFETWNLISRINEGKF-----VARASNYRKYIITITSKEKSNQN-----IKIMKEILNLMKDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGN-GAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFP-----------NYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKL 961
             P+NN++   L + +N +  + +G F       R      Y I I  K+   Q+       + K +L L+ D+  FL     C  +    + V EY   G L  +I   G  KE  A FY++ I + + FLH   I++R++ L+NV++D  G  K++DF  CK +M    TTRT      Y APE+   +   K +DW+A GV L+ M  G  P           +  ++ + + K LS ++ S+   L+   P  RLG   EG   V+ H FF+ +DWE L  R I+PP KPK+
Sbjct:  326 QPSNNLDRVKLTD-FNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALL-DKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSVCKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKV 618          
BLAST of Protein kinase N3 vs. Ensembl Human
Match: PKN2 (protein kinase N2 [Source:HGNC Symbol;Acc:HGNC:9406])

HSP 1 Score: 130.568 bits (327), Expect = 1.376e-32
Identity = 71/243 (29.22%), Postives = 129/243 (53.09%), Query Frame = 2
Query:  329 QNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGNGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFP-----------NYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQITYMDSLESDFLSDSKMFS 1024
            ++ FL+N   C  ++ H   V EY   G L  +I      E  A FY++C+VL +++LH + I++R++ L+N+++D  GF K++DF  CK  M   D T T      + APE+      T+ +DW+ LGV ++ M +G  P           +   + +R+ + LS ++ S++  L+   P+ RLG + +  E VK H FF+ +DW  L  + ++PP  P +     + + + +F S++ + +
Sbjct:  716 RHPFLVNLFACFQTKEHVCFVMEYAAGGDLMMHIHTDVFSEPRAVFYAACVVLGLQYLHEHKIVYRDLKLDNLLLDTEGFVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTETSYTRAVDWWGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAISIMRRLLRRNPERRLGASEKDAEDVKKHPFFRLIDWSALMDKKVKPPFIPTIRGREDVSNFDDEFTSEAPILT 958          
BLAST of Protein kinase N3 vs. Ensembl Human
Match: PKN2 (protein kinase N2 [Source:HGNC Symbol;Acc:HGNC:9406])

HSP 1 Score: 130.183 bits (326), Expect = 1.892e-32
Identity = 71/243 (29.22%), Postives = 129/243 (53.09%), Query Frame = 2
Query:  329 QNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGNGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFP-----------NYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQITYMDSLESDFLSDSKMFS 1024
            ++ FL+N   C  ++ H   V EY   G L  +I      E  A FY++C+VL +++LH + I++R++ L+N+++D  GF K++DF  CK  M   D T T      + APE+      T+ +DW+ LGV ++ M +G  P           +   + +R+ + LS ++ S++  L+   P+ RLG + +  E VK H FF+ +DW  L  + ++PP  P +     + + + +F S++ + +
Sbjct:  668 RHPFLVNLFACFQTKEHVCFVMEYAAGGDLMMHIHTDVFSEPRAVFYAACVVLGLQYLHEHKIVYRDLKLDNLLLDTEGFVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTETSYTRAVDWWGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAISIMRRLLRRNPERRLGASEKDAEDVKKHPFFRLIDWSALMDKKVKPPFIPTIRGREDVSNFDDEFTSEAPILT 910          
BLAST of Protein kinase N3 vs. Ensembl Human
Match: PKN1 (protein kinase N1 [Source:HGNC Symbol;Acc:HGNC:9405])

HSP 1 Score: 130.183 bits (326), Expect = 2.091e-32
Identity = 86/308 (27.92%), Postives = 146/308 (47.40%), Query Frame = 2
Query:  167 PLLFETWNLISRINEGKFV-ARASNYRKYIITITSKEKSNQNIKIMKEILNLMKDQ----------NAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGNGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFP-----------NYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQITYMDSLESDFLSDSKMFS 1024
            PL  E +  ++ +  G F     S +R        K     +I    E+ +LM ++          + FL+N   C  +  H   V EY   G L  +I +    E  A FYS+C+VL ++FLH + I++R++ L+N+++D  G+ K++DF  CK  M   D T T      + APE+      T+ +DW+ LGV L+ M +G  P           +   + +R+ + LS ++  ++  L+   P+ RLG++    E VK   FF+ + WE L  R + PP  P L   T + + + +F  ++   S
Sbjct:  615 PLTLEDFKFLAVLGRGHFGKVLLSEFRPSGELFAIKALKKGDIVARDEVESLMCEKRILAAVTSAGHPFLVNLFGCFQTPEHVCFVMEYSAGGDLMLHIHSDVFSEPRAIFYSACVVLGLQFLHEHKIVYRDLKLDNLLLDTEGYVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTDTSYTRAVDWWGLGVLLYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSAEAIGIMRRLLRRNPERRLGSSERDAEDVKKQPFFRTLGWEALLARRLPPPFVPTLSGRTDVSNFDEEFTGEAPTLS 922          
BLAST of Protein kinase N3 vs. Ensembl Human
Match: PKN1 (protein kinase N1 [Source:HGNC Symbol;Acc:HGNC:9405])

HSP 1 Score: 129.798 bits (325), Expect = 2.165e-32
Identity = 86/308 (27.92%), Postives = 146/308 (47.40%), Query Frame = 2
Query:  167 PLLFETWNLISRINEGKFV-ARASNYRKYIITITSKEKSNQNIKIMKEILNLMKDQ----------NAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGNGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFP-----------NYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQITYMDSLESDFLSDSKMFS 1024
            PL  E +  ++ +  G F     S +R        K     +I    E+ +LM ++          + FL+N   C  +  H   V EY   G L  +I +    E  A FYS+C+VL ++FLH + I++R++ L+N+++D  G+ K++DF  CK  M   D T T      + APE+      T+ +DW+ LGV L+ M +G  P           +   + +R+ + LS ++  ++  L+   P+ RLG++    E VK   FF+ + WE L  R + PP  P L   T + + + +F  ++   S
Sbjct:  609 PLTLEDFKFLAVLGRGHFGKVLLSEFRPSGELFAIKALKKGDIVARDEVESLMCEKRILAAVTSAGHPFLVNLFGCFQTPEHVCFVMEYSAGGDLMLHIHSDVFSEPRAIFYSACVVLGLQFLHEHKIVYRDLKLDNLLLDTEGYVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTDTSYTRAVDWWGLGVLLYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSAEAIGIMRRLLRRNPERRLGSSERDAEDVKKQPFFRTLGWEALLARRLPPPFVPTLSGRTDVSNFDEEFTGEAPTLS 916          
BLAST of Protein kinase N3 vs. Ensembl Celegans
Match: pkn-1 (Protein Kinase N (PKN) homolog [Source:UniProtKB/TrEMBL;Acc:G5EGE3])

HSP 1 Score: 139.813 bits (351), Expect = 3.611e-36
Identity = 91/313 (29.07%), Postives = 151/313 (48.24%), Query Frame = 2
Query:  167 PLLFETWNLISRINEGKFVA-------RASNYRKYIITITSK-----EKSNQNIKIMKEILNLM-KDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGNGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFP-----------NYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWE--NLRKRNIEPPIKPKLDQITYMDSLESDFLSDSKMFSV 1027
            PL  E + LIS +  G F           SNY  Y + +  K         +++ + K I  +  + ++ FL+N   C  +  H F   EY   G L ++I +    E    FY++C+VL ++FLH +NI++R+I L+N+++D  G+ K++DF  CK NM   D T T      + APE+      T+ IDW+ LGV +  M +G  P           +     +R+ + LS +S +++  L+   P+ RLG      E +K  RFF+ + WE   L  R I PP +P++     + + + +F  +   FS 
Sbjct:  678 PLTVEQFRLISVLGRGHFGKVILSQHNPTSNY--YALKVLKKGDILGRDEVESLMVEKRIFEVSSRARHPFLVNLNGCFQTNEHVFFCMEYSMGGDLMRHIHDDVFDEVRGCFYAACVVLGLDFLHKHNIIYRDIKLDNLLLDREGYVKIADFGLCKENMGPFDKTSTFCGTPEFLAPEVLSDSSYTRAIDWWGLGVLIFEMLVGEPPFSGDDEEEIFDSIISEDVRYPRYLSVESIAIMRRLLRKVPEKRLGYGERDAEDIKIQRFFRHISWEWDKLLNREIRPPFQPQIRNPEDVSNFDLEFTQEKARFSA 988          
BLAST of Protein kinase N3 vs. Ensembl Celegans
Match: pkn-1 (Protein Kinase N (PKN) homolog [Source:UniProtKB/TrEMBL;Acc:G5EGE3])

HSP 1 Score: 139.813 bits (351), Expect = 3.984e-36
Identity = 92/314 (29.30%), Postives = 153/314 (48.73%), Query Frame = 2
Query:  167 PLLFETWNLISRINEGKFVA-------RASNYRKYIITITSK-----EKSNQNIKIMKEILNLM-KDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGNGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFPNYSKN------------TLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWE--NLRKRNIEPPIKPKLDQITYMDSLESDFLSDSKMFSV 1027
            PL  E + LIS +  G F           SNY  Y + +  K         +++ + K I  +  + ++ FL+N   C  +  H F   EY   G L ++I +    E    FY++C+VL ++FLH +NI++R+I L+N+++D  G+ K++DF  CK NM   D T T      + APE+      T+ IDW+ LGV +  M +G  P +S +             +R+ + LS +S +++  L+   P+ RLG      E +K  RFF+ + WE   L  R I PP +P++     + + + +F  +   FS 
Sbjct:  804 PLTVEQFRLISVLGRGHFGKVILSQHNPTSNY--YALKVLKKGDILGRDEVESLMVEKRIFEVSSRARHPFLVNLNGCFQTNEHVFFCMEYSMGGDLMRHIHDDVFDEVRGCFYAACVVLGLDFLHKHNIIYRDIKLDNLLLDREGYVKIADFGLCKENMGPFDKTSTFCGTPEFLAPEVLSDSSYTRAIDWWGLGVLIFEMLVGE-PPFSGDDEEEIFDSIISEDVRYPRYLSVESIAIMRRLLRKVPEKRLGYGERDAEDIKIQRFFRHISWEWDKLLNREIRPPFQPQIRNPEDVSNFDLEFTQEKARFSA 1114          
BLAST of Protein kinase N3 vs. Ensembl Celegans
Match: akt-1 (Serine/threonine-protein kinase akt-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17941])

HSP 1 Score: 130.183 bits (326), Expect = 2.097e-33
Identity = 75/242 (30.99%), Postives = 121/242 (50.00%), Query Frame = 2
Query:  317 LMKDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGN-GAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFPNYSKN-----------TLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQITYMDSLESDFLS 1006
            L + ++ FL    Y    +H+   V ++   G L  ++   G   E  A+FY + IVLA+ +LH  +I++R++ LEN+++D  G  K++DF  CK  +   D T T      Y APE+       + +DW+ +GV ++ M  G  P YSK+            LR   KLS ++ +L++ L+   P  RLG   E    +    FF+ VDWE   ++ IEPP KP +   T     +++F S
Sbjct:  245 LQRCKHPFLTELKYSFQEQHYLCFVMQFANGGELFTHVRKCGTFSEPRARFYGAEIVLALGYLHRCDIVYRDMKLENLLLDKDGHIKIADFGLCKEEISFGDKTSTFCGTPEYLAPEVLDDHDYGRCVDWWGVGVVMYEMMCGRLPFYSKDHNKLFELIMAGDLRFPSKLSQEARTLLTGLLVKDPTQRLGGGPEDALEICRADFFRTVDWEATYRKEIEPPYKPNVQSETDTSYFDNEFTS 486          
BLAST of Protein kinase N3 vs. Ensembl Celegans
Match: akt-1 (Serine/threonine-protein kinase akt-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17941])

HSP 1 Score: 130.183 bits (326), Expect = 2.097e-33
Identity = 75/242 (30.99%), Postives = 121/242 (50.00%), Query Frame = 2
Query:  317 LMKDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGN-GAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFPNYSKN-----------TLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQITYMDSLESDFLS 1006
            L + ++ FL    Y    +H+   V ++   G L  ++   G   E  A+FY + IVLA+ +LH  +I++R++ LEN+++D  G  K++DF  CK  +   D T T      Y APE+       + +DW+ +GV ++ M  G  P YSK+            LR   KLS ++ +L++ L+   P  RLG   E    +    FF+ VDWE   ++ IEPP KP +   T     +++F S
Sbjct:  245 LQRCKHPFLTELKYSFQEQHYLCFVMQFANGGELFTHVRKCGTFSEPRARFYGAEIVLALGYLHRCDIVYRDMKLENLLLDKDGHIKIADFGLCKEEISFGDKTSTFCGTPEYLAPEVLDDHDYGRCVDWWGVGVVMYEMMCGRLPFYSKDHNKLFELIMAGDLRFPSKLSQEARTLLTGLLVKDPTQRLGGGPEDALEICRADFFRTVDWEATYRKEIEPPYKPNVQSETDTSYFDNEFTS 486          
BLAST of Protein kinase N3 vs. Ensembl Celegans
Match: akt-1 (Serine/threonine-protein kinase akt-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17941])

HSP 1 Score: 126.716 bits (317), Expect = 3.931e-32
Identity = 68/200 (34.00%), Postives = 104/200 (52.00%), Query Frame = 2
Query:  440 AIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFPNYSKN-----------TLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQITYMDSLESDFLS 1006
               E  A+FY S IVLA+ +LH N+I++R++ LEN+++D  G  K++DF  CK  +   D T T      Y APE+       + +DW+ +GV ++ M  G  P YSK+            LR   KLS ++ +L++ L+   P  RLG   E    +    FF+ VDWE   ++ IEPP KP +   T     +++F S
Sbjct:  292 GFSEPRARFYGSEIVLALGYLHANSIVYRDLKLENLLLDKDGHIKIADFGLCKEEISFGDKTSTFCGTPEYLAPEVLDDHDYGRCVDWWGVGVVMYEMMCGRLPFYSKDHNKLFELIMAGDLRFPSKLSQEARTLLTGLLVKDPTQRLGGGPEDALEICRADFFRTVDWEATYRKEIEPPYKPNVQSETDTSYFDNEFTS 491          
BLAST of Protein kinase N3 vs. Ensembl Fly
Match: Pkc53E (gene:FBgn0003091 transcript:FBtr0305069)

