Caveolin

Overview
NameCaveolin
Smed IDSMED30003024
Uniprot Best hitCaveolin-3 OS=Rattus norvegicus OX=10116 GN=Cav3 PE=1 SV=1 (E=6.93209e-21)
Length (bp)579
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Caveolin (SMED30003024) t-SNE clustered cells

Violin plots show distribution of expression levels for Caveolin (SMED30003024) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Caveolin (SMED30003024) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Caveolin (SMED30003024) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003024

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30003024SMESG000047637.1 dd_Smed_v4_1086_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003024SMESG000047637.1 dd_Smed_v4_1086_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30003024SMESG000047637.1 dd_Smed_v4_1086_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30003024SMESG000047637.1 dd_Smed_v4_1086_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Caveolin vs. Ensembl Human
Match: CAV3 (caveolin 3 [Source:HGNC Symbol;Acc:HGNC:1529])

HSP 1 Score: 85.5001 bits (210), Expect = 7.233e-21
Identity = 49/119 (41.18%), Postives = 65/119 (54.62%), Query Frame = 1
Query:  127 LENRDPKAINQHLT-VAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEP-FAKYCGLCTG 477
            L NRDPK IN+ +  V FED  AEP    S D +W  +Y  +  S   CYRLLS L G+ +AL+WGF +ACI+F +IW   PC     I+   I    +  I  +C P FA    +C+ 
Sbjct:   24 LVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVCSS 142          
BLAST of Caveolin vs. Ensembl Human
Match: CAV3 (caveolin 3 [Source:HGNC Symbol;Acc:HGNC:1529])

HSP 1 Score: 85.5001 bits (210), Expect = 7.233e-21
Identity = 49/119 (41.18%), Postives = 65/119 (54.62%), Query Frame = 1
Query:  127 LENRDPKAINQHLT-VAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEP-FAKYCGLCTG 477
            L NRDPK IN+ +  V FED  AEP    S D +W  +Y  +  S   CYRLLS L G+ +AL+WGF +ACI+F +IW   PC     I+   I    +  I  +C P FA    +C+ 
Sbjct:   24 LVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVCSS 142          
BLAST of Caveolin vs. Ensembl Human
Match: CAV1 (caveolin 1 [Source:HGNC Symbol;Acc:HGNC:1527])

HSP 1 Score: 83.1889 bits (204), Expect = 4.047e-20
Identity = 41/114 (35.96%), Postives = 61/114 (53.51%), Query Frame = 1
Query:  127 LENRDPKAINQHLT-VAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCG 465
            L NRDPK +N  +  + FED  AEP+   S D +W A++  +  +    YRLLS L GI +ALIWG  +A ++F +IW   PC     I+   I    + ++   C+P  +  G
Sbjct:   20 LVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVG 133          
BLAST of Caveolin vs. Ensembl Human
Match: CAV1 (caveolin 1 [Source:HGNC Symbol;Acc:HGNC:1527])

HSP 1 Score: 83.1889 bits (204), Expect = 5.181e-20
Identity = 41/126 (32.54%), Postives = 65/126 (51.59%), Query Frame = 1
Query:  127 LENRDPKAINQHLT-VAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCGLCTGHYTVTVNQ 501
            L NRDPK +N  +  + FED  AEP+   S D +W A++  +  +    YRLLS L GI +ALIWG  +A ++F +IW   PC     I+   I    + ++   C+P  +  G    +  + + +
Sbjct:   20 LVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQK 145          
BLAST of Caveolin vs. Ensembl Human
Match: CAV1 (caveolin 1 [Source:HGNC Symbol;Acc:HGNC:1527])

HSP 1 Score: 83.1889 bits (204), Expect = 5.181e-20
Identity = 41/126 (32.54%), Postives = 65/126 (51.59%), Query Frame = 1
Query:  127 LENRDPKAINQHLT-VAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCGLCTGHYTVTVNQ 501
            L NRDPK +N  +  + FED  AEP+   S D +W A++  +  +    YRLLS L GI +ALIWG  +A ++F +IW   PC     I+   I    + ++   C+P  +  G    +  + + +
Sbjct:   20 LVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQK 145          
BLAST of Caveolin vs. Ensembl Celegans
Match: cav-2 (Caveolin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18879])

HSP 1 Score: 58.5362 bits (140), Expect = 5.170e-11
Identity = 31/114 (27.19%), Postives = 54/114 (47.37%), Query Frame = 1
Query:  127 LENRDPKAINQHLTVAFEDSFAEP-DAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCG 465
            +++RDPK   Q+L  +F + F EP +   S  C+W  ++  ++      Y++L+ + G+ IA + G  +A  AF  IW  RP      + ++ I      F+     PF    G
Sbjct:   20 MDDRDPKDSAQYLNTSFFEVFNEPSEQYHSIACVWTLSFKIFEIVRIYSYKILTLIFGLIIAFLGGILFALFAFLNIWIFRPILILTRMAFAQIVLIWPMFLIYIVRPFFYSVG 133          
BLAST of Caveolin vs. Ensembl Celegans
Match: cav-2 (Caveolin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18879])