HSP 1 Score: 130.954 bits (328), Expect = 1.363e-33
Identity = 88/297 (29.63%), Postives = 140/297 (47.14%), Query Frame = 2
Query:  185 WNLISRINEGKF-----VARASNYRKYIITITSKEKSNQN-----IKIMKEILNLMKDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGN-GAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGT-----------FPNYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQITYMDSLESDFLSD 1009
            +N I  + +G F       R  +   Y I I  K+   Q+       I K +L L  ++  FL+    C  +    F V EY   G L   I   G  KE  A FY++ I   + FLH   I++R++ L+NV++D  G  K++DF  CK N+  + TT+T      Y APE+   +   K +DW+A GV L+ M +G            F   + + + + K LS ++       +  +P+ RLG    G E V+ H FF+ +DWE +  R ++PP KPK+     + + +  F S+
Sbjct:  196 FNFIKVLGKGSFGKVLLAERKGSEELYAIKILKKDVIIQDDDVECTMIEKRVLAL-GEKPPFLVQLHSCFQTMDRLFFVMEYVNGGDLMFQIQQFGKFKEPVAVFYAAEIAAGLFFLHTKGILYRDLKLDNVLLDADGHVKIADFGMCKENIVGDKTTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLYEMLVGQPPFDGEDEEELFAAITDHNVSYPKSLSKEAKEACKGFLTKQPNKRLGCGSSGEEDVRLHPFFRRIDWEKIENREVQPPFKPKIKHRKDVSNFDKQFTSE 491          
BLAST of Protein kinase N3 vs. Ensembl Fly
Match: Pkn (gene:FBgn0020621 transcript:FBtr0088605)

HSP 1 Score: 130.568 bits (327), Expect = 2.833e-33
Identity = 73/251 (29.08%), Postives = 132/251 (52.59%), Query Frame = 2
Query:  305 EILNLMKDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGNGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFP-----------NYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQITYMDSLESDFLSDSKMFS 1024
            E+ N M+  + FL+N   C  +E H   V EY   G L  +I      E  A FY++C+VL +++LH N I++R++ L+N+++D  G+ K++DF  CK  M   D T T      + APE+      T+ +DW+ LGV +  M +G  P           +   + +R+ + LS ++ +++  L+   P+ RLG++    E VK   FF+ + W++L  R ++PP  P ++ +  + + + +F S+    +
Sbjct:  316 EVANAMR--HPFLVNLYSCFQTEQHVCFVMEYAAGGDLMMHIHTDVFLEPRAVFYAACVVLGLQYLHENKIIYRDLKLDNLLLDTEGYVKIADFGLCKEGMGFGDRTGTFCGTPEFLAPEVLTETSYTRAVDWWGLGVLIFEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSLEAIAVMRRLLRKNPERRLGSSERDAEDVKKQAFFRSIVWDDLLLRKVKPPFVPTINHLEDVSNFDEEFTSEKAQLT 564          
BLAST of Protein kinase N3 vs. Ensembl Fly
Match: Pkc53E (gene:FBgn0003091 transcript:FBtr0112819)

HSP 1 Score: 130.954 bits (328), Expect = 3.866e-33
Identity = 88/297 (29.63%), Postives = 140/297 (47.14%), Query Frame = 2
Query:  185 WNLISRINEGKF-----VARASNYRKYIITITSKEKSNQN-----IKIMKEILNLMKDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGN-GAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGT-----------FPNYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQITYMDSLESDFLSD 1009
            +N I  + +G F       R  +   Y I I  K+   Q+       I K +L L  ++  FL+    C  +    F V EY   G L   I   G  KE  A FY++ I   + FLH   I++R++ L+NV++D  G  K++DF  CK N+  + TT+T      Y APE+   +   K +DW+A GV L+ M +G            F   + + + + K LS ++       +  +P+ RLG    G E V+ H FF+ +DWE +  R ++PP KPK+     + + +  F S+
Sbjct:  349 FNFIKVLGKGSFGKVLLAERKGSEELYAIKILKKDVIIQDDDVECTMIEKRVLAL-GEKPPFLVQLHSCFQTMDRLFFVMEYVNGGDLMFQIQQFGKFKEPVAVFYAAEIAAGLFFLHTKGILYRDLKLDNVLLDADGHVKIADFGMCKENIVGDKTTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLYEMLVGQPPFDGEDEEELFAAITDHNVSYPKSLSKEAKEACKGFLTKQPNKRLGCGSSGEEDVRLHPFFRRIDWEKIENREVQPPFKPKIKHRKDVSNFDKQFTSE 644          
BLAST of Protein kinase N3 vs. Ensembl Fly
Match: Pkc53E (gene:FBgn0003091 transcript:FBtr0305070)

HSP 1 Score: 130.954 bits (328), Expect = 3.866e-33
Identity = 88/297 (29.63%), Postives = 140/297 (47.14%), Query Frame = 2
Query:  185 WNLISRINEGKF-----VARASNYRKYIITITSKEKSNQN-----IKIMKEILNLMKDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGN-GAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGT-----------FPNYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQITYMDSLESDFLSD 1009
            +N I  + +G F       R  +   Y I I  K+   Q+       I K +L L  ++  FL+    C  +    F V EY   G L   I   G  KE  A FY++ I   + FLH   I++R++ L+NV++D  G  K++DF  CK N+  + TT+T      Y APE+   +   K +DW+A GV L+ M +G            F   + + + + K LS ++       +  +P+ RLG    G E V+ H FF+ +DWE +  R ++PP KPK+     + + +  F S+
Sbjct:  349 FNFIKVLGKGSFGKVLLAERKGSEELYAIKILKKDVIIQDDDVECTMIEKRVLAL-GEKPPFLVQLHSCFQTMDRLFFVMEYVNGGDLMFQIQQFGKFKEPVAVFYAAEIAAGLFFLHTKGILYRDLKLDNVLLDADGHVKIADFGMCKENIVGDKTTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLYEMLVGQPPFDGEDEEELFAAITDHNVSYPKSLSKEAKEACKGFLTKQPNKRLGCGSSGEEDVRLHPFFRRIDWEKIENREVQPPFKPKIKHRKDVSNFDKQFTSE 644          
BLAST of Protein kinase N3 vs. Ensembl Fly
Match: Pkc53E (gene:FBgn0003091 transcript:FBtr0087048)

HSP 1 Score: 130.568 bits (327), Expect = 4.269e-33
Identity = 88/297 (29.63%), Postives = 140/297 (47.14%), Query Frame = 2
Query:  185 WNLISRINEGKF-----VARASNYRKYIITITSKEKSNQN-----IKIMKEILNLMKDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGN-GAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGT-----------FPNYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQITYMDSLESDFLSD 1009
            +N I  + +G F       R  +   Y I I  K+   Q+       I K +L L  ++  FL+    C  +    F V EY   G L   I   G  KE  A FY++ I   + FLH   I++R++ L+NV++D  G  K++DF  CK N+  + TT+T      Y APE+   +   K +DW+A GV L+ M +G            F   + + + + K LS ++       +  +P+ RLG    G E V+ H FF+ +DWE +  R ++PP KPK+     + + +  F S+
Sbjct:  350 FNFIKVLGKGSFGKVLLAERKGSEELYAIKILKKDVIIQDDDVECTMIEKRVLAL-GEKPPFLVQLHSCFQTMDRLFFVMEYVNGGDLMFQIQQFGKFKEPVAVFYAAEIAAGLFFLHTKGILYRDLKLDNVLLDADGHVKIADFGMCKENIVGDKTTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLYEMLVGQPPFDGEDEEELFAAITDHNVSYPKSLSKEAKEACKGFLTKQPNKRLGCGSSGEEDVRLHPFFRRIDWEKIENREVQPPFKPKIKHRKDVSNFDKQFTSE 645          
BLAST of Protein kinase N3 vs. Ensembl Zebrafish
Match: pkn3 (protein kinase N3 [Source:ZFIN;Acc:ZDB-GENE-030131-1902])

HSP 1 Score: 148.673 bits (374), Expect = 6.148e-39
Identity = 74/235 (31.49%), Postives = 127/235 (54.04%), Query Frame = 2
Query:  329 QNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGNGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFP-----------NYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQITYMDSLESDF 1000
            ++ FL+N   C  +  H   V EY   G L  +I N    E+ A+FYS+C++L +EFLH N I++R++ L+N+++D  GF +++DF  CK  M   D T T      + APE+      T+ +DW+ LGV ++ M +G  P           +   + +R+ + +S +S S+I +L++   + RLG   +    VK HRFF+ +DWE L  + ++PP  P +     + + + +F
Sbjct:  673 RHPFLVNLYGCFQTPDHVCFVMEYSPGGDLMTHIHNNIFSERQARFYSACVLLGLEFLHQNRIVYRDLKLDNLLMDSDGFVRIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTDSNYTRAVDWWGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFMSPESVSVIQKLLQKNSEKRLGAGEQDANEVKKHRFFQGIDWEALLAKRVKPPFLPSIKTAADVSNFDEEF 907          
BLAST of Protein kinase N3 vs. Ensembl Zebrafish
Match: pkn3 (protein kinase N3 [Source:ZFIN;Acc:ZDB-GENE-030131-1902])

HSP 1 Score: 148.673 bits (374), Expect = 6.148e-39
Identity = 74/235 (31.49%), Postives = 127/235 (54.04%), Query Frame = 2
Query:  329 QNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGNGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFP-----------NYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQITYMDSLESDF 1000
            ++ FL+N   C  +  H   V EY   G L  +I N    E+ A+FYS+C++L +EFLH N I++R++ L+N+++D  GF +++DF  CK  M   D T T      + APE+      T+ +DW+ LGV ++ M +G  P           +   + +R+ + +S +S S+I +L++   + RLG   +    VK HRFF+ +DWE L  + ++PP  P +     + + + +F
Sbjct:  673 RHPFLVNLYGCFQTPDHVCFVMEYSPGGDLMTHIHNNIFSERQARFYSACVLLGLEFLHQNRIVYRDLKLDNLLMDSDGFVRIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTDSNYTRAVDWWGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFMSPESVSVIQKLLQKNSEKRLGAGEQDANEVKKHRFFQGIDWEALLAKRVKPPFLPSIKTAADVSNFDEEF 907          
BLAST of Protein kinase N3 vs. Ensembl Zebrafish
Match: BX321890.2 (protein kinase N3 [Source:NCBI gene;Acc:323182])

HSP 1 Score: 148.673 bits (374), Expect = 6.207e-39
Identity = 74/235 (31.49%), Postives = 127/235 (54.04%), Query Frame = 2
Query:  329 QNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGNGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFP-----------NYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQITYMDSLESDF 1000
            ++ FL+N   C  +  H   V EY   G L  +I N    E+ A+FYS+C++L +EFLH N I++R++ L+N+++D  GF +++DF  CK  M   D T T      + APE+      T+ +DW+ LGV ++ M +G  P           +   + +R+ + +S +S S+I +L++   + RLG   +    VK HRFF+ +DWE L  + ++PP  P +     + + + +F
Sbjct:  673 RHPFLVNLYGCFQTPDHVCFVMEYSPGGDLMTHIHNNIFSERQARFYSACVLLGLEFLHQNRIVYRDLKLDNLLMDSDGFVRIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTDSNYTRAVDWWGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFMSPESVSVIQKLLQKNSEKRLGAGEQDANEVKKHRFFQGIDWEALLAKRVKPPFLPSIKTAADVSNFDEEF 907          
BLAST of Protein kinase N3 vs. Ensembl Zebrafish
Match: pkn3 (protein kinase N3 [Source:ZFIN;Acc:ZDB-GENE-030131-1902])

HSP 1 Score: 148.288 bits (373), Expect = 6.607e-39
Identity = 74/235 (31.49%), Postives = 127/235 (54.04%), Query Frame = 2
Query:  329 QNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGNGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFP-----------NYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQITYMDSLESDF 1000
            ++ FL+N   C  +  H   V EY   G L  +I N    E+ A+FYS+C++L +EFLH N I++R++ L+N+++D  GF +++DF  CK  M   D T T      + APE+      T+ +DW+ LGV ++ M +G  P           +   + +R+ + +S +S S+I +L++   + RLG   +    VK HRFF+ +DWE L  + ++PP  P +     + + + +F
Sbjct:  654 RHPFLVNLYGCFQTPDHVCFVMEYSPGGDLMTHIHNNIFSERQARFYSACVLLGLEFLHQNRIVYRDLKLDNLLMDSDGFVRIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTDSNYTRAVDWWGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFMSPESVSVIQKLLQKNSEKRLGAGEQDANEVKKHRFFQGIDWEALLAKRVKPPFLPSIKTAADVSNFDEEF 888          
BLAST of Protein kinase N3 vs. Ensembl Zebrafish
Match: pkn3 (protein kinase N3 [Source:ZFIN;Acc:ZDB-GENE-030131-1902])

HSP 1 Score: 136.346 bits (342), Expect = 8.327e-35
Identity = 69/224 (30.80%), Postives = 113/224 (50.45%), Query Frame = 2
Query:  329 QNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGNGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFPNYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQITYMDSLESDF 1000
            ++ FL+N   C  +  H   V EY   G L  +I N    E+ A+FYS+C++L +EFLH N I++R++ L+N+++D  GF +++DF  CK  M   D T T      + APE+      T+ +DW+ LGV ++ M                         L+ EL++   + RLG   +    VK HRFF+ +DWE L  + ++PP  P +     + + + +F
Sbjct:  673 RHPFLVNLYGCFQTPDHVCFVMEYSPGGDLMTHIHNNIFSERQARFYSACVLLGLEFLHQNRIVYRDLKLDNLLMDSDGFVRIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTDSNYTRAVDWWGLGVLIYEM-------------------------LVGELLQKNSEKRLGAGEQDANEVKKHRFFQGIDWEALLAKRVKPPFLPSIKTAADVSNFDEEF 871          
BLAST of Protein kinase N3 vs. Ensembl Xenopus
Match: numbl (numb homolog-like [Source:Xenbase;Acc:XB-GENE-961776])

HSP 1 Score: 153.295 bits (386), Expect = 7.146e-43
Identity = 98/289 (33.91%), Postives = 154/289 (53.29%), Query Frame = 2
Query:  176 FETWNLISRINEGKF----VARASNYRKYIITITSKEK---SNQNIKIM---KEILNLMKDQNAFLLNSIYCGL-SEHHWFHVQEYPERGTLKKYIGN-GAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFPNYSKN------TLRHRK-----KLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQIT 973
             E +NL   + EG F    +A   + ++     T K++   +  +IK +   K IL  +       L S+Y    SE+H F V EY   G L   + + GA +E  A FY++CIVL +E LH NNI+HR++ LEN++VD  G+ K+ DF   K   +  D ++T+   + Y APE+      ++ +DW+ALGV L+ M +  FP  +++      ++R+ K     +LS ++  LI  L+E  P  RLG +  G E VK H FF+ +DWE   +R + PP KP +  +T
Sbjct:   17 LENFNLGKVLGEGTFGKVFLAEYKDTKQLCAIKTLKKERIIAKNDIKSVFKEKRILQKVTSAEHPFLVSLYATFQSENHLFFVMEYLPGGDLCHLLEHQGAFEESKAMFYTACIVLGLEELHRNNIVHRDLKLENLMVDVHGYLKIVDFGLSKDGFRYGDRSKTLCGTNCYMAPEIIDEMAYSRAVDWWALGVVLYVMIMFQFPFDAEDDMELFESIRNDKPALTEELSEEAQCLILRLLEKNPCRRLGYSEAGAEEVKAHEFFEDIDWEEFLERELMPPFKPDVSGLT 305          
BLAST of Protein kinase N3 vs. Ensembl Xenopus
Match: ENSXETT00000040203.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:19598914:19601054:1 gene:ENSXETG00000019008.1 transcript:ENSXETT00000040203.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 152.14 bits (383), Expect = 2.221e-42
Identity = 87/251 (34.66%), Postives = 134/251 (53.39%), Query Frame = 2
Query:  260 ITSKEKSNQNIKIMKEILNLMKDQNAFLLNSIYCGL-SEHHWFHVQEYPERGTLKKYIGN-GAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFPNYSKNTLRHRKKLSNDSNSLISE-----------LIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQIT 973
            I +K    +++K  K IL  +       L S+Y    SE+H F V EY   G L   + + GA +E  A FY++C+VL +E LH NNI+HR++ LEN++VD  G+ K+ DF   K   +  D ++T    + Y APE+      ++ +DW+ALGV L+ M +  FP  +++ +   + + ND  +L  E           L+E  P  RLG++  G E VK H FF+ +DWE   +R   PP KP +  +T
Sbjct:   55 IIAKNDIKRSVKWEKRILQKVTSAEHPFLVSLYATFQSENHLFFVMEYLPGGDLCHLLEHQGAFEESKAMFYTACVVLGLEELHRNNIVHRDLKLENLMVDVHGYLKIVDFGLSKDGFRYGDRSKTRCGTNCYMAPEIIDEMAYSRAVDWWALGVVLYVMLMFQFPFDAEDDMELFESIRNDKPALTEELSEEAQCVILRLLEKNPCHRLGSSETGAEEVKAHEFFEDIDWEEFLEREQMPPFKPDVSGLT 305          
BLAST of Protein kinase N3 vs. Ensembl Xenopus
Match: fhl5 (four and a half LIM domains 5 [Source:Xenbase;Acc:XB-GENE-1002465])

HSP 1 Score: 146.747 bits (369), Expect = 7.713e-41
Identity = 81/228 (35.53%), Postives = 126/228 (55.26%), Query Frame = 2
Query:  311 LNLMKDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGN-GAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMA------LGTFPNYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQIT 973
            L +   ++ FL++      SE+H F V EY   G L   + + GA +E  A FY++CIVL +E LH NNI+HR++ LEN++VD  G+ K+ DF   K   +  D ++T    + Y APE+      ++ +DW+ALGV L+ M       +  F +   +     ++LS ++  LI  L+E  P  RLG++  G E VK H FF+ +DWE   +R + PP KP +  +T
Sbjct:   31 LPVTSAEHPFLVSLYATFQSENHLFFVMEYLPGGDLCHLLEHQGAFEESKAMFYTACIVLGLEELHRNNIVHRDLKLENLMVDVHGYLKIVDFGLSKDGFRYGDRSKTRCGTNCYMAPEIIDEMAYSRAVDWWALGVVLYVMIMFQVNDMELFESIRNDKPALTEELSEEAQCLILRLLEKNPCHRLGSSEAGAEEVKAHEFFEDIDWEEFLERELMPPFKPDVSGLT 258          
BLAST of Protein kinase N3 vs. Ensembl Xenopus
Match: fhl5 (four and a half LIM domains 5 [Source:Xenbase;Acc:XB-GENE-1002465])

HSP 1 Score: 146.747 bits (369), Expect = 1.044e-40
Identity = 84/232 (36.21%), Postives = 126/232 (54.31%), Query Frame = 2
Query:  302 KEILNLMKDQNAFLLNSIYCGL-SEHHWFHVQEYPERGTLKKYIGN-GAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMA------LGTFPNYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQIT 973
            K IL  +       L S+Y    SE+H F V EY   G L   + + GA +E  A FY++CIVL +E LH NNI+HR++ LEN++VD  G+ K+ DF   K   +  D ++T    + Y APE+      ++ +DW+ALGV L+ M       +  F +   +     ++LS ++  LI  L+E  P  RLG++  G E VK H FF+ +DWE   +R + PP KP +  +T
Sbjct:   29 KRILQKVTSAEHPFLVSLYATFQSENHLFFVMEYLPGGDLCHLLEHQGAFEESKAMFYTACIVLGLEELHRNNIVHRDLKLENLMVDVHGYLKIVDFGLSKDGFRYGDRSKTRCGTNCYMAPEIIDEMAYSRAVDWWALGVVLYVMIMFQVNDMELFESIRNDKPALTEELSEEAQCLILRLLEKNPCHRLGSSEAGAEEVKAHEFFEDIDWEEFLERELMPPFKPDVSGLT 260          
BLAST of Protein kinase N3 vs. Ensembl Xenopus
Match: tmprss2.6 (transmembrane serine protease 2 gene 6 [Source:Xenbase;Acc:XB-GENE-5798774])

HSP 1 Score: 144.821 bits (364), Expect = 4.680e-40
Identity = 78/233 (33.48%), Postives = 125/233 (53.65%), Query Frame = 2
Query:  302 KEILNLMKDQNAFLLNSIYCGL-SEHHWFHVQEYPERGTLKKYIGNGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFPNYSKN-----------TLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLD 964
            + IL L K +N   L  ++    +EH+     ++ E G L   +G   I ++   FYS+CIVL ++FLH  NI HR++ LENV++D  G+AKL+DF   K  M     ++T      Y APEM      TK +DW+ALGV ++ M +G  P   ++              +   L+ +S ++I++L+      RLG++  G E VK   FF+ +DWE L K+ ++PP  P+++
Sbjct:   32 QRILLLAKKENCHFLTRLFASFRTEHYTCLAMDFAEGGDLVSQLGRSGISQERTIFYSACIVLGLQFLHERNIAHRDLKLENVLLDRDGYAKLTDFGISKEGMGFTGISQTQCGTLDYMAPEMFTRISHTKSVDWWALGVSIYRMLVGKMPFTGEDDNEVILSIICFEPTYPPDLTVESYNIITQLLMKFTLTRLGHSKNGAEEVKKSEFFQGLDWEALEKKQVQPPFVPEIE 264          
BLAST of Protein kinase N3 vs. Ensembl Mouse
Match: Prkx (protein kinase, X-linked [Source:MGI Symbol;Acc:MGI:1309999])

HSP 1 Score: 137.117 bits (344), Expect = 9.884e-37
Identity = 87/282 (30.85%), Postives = 142/282 (50.35%), Query Frame = 2
Query:  176 FETWNLISRINEGKF----VARASNYRKY----IITITSKEKSNQNIKIMKEILNLMKDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGN-GAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFPNYSKNT-----------LRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKL 961
             + W+ I+ +  G F    + +    R+Y    I++I    +  Q   +  E   L +  + FL+  ++ G      + + E+   G L  Y+ N G     A+ FY++ IV AIE+LH   I++R++  EN+++D  G  KL+DF   K   KL D T T+     Y APE+ +SKG  + +DW+ALG+ +  M  G  P +  N            +   ++L   S  LI +L+      RLGN   G E +K HR+F+ V+WE++ +R ++PPI PKL
Sbjct:   43 LQDWDTIATVGTGTFGRVNLVKEKTGRQYCALKIMSIPDVIRLKQEQHVQNEKAVLKEINHPFLIKLLWTGHDNRFLYMLMEFVPGGELFTYLRNRGRFSSVASVFYATEIVCAIEYLHSKEIVYRDLKPENILLDREGHIKLTDFGFAK---KLVDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFEMLSGFPPFFDDNPFGIYQKILACKIDFPRQLDFTSKDLIKKLLVVDRTRRLGNMKNGAEDIKRHRWFRGVEWESVPQRKLKPPIVPKL 321          
BLAST of Protein kinase N3 vs. Ensembl Mouse
Match: Prkca (protein kinase C, alpha [Source:MGI Symbol;Acc:MGI:97595])

HSP 1 Score: 134.806 bits (338), Expect = 2.226e-34
Identity = 93/295 (31.53%), Postives = 143/295 (48.47%), Query Frame = 2
Query:  143 SPNNNINFPLLFETWNLISRINEGKF-----VARASNYRKYIITITSKEKSNQN-----IKIMKEILNLMKDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGN-GAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFP-----------NYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKL 961
             P+NN++   L + +N +  + +G F       R      Y I I  K+   Q+       + K +L L+ D+  FL     C  +    + V EY   G L  +I   G  KE  A FY++ I + + FLH   I++R++ L+NV++D  G  K++DF  CK +M    TTRT      Y APE+   +   K +DW+A GV L+ M  G  P           +  ++ + + K LS ++ S+   L+   P  RLG   EG   V+ H FF+ +DWE L  R I+PP KPK+
Sbjct:  326 QPSNNLDRVKLTD-FNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALL-DKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKV 618          
BLAST of Protein kinase N3 vs. Ensembl Mouse
Match: Pkn1 (protein kinase N1 [Source:MGI Symbol;Acc:MGI:108022])

HSP 1 Score: 129.413 bits (324), Expect = 2.501e-32
Identity = 86/308 (27.92%), Postives = 145/308 (47.08%), Query Frame = 2
Query:  167 PLLFETWNLISRINEGKFV-ARASNYRKYIITITSKEKSNQNIKIMKEILNLM----------KDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGNGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFP-----------NYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQITYMDSLESDFLSDSKMFS 1024
            PL  E +  ++ +  G F     S +R        K     +I    E+ +LM          +  + FL+N   C  +  H   V EY   G L  +I +    E  A FYS+C+VL ++FLH + I++R++ L+N+++D  G+ K++DF  CK  M   D T T      + APE+      T+ +DW+ LGV L+ M +G  P           +   + +R+ + LS ++  ++  L+   P+ RLG+T    E VK   FF+ + W+ L  R + PP  P L   T + + + +F  ++   S
Sbjct:  613 PLTLEDFKFLAVLGRGHFGKVLLSEFRSSGELFAIKALKKGDIVARDEVESLMCEKRILAAVTRAGHPFLVNLFGCFQTPEHVCFVMEYSAGGDLMLHIHSDVFSEPRAVFYSACVVLGLQFLHEHKIVYRDLKLDNLLLDTEGYVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTDTSYTRAVDWWGLGVLLYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSAEAIGIMRRLLRRNPERRLGSTERDAEDVKKQPFFRSLGWDVLLARRLPPPFVPTLSGRTDVSNFDEEFTGEAPTLS 920          
BLAST of Protein kinase N3 vs. Ensembl Mouse
Match: Pkn1 (protein kinase N1 [Source:MGI Symbol;Acc:MGI:108022])

HSP 1 Score: 129.028 bits (323), Expect = 3.143e-32
Identity = 86/308 (27.92%), Postives = 145/308 (47.08%), Query Frame = 2
Query:  167 PLLFETWNLISRINEGKFV-ARASNYRKYIITITSKEKSNQNIKIMKEILNLM----------KDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGNGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFP-----------NYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQITYMDSLESDFLSDSKMFS 1024
            PL  E +  ++ +  G F     S +R        K     +I    E+ +LM          +  + FL+N   C  +  H   V EY   G L  +I +    E  A FYS+C+VL ++FLH + I++R++ L+N+++D  G+ K++DF  CK  M   D T T      + APE+      T+ +DW+ LGV L+ M +G  P           +   + +R+ + LS ++  ++  L+   P+ RLG+T    E VK   FF+ + W+ L  R + PP  P L   T + + + +F  ++   S
Sbjct:  618 PLTLEDFKFLAVLGRGHFGKVLLSEFRSSGELFAIKALKKGDIVARDEVESLMCEKRILAAVTRAGHPFLVNLFGCFQTPEHVCFVMEYSAGGDLMLHIHSDVFSEPRAVFYSACVVLGLQFLHEHKIVYRDLKLDNLLLDTEGYVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTDTSYTRAVDWWGLGVLLYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSAEAIGIMRRLLRRNPERRLGSTERDAEDVKKQPFFRSLGWDVLLARRLPPPFVPTLSGRTDVSNFDEEFTGEAPTLS 925          
BLAST of Protein kinase N3 vs. Ensembl Mouse
Match: Pkn2 (protein kinase N2 [Source:MGI Symbol;Acc:MGI:109211])