HSP 1 Score: 56.225 bits (134), Expect = 1.550e-9
Identity = 26/84 (30.95%), Postives = 45/84 (53.57%), Query Frame = 1
Query:  127 LENRDPKAINQHLTVAFEDSFAEP-DAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCC 375
            +++RDPK   Q+L  +F + F EP +   S  C+W  ++  ++      Y++L+ + G+ IA + G  +A  AF  IW  RP  
Sbjct:  141 MDDRDPKDSAQYLNTSFFEVFNEPSEQYHSIACVWTLSFKIFEIVRIYSYKILTLIFGLIIAFLGGILFALFAFLNIWIFRPIL 224          
BLAST of Caveolin vs. Ensembl Celegans
Match: cav-2 (Caveolin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18879])

HSP 1 Score: 55.8398 bits (133), Expect = 2.108e-9
Identity = 26/84 (30.95%), Postives = 45/84 (53.57%), Query Frame = 1
Query:  127 LENRDPKAINQHLTVAFEDSFAEP-DAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCC 375
            +++RDPK   Q+L  +F + F EP +   S  C+W  ++  ++      Y++L+ + G+ IA + G  +A  AF  IW  RP  
Sbjct:  179 MDDRDPKDSAQYLNTSFFEVFNEPSEQYHSIACVWTLSFKIFEIVRIYSYKILTLIFGLIIAFLGGILFALFAFLNIWIFRPIL 262          
BLAST of Caveolin vs. Ensembl Celegans
Match: cav-2 (Caveolin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18879])

HSP 1 Score: 55.4546 bits (132), Expect = 3.651e-9
Identity = 26/84 (30.95%), Postives = 45/84 (53.57%), Query Frame = 1
Query:  127 LENRDPKAINQHLTVAFEDSFAEP-DAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCC 375
            +++RDPK   Q+L  +F + F EP +   S  C+W  ++  ++      Y++L+ + G+ IA + G  +A  AF  IW  RP  
Sbjct:  211 MDDRDPKDSAQYLNTSFFEVFNEPSEQYHSIACVWTLSFKIFEIVRIYSYKILTLIFGLIIAFLGGILFALFAFLNIWIFRPIL 294          
BLAST of Caveolin vs. Ensembl Celegans
Match: cav-1 (Caveolin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q94051])

HSP 1 Score: 50.447 bits (119), Expect = 1.160e-7
Identity = 30/121 (24.79%), Postives = 53/121 (43.80%), Query Frame = 1
Query:  127 LENRDPKAINQHLTVAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCGLCTGHYTV 489
            L NRD  ++N H+ + FED F E D+  S DC+W   +  +       YRL+S L  +   +I+   +  +A   ++   P      I  +++       I    +P A   GL   ++ +
Sbjct:  102 LVNRDANSMNNHVQLNFEDIFGEADSQHSWDCVWRLNHTVFTAVRLFIYRLVS-LLALPFTIIFAIFFGLLASINVFIIVPLGKLLSIPGTLLAKLWNWLIHAIFDPIASAVGLIFSNFNI 221          
BLAST of Caveolin vs. Ensembl Zebrafish
Match: cav3 (caveolin 3 [Source:ZFIN;Acc:ZDB-GENE-050522-426])

HSP 1 Score: 94.3597 bits (233), Expect = 1.840e-24
Identity = 48/114 (42.11%), Postives = 66/114 (57.89%), Query Frame = 1
Query:  127 LENRDPKAINQHLT-VAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCG 465
            L NRDPK IN+ +  V FED  AEPD   S D +W A+Y  +  S   CYR+LS + GI +AL+WGFC+ACI+F +IW   PC     I+   +    +  I  +C+P  +  G
Sbjct:   23 LINRDPKQINEDVVKVDFEDVIAEPDGTHSMDGVWKASYTTFTVSKYWCYRVLSAVFGIPVALLWGFCFACISFCHIWAVMPCIKSYLIETQCLSRIYSLCIHTFCDPLFEALG 136          
BLAST of Caveolin vs. Ensembl Zebrafish
Match: cav1 (caveolin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2415])