HSP 1 Score: 128.642 bits (322), Expect = 4.527e-32
Identity = 71/243 (29.22%), Postives = 127/243 (52.26%), Query Frame = 2
Query:  329 QNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGNGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFP-----------NYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQITYMDSLESDFLSDSKMFS 1024
            ++ FL+N   C  ++ H   V EY   G L  +I      E  A FY++C+VL +++LH + I++R++ L+N+++D  GF K++DF  CK  M   D T T      + APE+      T+ +DW+ LGV ++ M +G  P           +   + +R+ + LS ++ S++  L+   P+ RLG   +  E VK H FF+  DW  L  + ++PP  P +     + + + +F S++ + +
Sbjct:  699 RHPFLVNLFACFQTKEHVCFVMEYAAGGDLMMHIHTDVFSEPRAVFYAACVVLGLQYLHEHKIVYRDLKLDNLLLDTEGFVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTETSYTRAVDWWGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAISIMRRLLRRNPERRLGAGEKDAEDVKKHPFFRLTDWSALMDKKVKPPFVPTIRGREDVSNFDDEFTSEAPILT 941          
BLAST of Protein kinase N3 vs. UniProt/SwissProt
Match: sp|Q922R0|PRKX_MOUSE (cAMP-dependent protein kinase catalytic subunit PRKX OS=Mus musculus OX=10090 GN=Prkx PE=1 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 6.914e-36
Identity = 87/282 (30.85%), Postives = 142/282 (50.35%), Query Frame = 2
Query:  176 FETWNLISRINEGKF----VARASNYRKY----IITITSKEKSNQNIKIMKEILNLMKDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGN-GAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFPNYSKNT-----------LRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKL 961
             + W+ I+ +  G F    + +    R+Y    I++I    +  Q   +  E   L +  + FL+  ++ G      + + E+   G L  Y+ N G     A+ FY++ IV AIE+LH   I++R++  EN+++D  G  KL+DF   K   KL D T T+     Y APE+ +SKG  + +DW+ALG+ +  M  G  P +  N            +   ++L   S  LI +L+      RLGN   G E +K HR+F+ V+WE++ +R ++PPI PKL
Sbjct:   43 LQDWDTIATVGTGTFGRVNLVKEKTGRQYCALKIMSIPDVIRLKQEQHVQNEKAVLKEINHPFLIKLLWTGHDNRFLYMLMEFVPGGELFTYLRNRGRFSSVASVFYATEIVCAIEYLHSKEIVYRDLKPENILLDREGHIKLTDFGFAK---KLVDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFEMLSGFPPFFDDNPFGIYQKILACKIDFPRQLDFTSKDLIKKLLVVDRTRRLGNMKNGAEDIKRHRWFRGVEWESVPQRKLKPPIVPKL 321          
BLAST of Protein kinase N3 vs. UniProt/SwissProt
Match: sp|P10102|KPCA_RABIT (Protein kinase C alpha type OS=Oryctolagus cuniculus OX=9986 GN=PRKCA PE=2 SV=3)

HSP 1 Score: 135.961 bits (341), Expect = 5.491e-34
Identity = 94/295 (31.86%), Postives = 143/295 (48.47%), Query Frame = 2
Query:  143 SPNNNINFPLLFETWNLISRINEGKF-----VARASNYRKYIITITSKEKSNQN-----IKIMKEILNLMKDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGN-GAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFP-----------NYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKL 961
             P+NN++   L + +N +  + +G F       R      Y I I  K+   Q+       + K +L LM D+  FL     C  +    + V EY   G L  +I   G  KE  A FY++ I + + FLH   I++R++ L+NV++D  G  K++DF  CK +M    TTRT      Y APE+   +   K +DW+A GV L+ M  G  P           +  ++ + + K LS ++ S+   L+   P  RLG   EG   V+ H FF+ +DWE L  R I+PP KPK+
Sbjct:  326 QPSNNLDRVKLTD-FNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALM-DKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKV 618          
BLAST of Protein kinase N3 vs. UniProt/SwissProt
Match: sp|P05696|KPCA_RAT (Protein kinase C alpha type OS=Rattus norvegicus OX=10116 GN=Prkca PE=1 SV=3)

HSP 1 Score: 134.806 bits (338), Expect = 1.557e-33
Identity = 93/295 (31.53%), Postives = 143/295 (48.47%), Query Frame = 2
Query:  143 SPNNNINFPLLFETWNLISRINEGKF-----VARASNYRKYIITITSKEKSNQN-----IKIMKEILNLMKDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGN-GAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFP-----------NYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKL 961
             P+NN++   L + +N +  + +G F       R      Y I I  K+   Q+       + K +L L+ D+  FL     C  +    + V EY   G L  +I   G  KE  A FY++ I + + FLH   I++R++ L+NV++D  G  K++DF  CK +M    TTRT      Y APE+   +   K +DW+A GV L+ M  G  P           +  ++ + + K LS ++ S+   L+   P  RLG   EG   V+ H FF+ +DWE L  R I+PP KPK+
Sbjct:  326 QPSNNLDRVKLTD-FNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALL-DKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKV 618          
BLAST of Protein kinase N3 vs. UniProt/SwissProt
Match: sp|P04409|KPCA_BOVIN (Protein kinase C alpha type OS=Bos taurus OX=9913 GN=PRKCA PE=1 SV=3)

HSP 1 Score: 134.806 bits (338), Expect = 1.572e-33
Identity = 93/295 (31.53%), Postives = 143/295 (48.47%), Query Frame = 2
Query:  143 SPNNNINFPLLFETWNLISRINEGKF-----VARASNYRKYIITITSKEKSNQN-----IKIMKEILNLMKDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGN-GAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFP-----------NYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKL 961
             P+NN++   L + +N +  + +G F       R      Y I I  K+   Q+       + K +L L+ D+  FL     C  +    + V EY   G L  +I   G  KE  A FY++ I + + FLH   I++R++ L+NV++D  G  K++DF  CK +M    TTRT      Y APE+   +   K +DW+A GV L+ M  G  P           +  ++ + + K LS ++ S+   L+   P  RLG   EG   V+ H FF+ +DWE L  R I+PP KPK+
Sbjct:  326 QPSNNLDRVKLTD-FNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALL-DKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPGKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKV 618          
BLAST of Protein kinase N3 vs. UniProt/SwissProt
Match: sp|P17252|KPCA_HUMAN (Protein kinase C alpha type OS=Homo sapiens OX=9606 GN=PRKCA PE=1 SV=4)

HSP 1 Score: 134.42 bits (337), Expect = 1.982e-33
Identity = 93/295 (31.53%), Postives = 143/295 (48.47%), Query Frame = 2
Query:  143 SPNNNINFPLLFETWNLISRINEGKF-----VARASNYRKYIITITSKEKSNQN-----IKIMKEILNLMKDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGN-GAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFP-----------NYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKL 961
             P+NN++   L + +N +  + +G F       R      Y I I  K+   Q+       + K +L L+ D+  FL     C  +    + V EY   G L  +I   G  KE  A FY++ I + + FLH   I++R++ L+NV++D  G  K++DF  CK +M    TTRT      Y APE+   +   K +DW+A GV L+ M  G  P           +  ++ + + K LS ++ S+   L+   P  RLG   EG   V+ H FF+ +DWE L  R I+PP KPK+
Sbjct:  326 QPSNNLDRVKLTD-FNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALL-DKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSVCKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKV 618          
BLAST of Protein kinase N3 vs. TrEMBL
Match: F7C977 (Uncharacterized protein OS=Xenopus tropicalis OX=8364 PE=3 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 2.452e-41
Identity = 93/285 (32.63%), Postives = 146/285 (51.23%), Query Frame = 2
Query:  167 PLLFETWNLISRINEGKF--VARASNYRK-YIITITSKEKSNQN-------IKIMKEILNLMKDQNAFLLNSIYCGLSEHHWFHV-QEYPERGTLKKYIGNGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFPNYSKNTLR-----------HRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKP 955
            P   E + L S + EG F  V +A +     II + +      N       + + + IL L+ ++    L  + C     H+  +  EY E GTL  Y+  G +  +  +FYS+CIVL ++FLH +NI HR++  ENV++ G G+ KL+DF  C+  M  N TT        Y A EM + +  T+ +DW+ALGV ++ M  G  P    NT++           +   ++ D++S+I+EL+E  P  RLG+  +  E VKN  FF+ +DWE L  + I+ P  P
Sbjct:   35 PPRIEDFQLQSFLGEGSFGKVYKAQHRETGEIIALKTLALCEMNDTSVFKCVALEQRILRLVSERQWPFLTGLVCSFQTEHYMCLGMEYAEGGTLDSYLSEGGLPLERVRFYSACIVLGLQFLHEHNIAHRDLKPENVLLYGDGYVKLADFGLCREGMAFNSTTSAGGGTLFYMALEMFRGQ-YTRAVDWWALGVTMYNMLTGAAPFRGLNTMQFFGTVTTEEPDYPVDITEDTHSIIAELLEKNPRYRLGSGEDDAEEVKNSPFFEGLDWEALENKQIQAPFIP 318          
BLAST of Protein kinase N3 vs. TrEMBL
Match: A0A5G3KBW9 (Numb homolog-like OS=Xenopus tropicalis OX=8364 GN=numbl PE=3 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.122e-39
Identity = 98/289 (33.91%), Postives = 154/289 (53.29%), Query Frame = 2
Query:  176 FETWNLISRINEGKF----VARASNYRKYIITITSKEK---SNQNIKIM---KEILNLMKDQNAFLLNSIYCGL-SEHHWFHVQEYPERGTLKKYIGN-GAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFPNYSKN------TLRHRK-----KLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQIT 973
             E +NL   + EG F    +A   + ++     T K++   +  +IK +   K IL  +       L S+Y    SE+H F V EY   G L   + + GA +E  A FY++CIVL +E LH NNI+HR++ LEN++VD  G+ K+ DF   K   +  D ++T+   + Y APE+      ++ +DW+ALGV L+ M +  FP  +++      ++R+ K     +LS ++  LI  L+E  P  RLG +  G E VK H FF+ +DWE   +R + PP KP +  +T
Sbjct:   17 LENFNLGKVLGEGTFGKVFLAEYKDTKQLCAIKTLKKERIIAKNDIKSVFKEKRILQKVTSAEHPFLVSLYATFQSENHLFFVMEYLPGGDLCHLLEHQGAFEESKAMFYTACIVLGLEELHRNNIVHRDLKLENLMVDVHGYLKIVDFGLSKDGFRYGDRSKTLCGTNCYMAPEIIDEMAYSRAVDWWALGVVLYVMIMFQFPFDAEDDMELFESIRNDKPALTEELSEEAQCLILRLLEKNPCRRLGYSEAGAEEVKAHEFFEDIDWEEFLERELMPPFKPDVSGLT 305          
BLAST of Protein kinase N3 vs. TrEMBL
Match: A0A163AW84 (Non-specific serine/threonine protein kinase OS=Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) OX=763407 GN=YPK1 PE=4 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 1.568e-39
Identity = 97/310 (31.29%), Postives = 158/310 (50.97%), Query Frame = 2
Query:  161 NFPLLFETWNLISRINEGKF-----VARASNYRKYIITITSKEK---SNQNIKIMKEILNLMKDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIG-NGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFPNYSKNT-----------LRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQITYMDSLESDFLSDSKMFSVI 1030
            N P+ F+ ++L+  I  G F     V +    R Y + +  K +    ++    M E   L K +N F++   +   S    + V  +   G L  ++   G   E+ ++FY++ ++ A+E LH  N+++R++  EN+++D  G   L DF  CK+NMK ND T T      Y APE+   +G TK +DW+ LGV L+ M  G  P Y +NT           LR   ++S DS  L+  L+   P+ RLGN   G E +KNH FF  +DW+ L ++ ++PP KP +D      + + +F S++   SV+
Sbjct:  194 NQPIAFDAFDLLRVIGRGSFGKVYVVRKKDTNRIYAMKVLRKSRIISRSEVTHTMAEKTVLAKIRNPFIVPLKFAFQSPDKLYLVLAFINGGELFHHLQVEGKFDEERSRFYTAELLCALECLHDYNVIYRDLKPENILIDYNGHIALCDFGLCKLNMKENDRTNTFCGTPEYLAPELLLGQGYTKTVDWWTLGVLLYEMMTGLPPFYDENTNEMYRKILQDELRFPDEMSEDSKGLLRGLLTRDPNERLGNN--GPEDIKNHPFFARIDWQKLMQKKVQPPFKPSVDGSNDTSNFDEEFTSEAPQESVV 501          
BLAST of Protein kinase N3 vs. TrEMBL
Match: A0A5G3K705 (Uncharacterized protein OS=Xenopus tropicalis OX=8364 PE=3 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 3.487e-39
Identity = 87/251 (34.66%), Postives = 134/251 (53.39%), Query Frame = 2
Query:  260 ITSKEKSNQNIKIMKEILNLMKDQNAFLLNSIYCGL-SEHHWFHVQEYPERGTLKKYIGN-GAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFPNYSKNTLRHRKKLSNDSNSLISE-----------LIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQIT 973
            I +K    +++K  K IL  +       L S+Y    SE+H F V EY   G L   + + GA +E  A FY++C+VL +E LH NNI+HR++ LEN++VD  G+ K+ DF   K   +  D ++T    + Y APE+      ++ +DW+ALGV L+ M +  FP  +++ +   + + ND  +L  E           L+E  P  RLG++  G E VK H FF+ +DWE   +R   PP KP +  +T
Sbjct:   55 IIAKNDIKRSVKWEKRILQKVTSAEHPFLVSLYATFQSENHLFFVMEYLPGGDLCHLLEHQGAFEESKAMFYTACVVLGLEELHRNNIVHRDLKLENLMVDVHGYLKIVDFGLSKDGFRYGDRSKTRCGTNCYMAPEIIDEMAYSRAVDWWALGVVLYVMLMFQFPFDAEDDMELFESIRNDKPALTEELSEEAQCVILRLLEKNPCHRLGSSETGAEEVKAHEFFEDIDWEEFLEREQMPPFKPDVSGLT 305          
BLAST of Protein kinase N3 vs. TrEMBL
Match: A0A162QNY9 (Non-specific serine/threonine protein kinase OS=Mucor circinelloides f. lusitanicus CBS 277.49 OX=747725 GN=MUCCIDRAFT_87923 PE=4 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 5.668e-38
Identity = 94/311 (30.23%), Postives = 158/311 (50.80%), Query Frame = 2
Query:  158 INFPLLFETWNLISRINEGKF-----VARASNYRKYIITITSKEK---SNQNIKIMKEILNLMKDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIG-NGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFPNYSKNT-----------LRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQITYMDSLESDFLSDSKMFSVI 1030
            ++ P+ F+ ++L+  I  G F     V +    R Y + +  K +    ++    M E   L K +N F++   +   S    + V  +   G L  ++   G   E  ++FY++ ++ A+E LH  N+++R++  EN+++D  G   L DF  CK+NMK N+ T T      Y APE+   +G TK +DW+ LGV L+ M  G  P Y +NT           LR    +S D+ SL+  L+   P+ RLGN   G+E +KNH FF  +DW  L ++ ++PP KP +D      + + +F S++   S++
Sbjct:  184 VSTPITFDAFDLLRVIGRGSFGKVYVVRKKDTNRIYAMKVLRKSRIISRSEVTHTMAEKTVLAKIRNPFIVPLKFAFQSPDKLYLVLAFINGGELFHHLQLEGRFDENRSRFYTAELLSALECLHDFNVVYRDLKPENILIDYNGHIALCDFGLCKLNMKENERTNTFCGTPEYLAPELLLGQGYTKTVDWWTLGVLLYEMMTGLPPFYDENTNEMYRKILQDELRFPDDMSEDARSLLRGLLTRDPNERLGNN--GSEEIKNHAFFSSIDWRKLNQKKLQPPYKPSVDSAYDTTNFDDEFTSEAPQESLV 492          
BLAST of Protein kinase N3 vs. Ensembl Cavefish
Match: pkn3 (protein kinase N3 [Source:ZFIN;Acc:ZDB-GENE-030131-1902])

HSP 1 Score: 146.747 bits (369), Expect = 1.912e-38
Identity = 74/234 (31.62%), Postives = 126/234 (53.85%), Query Frame = 2
Query:  332 NAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGNGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFP-----------NYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQITYMDSLESDF 1000
            + FL+N   C  +  H   V EY   G L  +I N    E+  +FY++C++L +EFLH N I++R++ L+N+++D  GF +++DF  CK  M   D T T      + APE+      T+ +DW+ LGV ++ M +G  P           +   + +R+ + LS +S S+I +L++  P+ RLG   +    VK HRFF+ +DWE L  + ++PP  P +     + + + +F
Sbjct:  597 HPFLVNLHGCFQTCDHVCFVMEYSPGGDLMTHIHNSIFTERQTRFYAACVLLGLEFLHQNQIVYRDLKLDNLLMDADGFVRIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTDSTYTRAVDWWGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSPESVSIIQKLLQKNPEKRLGAGEQDANEVKKHRFFQGIDWEALLAKRVKPPFLPTIKTSGDVSNFDEEF 830          
BLAST of Protein kinase N3 vs. Ensembl Cavefish
Match: pkn1b (protein kinase N1b [Source:ZFIN;Acc:ZDB-GENE-070424-87])

HSP 1 Score: 140.198 bits (352), Expect = 2.677e-36
Identity = 87/308 (28.25%), Postives = 152/308 (49.35%), Query Frame = 2
Query:  167 PLLFETWNLISRINEGKF-VARASNYRKYIITITSKEKSNQNIKIMKEILNLMKDQ----------NAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGNGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFP-----------NYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQITYMDSLESDFLSDSKMFS 1024
            PL  + + L++ +  G F     S Y++       K     +I    E+ +LM ++          + FL+N   C  ++ H   V EY   G L  +I      E  + FY++C+VL ++FLH N I++R++ L+N+++D  GF K++DF  CK  M   D T T      + APE+      T+ +DW+ LGV ++ M +G  P           +   + +R+ + LS ++ SL+  L+   P+ RLG+T    E VK   FF+ +DWE L +R + PP  P L     + + +++F +++   +
Sbjct:  393 PLCLQDFRLVAVLGRGHFGKVLLSEYKRSGTLYAIKALKKGDIIARDEVESLMCEKRIFETVNSSHHPFLVNLFACFQTDEHVCFVMEYTAGGDLMMHIHADVFSEPRSVFYAACVVLGLQFLHDNKIVYRDLKLDNLLLDTDGFVKIADFGLCKEGMGFGDRTSTFCGTPEFLAPEVLTDSSYTRAVDWWGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAISLMRRLLRRNPERRLGSTERDAEDVKKQPFFRNIDWEALLQRKVVPPFVPSLGGREDVSNFDAEFTTEAPALT 700          
BLAST of Protein kinase N3 vs. Ensembl Cavefish
Match: prkx (protein kinase X-linked [Source:NCBI gene;Acc:103026199])

HSP 1 Score: 127.872 bits (320), Expect = 1.865e-33
Identity = 80/241 (33.20%), Postives = 121/241 (50.21%), Query Frame = 2
Query:  275 KSNQNIKIMKEILNLMKDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYI-GNGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFPNYSKNT-----------LRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKL 961
            K  Q++   KE+L  +   + FL+   +    E   + + +Y   G L  Y+   G        FYS+ IV AIE+LH   I++R++  EN+++DG G  +L+DF   K   KL+D T T+     Y APE+ +SKG  + +DW+ALGV +  M  G  P +  N            L   + L      LI + +      RLGN   G + VK HR+FK +DWE +  R ++PPI PK+
Sbjct:   91 KQEQHVHNEKEVLTEV--NHPFLITLFWTHHDERFLYMLMDYVPGGELFSYLRSRGRFSNNTGLFYSAEIVCAIEYLHSKEIVYRDLKPENILLDGEGHIRLTDFGFAK---KLSDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGVLIFEMLAGYPPFFDDNPFGIYQKILAGKLEFPRHLDFYVKDLIKKFLVIDRARRLGNMKNGADDVKKHRWFKSIDWETVPNRRLKPPIVPKV 326          
BLAST of Protein kinase N3 vs. Ensembl Cavefish
Match: prkcaa (protein kinase C, alpha, a [Source:ZFIN;Acc:ZDB-GENE-050208-100])

HSP 1 Score: 131.339 bits (329), Expect = 2.841e-33
Identity = 84/281 (29.89%), Postives = 137/281 (48.75%), Query Frame = 2
Query:  185 WNLISRINEGKF-----VARASNYRKYIITITSKEKSNQN-----IKIMKEILNLMKDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGN-GAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFP-----------NYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKL 961
            +N ++ + +G F         S+   Y I I  K+   Q+       + K +L   +D+  FL     C  +    + V EY   G L  +I   G  KE  A FY++ I + + FLH   +++R++ L+NV++D  G  K++DF  CK N+    TTRT      Y APE+   +   + +DW+A GV L+ M  G  P           +  ++ + + K LS ++ S+   L+   P  RLG + EG   ++ H FF+ +DWE L  R ++PP KPK+
Sbjct:  305 FNFLAVLGKGSFGKVMLAEMKSSEELYAIKILKKDVVIQDDDVECTMVEKRVLA-QQDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEIAVGLFFLHQKGVIYRDLKLDNVMLDAEGHIKIADFGMCKENIFEGVTTRTFCGTPDYIAPEIIAYQPYGRSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKALSKEAVSICKGLMTKHPTKRLGCSQEGERDIREHAFFRRIDWERLENREVQPPFKPKV 584          
BLAST of Protein kinase N3 vs. Ensembl Cavefish
Match: prkcaa (protein kinase C, alpha, a [Source:ZFIN;Acc:ZDB-GENE-050208-100])

HSP 1 Score: 130.568 bits (327), Expect = 4.048e-33
Identity = 84/281 (29.89%), Postives = 137/281 (48.75%), Query Frame = 2
Query:  185 WNLISRINEGKF-----VARASNYRKYIITITSKEKSNQN-----IKIMKEILNLMKDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGN-GAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFP-----------NYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKL 961
            +N ++ + +G F         S+   Y I I  K+   Q+       + K +L   +D+  FL     C  +    + V EY   G L  +I   G  KE  A FY++ I + + FLH   +++R++ L+NV++D  G  K++DF  CK N+    TTRT      Y APE+   +   + +DW+A GV L+ M  G  P           +  ++ + + K LS ++ S+   L+   P  RLG + EG   ++ H FF+ +DWE L  R ++PP KPK+
Sbjct:  313 FNFLAVLGKGSFGKVMLAEMKSSEELYAIKILKKDVVIQDDDVECTMVEKRVL-AQQDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEIAVGLFFLHQKGVIYRDLKLDNVMLDAEGHIKIADFGMCKENIFEGVTTRTFCGTPDYIAPEIIAYQPYGRSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKALSKEAVSICKGLMTKHPTKRLGCSQEGERDIREHAFFRRIDWERLENREVQPPFKPKV 592          
BLAST of Protein kinase N3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001814.1 (pep scaffold:Pmarinus_7.0:GL481074:830:17391:1 gene:ENSPMAG00000001637.1 transcript:ENSPMAT00000001814.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.775 bits (286), Expect = 8.317e-30
Identity = 72/261 (27.59%), Postives = 130/261 (49.81%), Query Frame = 2
Query:  212 GKFVARASNYRKYIITITSKEKSNQNIKIMKEILNLMKDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGN-GAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFPNYSKNTLRHRKKL-----------SNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPK 958
            G+ V+  +  R  ++ +   E +    +I++ I         FL+   Y      + + V EY   G +  ++   G   E  ++FY++ IVLA E+LH  ++++R++  EN+++D  G+ +++DF   K   ++   T T+     Y APE+  SKG  K +DW+ALGV ++ MA G  P ++   ++  +K+           S+D   L+  L++     R GN   G   +KNH++F   DW  + +R +E P  PK
Sbjct:    4 GQHVSLKATKRTKVVKLKQVEHTLNEKRILQAI------SFPFLVRLEYSFKDNSNLYMVLEYVPGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAK---RVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFSTTDWIAIYQRKVEAPFIPK 255          
BLAST of Protein kinase N3 vs. Ensembl Sea Lamprey
Match: PRKCD (protein kinase C delta [Source:HGNC Symbol;Acc:HGNC:9399])

HSP 1 Score: 111.694 bits (278), Expect = 6.404e-29
Identity = 64/210 (30.48%), Postives = 109/210 (51.90%), Query Frame = 2
Query:  368 SEHHWFHVQEYPERGTLKKYIG-NGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFP-----------NYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKL 961
            ++ H   V EY   G L  +I   G  +   A FY++ IV  ++FLH   I++R++ L+N+++D  G  K++DF  CK N+  +    T      Y APE+   +     +DW++ GV L+ M +G  P           +   +   + + ++ DS  ++  L+E +P  RLG T E    ++ H FF+ ++WE L KR +EPP KP++
Sbjct:   59 TKEHLMFVMEYLNGGDLMFHIQVKGRFEIDRATFYAAEIVSGLQFLHDQGIIYRDLKLDNILLDKDGHVKIADFGMCKENIVGDVRAGTFCGTPDYIAPEIVIGQKYNCSVDWWSFGVLLYEMLIGQSPFRGDDEEELFESIRTSVPYYPRWITKDSRDILPLLLEREPMKRLGVTGE----IRQHPFFRTINWEALEKRELEPPFKPRV 264          
BLAST of Protein kinase N3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008480.1 (pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1 gene:ENSPMAG00000007654.1 transcript:ENSPMAT00000008480.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.161 bits (287), Expect = 8.050e-29
Identity = 77/297 (25.93%), Postives = 141/297 (47.47%), Query Frame = 2
Query:  176 FETWNLISRINEGK--FVARASNYRKYIITITSKE---KSNQNIKIMKEILNLMKDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGNGAI-KEKAAKFYSSCIVLAIEFLHFN-NIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFPNYSKN-----------TLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQITYMDSLESDFLSDS 1012
            F+   L+ +   GK   V   +  + Y + I  KE     ++    + E   L   ++ FL    Y   +      V EY   G L  ++    +  E   +FY + IV A+++LH   N+++R++ LEN+++D  G  K++DF  CK  +    T +T      Y APE+ +     + +DW+ LGV ++ M  G  P Y+++            +R  + LSND+ +L+S L++  P  RLG  ++  + +  H FF  + W+++  R + PP KP++   T     + +F + +
Sbjct:  150 FDYLKLLGKGTFGKVILVREKATGQYYAMKILKKEVIVAKDEVAHTLTENRVLQTTKHPFLTLLKYSFQTHDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHTEKNVVYRDLKLENLMLDKDGHIKIADFGLCKEGITDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIRFPRTLSNDARALLSGLLKKDPKQRLGGGVDDAKEIMRHSFFAGIIWQDVYDRKMTPPFKPQVASETDTRYFDEEFTAQT 446          
BLAST of Protein kinase N3 vs. Ensembl Sea Lamprey
Match: PRKCD (protein kinase C delta [Source:HGNC Symbol;Acc:HGNC:9399])

HSP 1 Score: 112.464 bits (280), Expect = 1.168e-27
Identity = 74/268 (27.61%), Postives = 133/268 (49.63%), Query Frame = 2
Query:  206 NEGKFVARASNYRKYIITITSKEKSNQNIKIMKEILNLMKDQNAFLLNSIYCGL--SEHHWFHVQEYPERGTLKKYI---GNGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFPNYSKN-----------TLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKL 961
             +GKF A  +  ++ ++     E +    +++     LM  ++ FL +   CG   ++ H F V E+   G L  +I   G   +     +FY++ ++  ++FLH +NI++R++ L+NV++D  G  K++DF  CK ++   +   T      Y APE+   +     +DW+++GV ++ M +G  P Y  +           T  + + LS+ S +++S L E     RLG        ++ H FFK +DW +L  R I PP KPK+
Sbjct:  273 EQGKFFAIKALKKEVVLMGDDVECTMVEKRVL-----LMACEHPFLTH--LCGTFQTKEHLFFVMEFLTGGDLMFHIQDKGKFDLPTGTNRFYAAEVICGLQFLHSHNIIYRDLKLDNVLLDREGHVKIADFGMCKEHVGAGNLATTFCGTPDYIAPEILLGRAYGTSVDWWSMGVLIYEMLIGQSPFYGSDEDELFEAIKGHTPHYPRWLSDSSRNILSCLFERDHTKRLG----AVGDIRLHPFFKNIDWPSLEARKITPPFKPKV 529          
BLAST of Protein kinase N3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006766.1 (pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 gene:ENSPMAG00000006086.1 transcript:ENSPMAT00000006766.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 108.997 bits (271), Expect = 7.741e-27
Identity = 83/275 (30.18%), Postives = 133/275 (48.36%), Query Frame = 2
Query:  242 RKYIITITSKEKSNQNIKIMKEILNLMKD-QNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIG-NGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFPNYSKN-----------TLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQITYMDSLESDFLSDSKMFSV 1027
            +K II    +EK      IM E   L+K+ ++ FL+   Y   S    + V +Y   G L  ++   G+  E  A+FY++ I  AI +LH  NI++R++  EN+++D  G   L+DF  CK  +  + TT T      Y APE+ K     + +DW+ LG  L+ M  G  P YSKN            L+ R   +N + S++  L+   P  RLG T +  E +KNH FF  ++W +L  + I  P  P +     + + +  F ++    S+
Sbjct:  124 KKSIILQKKEEK-----HIMAERNVLVKNVRHPFLVGLHYSFQSADKLYFVMDYVNGGELFFHLQRQGSFPESRAQFYAAEIGSAIGYLHSLNIVYRDLKPENILLDYQGHIVLTDFGLCKEGIDPHSTTCTFCGTPEYLAPEVLKKHPYDRTVDWWCLGCVLYEMLYGLPPFYSKNLKQMYESILHQPLQLRPCTTNAAISVLEGLLHKDPHQRLGATSDILE-IKNHVFFSTINWNDLDAKRIPSPYNPGVSGPCDLHNFDPAFTAEPLSMSM 392          
BLAST of Protein kinase N3 vs. Ensembl Yeast
Match: TPK1 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; phosphorylates and inhibits Whi3p to promote G1/S phase passage; partially redundant with Tpk2p and Tpk3p; phosphorylates pre-Tom40p, which impairs its import into mitochondria under non-respiratory conditions; TPK1 has a paralog, TPK3, that arose from the whole genome duplication [Source:SGD;Acc:S000003700])

HSP 1 Score: 125.176 bits (313), Expect = 4.677e-33
Identity = 83/272 (30.51%), Postives = 134/272 (49.26%), Query Frame = 2
Query:  188 NLISRINEGKFVARASNYRKYIITITSKEKSNQNIKIMKEILNLMKDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGNGA-IKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFPNYSKNTLRHRKKLSN-----------DSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQ 967
            +LI   + G++ A     ++ ++ +   E +N   ++M  I+      + F++            F + +Y E G L   +          AKFY++ + LA+E+LH  +I++R++  EN+++D  G  K++DF   K    + D T T+     Y APE+  +K   K IDW++ G+ ++ M  G  P Y  NT++  +K+ N           D   L+S LI      RLGN   GTE VKNH +FK V WE L  RNIE P +P + Q
Sbjct:  102 HLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTNDE-RLMLSIVT-----HPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKY---VPDVTYTLCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFYDSNTMKTYEKILNAELRFPPFFNEDVKDLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKEVVWEKLLSRNIETPYEPPIQQ 364          
BLAST of Protein kinase N3 vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 119.783 bits (299), Expect = 5.104e-31
Identity = 80/276 (28.99%), Postives = 133/276 (48.19%), Query Frame = 2
Query:  176 FETWNLISRINEGKFVARASNYRKYIITITSKEKSNQNIKIMKEILNLMKDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGNGA-IKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFPNYSKNTLRHRKKLSN-----------DSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQ 967
            F   +LI   + G+F A  +  +  I+ +   E +N   +++  +       + F++            F V +Y E G L   +          AKFY++ + LA+E+LH  +I++R++  EN+++D  G  K++DF   K    + D T T+     Y APE+  +K   K +DW++ GV ++ M  G  P Y+ NT++  + + N           D+  L+ +LI      RLGN   G+E VKNH +F  V WE L  R IE P +P + Q
Sbjct:   99 FGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEHTNDERRMLSIV------SHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKY---VPDVTYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYNSNTMKTYENILNAELKFPPFFHPDAQDLLKKLITRDLSERLGNLQNGSEDVKNHPWFNEVIWEKLLARYIETPYEPPIQQ 365          
BLAST of Protein kinase N3 vs. Ensembl Yeast
Match: TPK2 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk3p; localizes to P-bodies during stationary phase; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000006124])

HSP 1 Score: 113.62 bits (283), Expect = 6.809e-29
Identity = 72/270 (26.67%), Postives = 135/270 (50.00%), Query Frame = 2
Query:  188 NLISRINEGKFVARASNYRKYIITITSKEKSNQNIKIMKEILNLMKDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGNGA-IKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFPNYSKNTLRHRKKLSN-----------DSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKL 961
            +L+  ++ G++ A     ++ ++ +   E +N   +++K +      ++ FL+          + F V +Y E G L   +          AKFY++ ++LA+E+LH +NI++R++  EN+++D  G  K++DF   K   ++   T T+     Y APE+  +K   K +DW++LGV ++ M  G  P Y    ++  +K+             D   L+S+LI +    R+GN   G+  +K H +F  V WE L  ++IE P +P +
Sbjct:   85 HLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTNDERRMLKLV------EHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAK---EVQTVTWTLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILQGKVVYPPYFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWFSEVVWERLLAKDIETPYEPPI 345          
BLAST of Protein kinase N3 vs. Ensembl Yeast
Match: YPK1 (S/T protein kinase; phosphorylates, downregulates flippase activator Fpk1p; inactivates Orm1p and Orm2p by phosphorylation in response to compromised sphingolipid synthesis; involved in the TORC-dependent phosphorylation of ribosomal proteins Rps6a/b (S6); mutations affect receptor-mediated endocytosis and sphingolipid-mediated and cell integrity signaling pathways; human homolog SGK1 can complement a null mutant; human homolog SGK2 can complement a ypk1 ypk2 double mutant [Source:SGD;Acc:S000001609])

HSP 1 Score: 110.538 bits (275), Expect = 4.850e-27
Identity = 83/323 (25.70%), Postives = 147/323 (45.51%), Query Frame = 2
Query:  122 ICLTNDLSPNNNINFPLLFETWNLISRINEGKF-----VARASNYRKYIITITSKE---KSNQNIKIMKEILNLMKDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIG-NGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFPNYSKNTLRHRKKL-----------SNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQITYMDSLESDFLSDSKMFSVI 1030
            I ++ D  P+ N   PL  + ++L+  I +G F     V +    + Y +    K      ++    + E   L +    F++   +   S    + V  +   G L  ++   G      A+FY++ ++ A++ LH  ++++R++  EN+++D  G   L DF  CK+NMK +D T T      Y APE+    G TK +DW+ LGV L+ M  G  P Y ++  +  KK+             D+  L+  L+   P  RLG    G + ++NH FF  + W+ L  +   PP KP +       + + +F  +  + SV+
Sbjct:  328 INISIDYKPSRNK--PLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKVYALKAIRKSYIVSKSEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYFVLAFINGGELFYHLQKEGRFDLSRARFYTAELLCALDNLHKLDVVYRDLKPENILLDYQGHIALCDFGLCKLNMKDDDKTDTFCGTPEYLAPELLLGLGYTKAVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLVFPDGFDRDAKDLLIGLLSRDPTRRLG--YNGADEIRNHPFFSQLSWKRLLMKGYIPPYKPAVSNSMDTSNFDEEFTREKPIDSVV 646          
BLAST of Protein kinase N3 vs. Ensembl Yeast
Match: SCH9 (AGC family protein kinase; functional ortholog of mammalian S6 kinase; phosphorylated by Tor1p and required for TORC1-mediated regulation of ribosome biogenesis, translation initiation, and entry into G0 phase; involved in transactivation of osmostress-responsive genes; regulates G1 progression, cAPK activity and nitrogen activation of the FGM pathway; integrates nutrient signals and stress signals from sphingolipids to regulate lifespan [Source:SGD;Acc:S000001248])

HSP 1 Score: 109.768 bits (273), Expect = 8.527e-27
Identity = 87/307 (28.34%), Postives = 146/307 (47.56%), Query Frame = 2
Query:  167 PLLFETWNLISRINEGKF--VARASNYRKYIITITSKE---KSNQNIKIMKE---ILNLMKDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIG-NGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPE-MAKSKGDTKGIDWFALGVCLHYMALGTFPNYSKNTLRHRKK------------LSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQITYMDSLESDFLSDSKMF 1021
            P  FE   L+ +   G+   V +    R Y + + SK+   K N+    + E   ++      + F++   +   +    + V +Y   G L  ++   G   E  AKFY + +VLA+E LH N+I++R++  EN+++D  G   L DF   K ++K  D T T      Y APE +    G TK +D+++LGV +  M  G  P +++N  +  +K            LS +  S +  L+   P  RLG   +G E ++ H FF  +DWE L+++ I PP KP L   T   + + +F + S  +
Sbjct:  409 PQDFEVLRLLGKGTFGQVYQVKKKDTQRIYAMKVLSKKVIVKKNEIAHTIGERNILVTTASKSSPFIVGLKFSFQTPTDLYLVTDYMSGGELFWHLQKEGRFSEDRAKFYIAELVLALEHLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLK--DRTNTFCGTTEYLAPELLLDETGYTKMVDFWSLGVLIFEMCCGWSPFFAENNQKMYQKIAFGKVKFPRDVLSQEGRSFVKGLLNRNPKHRLGAIDDGRE-LRAHPFFADIDWEALKQKKIPPPFKPHLVSETDTSNFDPEFTTASTSY 712          
BLAST of Protein kinase N3 vs. Ensembl Nematostella
Match: EDO35228 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM62])

HSP 1 Score: 122.479 bits (306), Expect = 4.222e-32
Identity = 75/245 (30.61%), Postives = 130/245 (53.06%), Query Frame = 2
Query:  317 LMKDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGN-GAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFPNYSKNTLRHRKKL------------SNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKL----DQITYMDSLESDF 1000
            LM  ++ F++N ++    +   + + EY   G L  Y+   G        F+ S IV A+++LH ++I++R++  EN+++D  G  KL+DF   K   +++D T T+     Y APE+ +SKG  K +DW+ALG+ ++ M +G  P +  N     +K+            +  +  LI +L+      RLG+   G+E VKNH++FK +DW  + +R ++PPI PK+    D   + D  E D+
Sbjct:   70 LMSIEHPFIVNLLWTQHDQTFLYMLLEYACGGELFTYLRTAGRFNNGTGLFFGSEIVSAMDYLHGHSIVYRDLKPENILLDRDGHVKLTDFGFAK---EVHDKTWTLCGTPEYLAPEIIQSKGHNKAVDWWALGILIYEMLVGYPPFFDDNPFGIYEKILSGKVEWPKHMDNTSAKDLIKKLLVHDRTRRLGSMKNGSEDVKNHKWFKVIDWNLVLQRKLKPPINPKISHPGDTRNFDDYPEEDW 311          
BLAST of Protein kinase N3 vs. Ensembl Nematostella
Match: EDO35585 (Protein kinase C [Source:UniProtKB/TrEMBL;Acc:A7SL27])

HSP 1 Score: 120.553 bits (301), Expect = 5.043e-30
Identity = 79/243 (32.51%), Postives = 125/243 (51.44%), Query Frame = 2
Query:  383 FHVQEYPERGTLKKYIGNG-AIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFPNYSKN------TLRHRKK-----LSNDSNSLISELIESKPDVRLGNTLEGTE-SVKNHRFFKCVDWENLRKRNIEPPIKPKLDQITYMDSLESDFLSDSKMFSVILIFKKLRICNRNLI 1072
            F V EY   G L   I       E  ++FY++ +VLA++FLH N +++R++ L+NV++D  G  KL+DF  CK NM    TT T      Y APE+ + +     +DW+ALGV ++ M  G  P  ++N      ++ H        LS ++ S++   +      RLG T   TE S++ H FF+ +++E L  R I PP KPK+   T + + ++DF  +           KL   +RN+I
Sbjct:  458 FFVMEYVNGGDLMFQIQKSRKFDENRSRFYAAEVVLALQFLHQNGVIYRDLKLDNVLLDADGHIKLADFGMCKENMAPGKTTTTFCGTPDYIAPEILQEQPYGFSVDWWALGVLMYEMMAGQPPFEAENEEDLFESILHDDVLYPVWLSREAVSILKGFMTKNYLKRLGCTPTSTESSIREHAFFRLINFEKLEARQINPPFKPKIRSRTDVGNFDTDFTKEE---------PKLTPTDRNVI 691          
BLAST of Protein kinase N3 vs. Ensembl Nematostella
Match: EDO44938 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU22])

HSP 1 Score: 119.783 bits (299), Expect = 7.591e-30
Identity = 85/312 (27.24%), Postives = 141/312 (45.19%), Query Frame = 2
Query:  185 WNLISRINEGKF-----VARASNYRKYIITITSKEKSNQN-----IKIMKEILNLMKDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGNGA-IKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFP--------NYSKNT------------LRHRKKLSNDSNSLISELIESKPDVRLG-NTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQITYMDSLESDFLSDSKMFS 1024
            +NLI  I  G +     V      R Y + +  KE  N +     ++  K +       + FL+    C  +    F V EY   G L  ++     + E  A+FYS+ I  A+ FLH   +++R++ L+NV++D  G  KL+D+  CK  ++  D T T      Y APE+ + +     +DW+ALGV L+ M  G  P        N  +NT            +R  + LS  + S++   +   P  RLG +   G   + +H FF+ V WE L  R + PP KP+ +    +++ +  F ++   F+
Sbjct:  222 FNLIRVIGRGSYAKVMLVELKKTKRIYAMKVVKKELVNDDEDIDWVQTEKHVFE-QASNHPFLVGLHSCFQTSSRLFFVIEYVSGGDLMYHMQRQRRLPEDHARFYSAEICCALNFLHEKGVIYRDLKLDNVLLDSDGHIKLTDYGMCKEGIRPGDVTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLLYEMLAGRSPFDIVGSADNPDQNTEDYLFQVILEKPIRIPRSLSVKAASILKGYLNKNPTERLGCHPQTGFADITSHAFFRTVSWEQLEARQVTPPFKPRQEDPYGLENFDPQFTNEDVQFT 532          
BLAST of Protein kinase N3 vs. Ensembl Nematostella
Match: EDO41166 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S521])

HSP 1 Score: 117.472 bits (293), Expect = 1.037e-29
Identity = 80/277 (28.88%), Postives = 129/277 (46.57%), Query Frame = 2
Query:  257 TITSKEKSNQNIKIMKEILNLMKDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIG-NGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFPNYSKNTLRHRKK-----------LSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKP-------------KLDQITYMDSLESDFLSDS 1012
             I   +K   + K  + IL  +K  + F+++ IY   +    + + EY   G L   +   G   E  A FY S I +A+E LH   I++R++  EN+++D  G  KL+DF  CK ++  N  T T      Y APE+    G  K +DW++LG  ++ M  GT P  + N  +   K           L+ ++   I +L++  P  RLG        +K H FF+ + WE+L  + +EPP +P             K  + T +DS +   LS+S
Sbjct:  103 AIIRSQKDTAHTKAERNILECVK--HPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFLEDTACFYLSEISMALEHLHKQGIVYRDLKPENILLDANGHVKLTDFGLCKESIFENSLTHTFCGTIEYMAPEILTRSGHGKAVDWWSLGALMYDMLTGTPPFCADNRKKTIDKILKGKLIIPPYLTPEAKDFIRKLLKRHPQARLGGMAGDANPIKAHSFFRHICWEDLLAKKVEPPFRPSISGEEDVSQFDSKFTRQTPVDSPDDSMLSES 377          
BLAST of Protein kinase N3 vs. Ensembl Nematostella
Match: EDO43312 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYZ0])

HSP 1 Score: 119.783 bits (299), Expect = 1.414e-29
Identity = 72/267 (26.97%), Postives = 136/267 (50.94%), Query Frame = 2
Query:  260 ITSKEKSNQNIKIMKEILNLMKDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGNGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGD-TKGIDWFALGVCLHYMALGTFP-----------NYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQITYMDSLESDFLSDSKMFS 1024
            I ++E+    +   +  L   K ++ FL+N   C  ++ H   V EY   G L  +I      E    FY++C+VL +++LH + I++R++ L+N+++D  G+ K++DF  CK +M     T T      + APEM  ++   T+ +DW+ LGV +  M +G  P           +   + +R+ + LS ++ +++  L+   P+ RLG   +  E VK   FF+ + W++L  R I PP  P++     + + + +F S+  + +
Sbjct:  648 IIAREEVESLLAEKRIFLTANKTRHPFLVNLFACFQTQEHVCFVMEYAPGGDLMMHIHADVFAESRTVFYTACVVLGLQYLHDHEIVYRDLKLDNLLLDSEGYVKIADFGLCKEDMGYGARTGTFCGTPEFLAPEMLVTETSYTRAVDWWGLGVLIFEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAIAIMRRLLRRNPERRLGAAEKDAEEVKKQPFFRDMRWDDLLARKIRPPFVPQVKHAEDVSNFDEEFTSEEPILT 914          
BLAST of Protein kinase N3 vs. Ensembl Medaka
Match: pkn3 (serine/threonine-protein kinase N2 [Source:NCBI gene;Acc:101157143])

HSP 1 Score: 141.739 bits (356), Expect = 1.249e-36
Identity = 76/237 (32.07%), Postives = 122/237 (51.48%), Query Frame = 2
Query:  323 KDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGNGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFP-----------NYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQITYMDSLESDF 1000
            K Q+ FL+N   C  +  H   V  Y   G L K+I N         FYSSC++L +EFLH N I++R++ L+N+++D  GF K++DF  CK  M   D T T      + APE+      T+ +DW+ LGV ++ M LG  P           +     +R    LS ++ SLI +L++  P +RLG   E    +K H FF+ ++W+ L  + ++PP +P +     + + + +F
Sbjct:  659 KAQHPFLVNLHGCFQTADHVCFVMAYSSGGDLMKHIHNHIFNRNQTLFYSSCVLLGLEFLHQNKIVYRDLKLDNLLMDAEGFVKIADFGLCKEGMGHGDRTSTFCGTPEFLAPEVLIDNSYTRCVDWWELGVLIYEMLLGECPFPGDDEEEIFDSIVNEEVRCPASLSKEAQSLIQQLLQKDPTLRLGAGEEDASEIKRHPFFQGMNWDALLAKKLKPPFQPVIRAPQDVSNFDEEF 895          
BLAST of Protein kinase N3 vs. Ensembl Medaka
Match: pkn1a (protein kinase N1 [Source:NCBI gene;Acc:101164700])

HSP 1 Score: 132.88 bits (333), Expect = 1.048e-33
Identity = 84/287 (29.27%), Postives = 140/287 (48.78%), Query Frame = 2
Query:  167 PLLFETWNLISRINEGKFV-ARASNYRKYIITITSKEKSNQNIKIMKEILNLMKDQ----------NAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGNGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFP-----------NYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKL 961
            PL  + + LI+ +  G F     S Y+K       K     +I    E+ +LM ++          + FL+N   C  +  H   V EY   G L  +I      E  A FY++C+VL ++FLH + I++R++ L+N+++D  G+ K++DF  CK  M   D T T      + APE+      T+ +DW+ LGV ++ M +G  P           +   + +R+ + LS ++  ++  L+   P+ RLG+  +  E VK   FF+ VDWE L +R + PP  P +
Sbjct:  426 PLSLQDFRLIAVLGRGHFGKVLLSEYKKTGTMYAIKALKKGDIIARDEVDSLMCEKRIFEIVNMSHHPFLINLFACFQTSQHVCFVMEYTAGGDLMMHIHTDVFTEPRAVFYAACVVLGLQFLHDHKIVYRDLKLDNLLLDTDGYVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTDTSYTRAVDWWGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAIGIMRRLLRRNPERRLGSGEKDAEEVKKQPFFRSVDWEALLQRKVPPPFVPSI 712          
BLAST of Protein kinase N3 vs. Ensembl Medaka
Match: pkn1a (protein kinase N1 [Source:NCBI gene;Acc:101164700])

HSP 1 Score: 132.109 bits (331), Expect = 2.091e-33
Identity = 84/287 (29.27%), Postives = 140/287 (48.78%), Query Frame = 2
Query:  167 PLLFETWNLISRINEGKFV-ARASNYRKYIITITSKEKSNQNIKIMKEILNLMKDQ----------NAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGNGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFP-----------NYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKL 961
            PL  + + LI+ +  G F     S Y+K       K     +I    E+ +LM ++          + FL+N   C  +  H   V EY   G L  +I      E  A FY++C+VL ++FLH + I++R++ L+N+++D  G+ K++DF  CK  M   D T T      + APE+      T+ +DW+ LGV ++ M +G  P           +   + +R+ + LS ++  ++  L+   P+ RLG+  +  E VK   FF+ VDWE L +R + PP  P +
Sbjct:  544 PLSLQDFRLIAVLGRGHFGKVLLSEYKKTGTMYAIKALKKGDIIARDEVDSLMCEKRIFEIVNMSHHPFLINLFACFQTSQHVCFVMEYTAGGDLMMHIHTDVFTEPRAVFYAACVVLGLQFLHDHKIVYRDLKLDNLLLDTDGYVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTDTSYTRAVDWWGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAIGIMRRLLRRNPERRLGSGEKDAEEVKKQPFFRSVDWEALLQRKVPPPFVPSI 830          
BLAST of Protein kinase N3 vs. Ensembl Medaka
Match: pkn1a (protein kinase N1 [Source:NCBI gene;Acc:101164700])

HSP 1 Score: 132.109 bits (331), Expect = 2.368e-33
Identity = 84/287 (29.27%), Postives = 140/287 (48.78%), Query Frame = 2
Query:  167 PLLFETWNLISRINEGKF-VARASNYRKYIITITSKEKSNQNIKIMKEILNLMKDQ----------NAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGNGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFP-----------NYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKL 961
            PL  + + LI+ +  G F     S Y+K       K     +I    E+ +LM ++          + FL+N   C  +  H   V EY   G L  +I      E  A FY++C+VL ++FLH + I++R++ L+N+++D  G+ K++DF  CK  M   D T T      + APE+      T+ +DW+ LGV ++ M +G  P           +   + +R+ + LS ++  ++  L+   P+ RLG+  +  E VK   FF+ VDWE L +R + PP  P +
Sbjct:  599 PLSLQDFRLIAVLGRGHFGKVLLSEYKKTGTMYAIKALKKGDIIARDEVDSLMCEKRIFEIVNMSHHPFLINLFACFQTSQHVCFVMEYTAGGDLMMHIHTDVFTEPRAVFYAACVVLGLQFLHDHKIVYRDLKLDNLLLDTDGYVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTDTSYTRAVDWWGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAIGIMRRLLRRNPERRLGSGEKDAEEVKKQPFFRSVDWEALLQRKVPPPFVPSI 885          
BLAST of Protein kinase N3 vs. Ensembl Medaka
Match: pkn1a (protein kinase N1 [Source:NCBI gene;Acc:101164700])

HSP 1 Score: 131.724 bits (330), Expect = 2.586e-33
Identity = 84/287 (29.27%), Postives = 140/287 (48.78%), Query Frame = 2
Query:  167 PLLFETWNLISRINEGKFV-ARASNYRKYIITITSKEKSNQNIKIMKEILNLMKDQ----------NAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGNGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFP-----------NYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKL 961
            PL  + + LI+ +  G F     S Y+K       K     +I    E+ +LM ++          + FL+N   C  +  H   V EY   G L  +I      E  A FY++C+VL ++FLH + I++R++ L+N+++D  G+ K++DF  CK  M   D T T      + APE+      T+ +DW+ LGV ++ M +G  P           +   + +R+ + LS ++  ++  L+   P+ RLG+  +  E VK   FF+ VDWE L +R + PP  P +
Sbjct:  606 PLSLQDFRLIAVLGRGHFGKVLLSEYKKTGTMYAIKALKKGDIIARDEVDSLMCEKRIFEIVNMSHHPFLINLFACFQTSQHVCFVMEYTAGGDLMMHIHTDVFTEPRAVFYAACVVLGLQFLHDHKIVYRDLKLDNLLLDTDGYVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTDTSYTRAVDWWGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAIGIMRRLLRRNPERRLGSGEKDAEEVKKQPFFRSVDWEALLQRKVPPPFVPSI 892          
BLAST of Protein kinase N3 vs. Planmine SMEST
Match: SMESG000014962.1 (SMESG000014962.1)

HSP 1 Score: 404.831 bits (1039), Expect = 5.814e-140
Identity = 194/200 (97.00%), Postives = 194/200 (97.00%), Query Frame = 2
Query:  299 MKEILNLMKDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGNGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFPNYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFF 898
            MKEILNLMKD NAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGNGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCK NMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTF N SKNTLRHRKKLSNDSNSLISELIES P VRLGNTLEGTESVKNHRFF
Sbjct:    1 MKEILNLMKDHNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGNGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKANMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFLNNSKNTLRHRKKLSNDSNSLISELIESNPGVRLGNTLEGTESVKNHRFF 200          
BLAST of Protein kinase N3 vs. Planmine SMEST
Match: SMESG000014536.1 (SMESG000014536.1)

HSP 1 Score: 175.637 bits (444), Expect = 2.891e-49
Identity = 102/244 (41.80%), Postives = 136/244 (55.74%), Query Frame = 2
Query:  302 KEILNLM-KDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGNGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFPNYSKN----------TLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQITYMDSLESDF 1000
            +EIL L+ K  N FL+N I C  SE H F   EY   G    ++      E+ A+FY SCIVLA EFLH  +I++R++ L+NV++D  G+AKL+DF   K NMK +  T T      + APE+ + K  T+ IDW+ALGV L+ M LG  P    +          T  + K LS +S SLI  L++  P+ RLG   EGT  VK H FF  +DW  L  R + PP  PKLD +T     ES+F
Sbjct:  386 REILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNIKSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEF 629          
BLAST of Protein kinase N3 vs. Planmine SMEST
Match: SMESG000014536.1 (SMESG000014536.1)

HSP 1 Score: 176.022 bits (445), Expect = 1.665e-48
Identity = 102/244 (41.80%), Postives = 137/244 (56.15%), Query Frame = 2
Query:  302 KEILNLM-KDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGNGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFP----------NYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQITYMDSLESDF 1000
            +EIL L+ K  N FL+N I C  SE H F   EY   G    ++      E+ A+FY SCIVLA EFLH  +I++R++ L+NV++D  G+AKL+DF   K NMK +  T T      + APE+ + K  T+ IDW+ALGV L+ M LG  P          +   +T  + K LS +S SLI  L++  P+ RLG   EGT  VK H FF  +DW  L  R + PP  PKLD +T     ES+F
Sbjct:  783 REILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNIKSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEF 1026          
BLAST of Protein kinase N3 vs. Planmine SMEST
Match: SMESG000014533.1 (SMESG000014533.1)

HSP 1 Score: 175.637 bits (444), Expect = 2.019e-48
Identity = 102/244 (41.80%), Postives = 137/244 (56.15%), Query Frame = 2
Query:  302 KEILNLM-KDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGNGAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFP----------NYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQITYMDSLESDF 1000
            +EIL L+ K  N FL+N I C  SE H F   EY   G    ++      E+ A+FY SCIVLA EFLH  +I++R++ L+NV++D  G+AKL+DF   K NMK +  T T      + APE+ + K  T+ IDW+ALGV L+ M LG  P          +   +T  + K LS +S SLI  L++  P+ RLG   EGT  VK H FF  +DW  L  R + PP  PKLD +T     ES+F
Sbjct:  718 REILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNIKSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEF 961          
BLAST of Protein kinase N3 vs. Planmine SMEST
Match: SMESG000039865.1 (SMESG000039865.1)

HSP 1 Score: 128.257 bits (321), Expect = 6.170e-33
Identity = 76/255 (29.80%), Postives = 130/255 (50.98%), Query Frame = 2
Query:  296 IMKEILNLMKDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGN-GAIKEKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCKVNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTFP-----------NYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFFKCVDWENLRKRNIEPPIKPKLDQITYMDSLESDFLSDSKMFS 1024
            I K +L L +++ +FL+    C  +    + V E+   G L   I   G  KE  A FY++ I + + FLH   I++R++ L+N+++D  G  K++DF  CK  +  + TTRT      Y APE+ K +   K +DW+A GV L+ M  G  P             +++ + + K +S +S S+   L+   P  RLG+   G   V+ H FF+ +DWE +  R ++PP KPK+     + + + +F  ++   +
Sbjct:  200 IEKRVLAL-QEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYTAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPKIKDPRDVSNFDQEFTKETAQLT 453          
The following BLAST results are available for this feature:
BLAST of Protein kinase N3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRKCA4.127e-3431.53protein kinase C alpha [Source:HGNC Symbol;Acc:HGN... [more]
PKN21.376e-3229.22protein kinase N2 [Source:HGNC Symbol;Acc:HGNC:940... [more]
PKN21.892e-3229.22protein kinase N2 [Source:HGNC Symbol;Acc:HGNC:940... [more]
PKN12.091e-3227.92protein kinase N1 [Source:HGNC Symbol;Acc:HGNC:940... [more]
PKN12.165e-3227.92protein kinase N1 [Source:HGNC Symbol;Acc:HGNC:940... [more]
back to top
BLAST of Protein kinase N3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkn-13.611e-3629.07Protein Kinase N (PKN) homolog [Source:UniProtKB/... [more]
pkn-13.984e-3629.30Protein Kinase N (PKN) homolog [Source:UniProtKB/... [more]
akt-12.097e-3330.99Serine/threonine-protein kinase akt-1 [Source:Uni... [more]
akt-12.097e-3330.99Serine/threonine-protein kinase akt-1 [Source:Uni... [more]
akt-13.931e-3234.00Serine/threonine-protein kinase akt-1 [Source:Uni... [more]
back to top
BLAST of Protein kinase N3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pkc53E1.363e-3329.63gene:FBgn0003091 transcript:FBtr0305069[more]
Pkn2.833e-3329.08gene:FBgn0020621 transcript:FBtr0088605[more]
Pkc53E3.866e-3329.63gene:FBgn0003091 transcript:FBtr0112819[more]
Pkc53E3.866e-3329.63gene:FBgn0003091 transcript:FBtr0305070[more]
Pkc53E4.269e-3329.63gene:FBgn0003091 transcript:FBtr0087048[more]
back to top
BLAST of Protein kinase N3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkn36.148e-3931.49protein kinase N3 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
pkn36.148e-3931.49protein kinase N3 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
BX321890.26.207e-3931.49protein kinase N3 [Source:NCBI gene;Acc:323182][more]
pkn36.607e-3931.49protein kinase N3 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
pkn38.327e-3530.80protein kinase N3 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
back to top
BLAST of Protein kinase N3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
numbl7.146e-4333.91numb homolog-like [Source:Xenbase;Acc:XB-GENE-9617... [more]
ENSXETT00000040203.12.221e-4234.66pep primary_assembly:Xenopus_tropicalis_v9.1:9:195... [more]
fhl57.713e-4135.53four and a half LIM domains 5 [Source:Xenbase;Acc:... [more]
fhl51.044e-4036.21four and a half LIM domains 5 [Source:Xenbase;Acc:... [more]
tmprss2.64.680e-4033.48transmembrane serine protease 2 gene 6 [Source:Xen... [more]
back to top
BLAST of Protein kinase N3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prkx9.884e-3730.85protein kinase, X-linked [Source:MGI Symbol;Acc:MG... [more]
Prkca2.226e-3431.53protein kinase C, alpha [Source:MGI Symbol;Acc:MGI... [more]
Pkn12.501e-3227.92protein kinase N1 [Source:MGI Symbol;Acc:MGI:10802... [more]
Pkn13.143e-3227.92protein kinase N1 [Source:MGI Symbol;Acc:MGI:10802... [more]
Pkn24.527e-3229.22protein kinase N2 [Source:MGI Symbol;Acc:MGI:10921... [more]
back to top
BLAST of Protein kinase N3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q922R0|PRKX_MOUSE6.914e-3630.85cAMP-dependent protein kinase catalytic subunit PR... [more]
sp|P10102|KPCA_RABIT5.491e-3431.86Protein kinase C alpha type OS=Oryctolagus cunicul... [more]
sp|P05696|KPCA_RAT1.557e-3331.53Protein kinase C alpha type OS=Rattus norvegicus O... [more]
sp|P04409|KPCA_BOVIN1.572e-3331.53Protein kinase C alpha type OS=Bos taurus OX=9913 ... [more]
sp|P17252|KPCA_HUMAN1.982e-3331.53Protein kinase C alpha type OS=Homo sapiens OX=960... [more]
back to top
BLAST of Protein kinase N3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
F7C9772.452e-4132.63Uncharacterized protein OS=Xenopus tropicalis OX=8... [more]
A0A5G3KBW91.122e-3933.91Numb homolog-like OS=Xenopus tropicalis OX=8364 GN... [more]
A0A163AW841.568e-3931.29Non-specific serine/threonine protein kinase OS=Ph... [more]
A0A5G3K7053.487e-3934.66Uncharacterized protein OS=Xenopus tropicalis OX=8... [more]
A0A162QNY95.668e-3830.23Non-specific serine/threonine protein kinase OS=Mu... [more]
back to top
BLAST of Protein kinase N3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkn31.912e-3831.62protein kinase N3 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
pkn1b2.677e-3628.25protein kinase N1b [Source:ZFIN;Acc:ZDB-GENE-07042... [more]
prkx1.865e-3333.20protein kinase X-linked [Source:NCBI gene;Acc:1030... [more]
prkcaa2.841e-3329.89protein kinase C, alpha, a [Source:ZFIN;Acc:ZDB-GE... [more]
prkcaa4.048e-3329.89protein kinase C, alpha, a [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Protein kinase N3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001814.18.317e-3027.59pep scaffold:Pmarinus_7.0:GL481074:830:17391:1 gen... [more]
PRKCD6.404e-2930.48protein kinase C delta [Source:HGNC Symbol;Acc:HGN... [more]
ENSPMAT00000008480.18.050e-2925.93pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1... [more]
PRKCD1.168e-2727.61protein kinase C delta [Source:HGNC Symbol;Acc:HGN... [more]
ENSPMAT00000006766.17.741e-2730.18pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 g... [more]
back to top
BLAST of Protein kinase N3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TPK14.677e-3330.51cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK35.104e-3128.99cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK26.809e-2926.67cAMP-dependent protein kinase catalytic subunit; p... [more]
YPK14.850e-2725.70S/T protein kinase; phosphorylates, downregulates ... [more]
SCH98.527e-2728.34AGC family protein kinase; functional ortholog of ... [more]
back to top
BLAST of Protein kinase N3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO352284.222e-3230.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355855.043e-3032.51Protein kinase C [Source:UniProtKB/TrEMBL;Acc:A7S... [more]
EDO449387.591e-3027.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411661.037e-2928.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433121.414e-2926.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase N3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkn31.249e-3632.07serine/threonine-protein kinase N2 [Source:NCBI ge... [more]
pkn1a1.048e-3329.27protein kinase N1 [Source:NCBI gene;Acc:101164700][more]
pkn1a2.091e-3329.27protein kinase N1 [Source:NCBI gene;Acc:101164700][more]
pkn1a2.368e-3329.27protein kinase N1 [Source:NCBI gene;Acc:101164700][more]
pkn1a2.586e-3329.27protein kinase N1 [Source:NCBI gene;Acc:101164700][more]
back to top
BLAST of Protein kinase N3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014962.15.814e-14097.00SMESG000014962.1[more]
SMESG000014536.12.891e-4941.80SMESG000014536.1[more]
SMESG000014536.11.665e-4841.80SMESG000014536.1[more]
SMESG000014533.12.019e-4841.80SMESG000014533.1[more]
SMESG000039865.16.170e-3329.80SMESG000039865.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003027 ID=SMED30003027|Name=Protein kinase N3|organism=Schmidtea mediterranea sexual|type=transcript|length=1081bp
ATTGAACATGGAGCAAGTAAGCATATTTTTGACAGCAGTTTGTTGTTGTT
TCAGGTTGCAATCGAGCTTTTGTTAGCGCTTTTCATTTTAGAGCAGCCAA
AGAAGTTAGTGGAGTTGAAATATTTGTTTGACAAATGATCTCAGTCCAAA
CAATAACATCAATTTTCCTTTATTATTTGAAACGTGGAATTTAATATCTA
GGATTAATGAAGGGAAATTCGTCGCCAGAGCTTCAAATTATCGTAAATAC
ATAATAACGATTACCAGCAAAGAGAAGTCAAATCAAAATATTAAGATAAT
GAAAGAAATATTGAACTTGATGAAAGACCAAAATGCCTTTTTACTGAATT
CAATTTATTGCGGACTCTCAGAGCATCACTGGTTCCACGTGCAAGAATAT
CCAGAAAGAGGAACATTAAAAAAGTATATTGGAAACGGAGCGATAAAAGA
AAAAGCAGCAAAATTTTATTCGAGTTGTATCGTTCTCGCAATCGAGTTCC
TGCACTTCAACAATATTATGCACAGAAATATAACATTAGAAAATGTGGTT
GTTGATGGAGCAGGATTTGCCAAATTATCAGATTTCCATCATTGTAAGGT
TAACATGAAGTTGAATGATACAACAAGAACAGTATATAAAGACGATGTTT
ATAAGGCTCCTGAAATGGCAAAAAGTAAAGGAGATACTAAAGGGATAGAT
TGGTTTGCCCTCGGTGTATGCCTCCATTATATGGCACTGGGTACATTTCC
CAATTACTCAAAAAACACTCTGCGACACAGGAAAAAACTTTCCAATGATT
CAAATTCGCTAATCAGTGAATTAATTGAAAGTAAACCTGACGTAAGACTC
GGGAACACATTGGAGGGAACGGAAAGTGTCAAAAATCATAGATTTTTCAA
GTGTGTTGATTGGGAAAATTTGAGGAAAAGAAATATAGAACCACCAATCA
AACCAAAATTGGATCAGATCACTTACATGGATTCGTTGGAAAGTGATTTC
TTAAGTGATTCCAAAATGTTTTCCGTAATTTTGATCTTTAAAAAACTTAG
GATTTGTAACCGAAACTTGATATAAGTTATT
back to top

protein sequence of SMED30003027-orf-1

>SMED30003027-orf-1 ID=SMED30003027-orf-1|Name=SMED30003027-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=259bp
MKEILNLMKDQNAFLLNSIYCGLSEHHWFHVQEYPERGTLKKYIGNGAIK
EKAAKFYSSCIVLAIEFLHFNNIMHRNITLENVVVDGAGFAKLSDFHHCK
VNMKLNDTTRTVYKDDVYKAPEMAKSKGDTKGIDWFALGVCLHYMALGTF
PNYSKNTLRHRKKLSNDSNSLISELIESKPDVRLGNTLEGTESVKNHRFF
KCVDWENLRKRNIEPPIKPKLDQITYMDSLESDFLSDSKMFSVILIFKKL
RICNRNLI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0017049GTP-Rho binding
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0004674protein serine/threonine kinase activity
GO:0000166nucleotide binding
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR000961AGC-kinase_C
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0007165signal transduction
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 1..200
e-value: 2.1E-10
score: 14.2
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 14..200
e-value: 6.7E-25
score: 87.9
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 1..200
score: 19.708
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 3..220
e-value: 4.6E-47
score: 162.3
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 35..219
e-value: 4.6E-47
score: 162.3
NoneNo IPR availablePANTHERPTHR24356SERINE/THREONINE-PROTEIN KINASEcoord: 2..234
NoneNo IPR availablePANTHERPTHR24356:SF322PROTEIN KINASE C DELTA TYPEcoord: 2..234
IPR000961AGC-kinase, C-terminalPROSITEPS51285AGC_KINASE_CTERcoord: 201..258
score: 9.968
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 2..241