HSP 1 Score: 85.1149 bits (209), Expect = 5.756e-21
Identity = 44/126 (34.92%), Postives = 66/126 (52.38%), Query Frame = 1
Query:  127 LENRDPKAINQHLT-VAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCGLCTGHYTVTVNQ 501
            L NRDPK +N  +  V FED  AEP    S D +W A++  +  +   CYRLL+ L GI +AL+WG  +A ++F +IW   PC     I+   I    +  +  +C+P  +  G C  +  VT  +
Sbjct:   21 LVNRDPKHLNDDVVKVDFEDVIAEPAGTYSFDGVWKASFTTFTVTKYWCYRLLTALVGIPLALVWGIFFAILSFIHIWAVVPCVKSYLIEIHCISRVYSICVHTFCDPLFEAMGKCFSNVRVTATK 146          
BLAST of Caveolin vs. Ensembl Zebrafish
Match: cav1 (caveolin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2415])

HSP 1 Score: 84.7297 bits (208), Expect = 1.872e-20
Identity = 44/126 (34.92%), Postives = 66/126 (52.38%), Query Frame = 1
Query:  127 LENRDPKAINQHLT-VAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCGLCTGHYTVTVNQ 501
            L NRDPK +N  +  V FED  AEP    S D +W A++  +  +   CYRLL+ L GI +AL+WG  +A ++F +IW   PC     I+   I    +  +  +C+P  +  G C  +  VT  +
Sbjct:   54 LVNRDPKHLNDDVVKVDFEDVIAEPAGTYSFDGVWKASFTTFTVTKYWCYRLLTALVGIPLALVWGIFFAILSFIHIWAVVPCVKSYLIEIHCISRVYSICVHTFCDPLFEAMGKCFSNVRVTATK 179          
BLAST of Caveolin vs. Ensembl Zebrafish
Match: cav2 (caveolin 2 [Source:ZFIN;Acc:ZDB-GENE-040625-164])

HSP 1 Score: 74.3294 bits (181), Expect = 1.322e-16
Identity = 35/125 (28.00%), Postives = 59/125 (47.20%), Query Frame = 1
Query:  127 LENRDPKAINQHLTVAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCGLCTGHYTVTVNQ 501
            +++RDPK IN+HL V FED  AEP++  S D +W+ ++  ++      YR+L+    I +A I G  +  ++  +IW   P      +    I    T+ +  +  PF    G C     +   Q
Sbjct:   37 VQDRDPKDINKHLKVGFEDIIAEPNSTHSFDRVWIGSHAVFELVKYVFYRILTTFLAIPMAFIAGIVFGILSCIHIWVVMPVIQGCMMTLPSIHVIWTSLMDMFIGPFFFSIGRCLSSINIKTEQ 161          
BLAST of Caveolin vs. Ensembl Zebrafish
Match: zgc:172270 (zgc:172270 [Source:ZFIN;Acc:ZDB-GENE-080204-67])

HSP 1 Score: 71.2478 bits (173), Expect = 3.253e-15
Identity = 29/84 (34.52%), Postives = 52/84 (61.90%), Query Frame = 1
Query:  127 LENRDPKAINQHLTVAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCN 378
            +  RDP+ IN+ L V+FED  AEP +V+S D +W+ ++  ++ S    YR+++ +  + ++LI G  +A ++F +IW   PC  
Sbjct:   60 INERDPRQINECLKVSFEDVIAEPVSVRSGDRVWIWSHALFEVSRVWFYRIITAVLAVPVSLIAGIVFAVLSFIHIWFFTPCVQ 143          
BLAST of Caveolin vs. Ensembl Xenopus
Match: cav3.1 (caveolin 3, gene 1 [Source:NCBI gene;Acc:100125124])

HSP 1 Score: 82.0333 bits (201), Expect = 1.782e-19
Identity = 43/128 (33.59%), Postives = 65/128 (50.78%), Query Frame = 1
Query:  127 LENRDPKAINQH-LTVAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCGLCTGHYTVTVNQ*M 507
            L +RDPK IN   + V FED  AEP    S D +W A+Y  +  +   CYR+LS   GI ++++WGF +A I+F +IW   PC     I+   +    +     +C+P  +  G       VT+ + M
Sbjct:   28 LVDRDPKRINDSVIKVDFEDVIAEPQGTHSFDGVWKASYTTFTVTKFWCYRILSAAIGIPLSIVWGFIFALISFCHIWAVVPCIKSYQIETHCLGRIFSLCTHTFCDPLFEALGKIFSSIKVTLQKNM 155          
BLAST of Caveolin vs. Ensembl Xenopus
Match: cav1 (caveolin 1 [Source:NCBI gene;Acc:548467])

HSP 1 Score: 82.0333 bits (201), Expect = 2.869e-19
Identity = 42/128 (32.81%), Postives = 65/128 (50.78%), Query Frame = 1
Query:  127 LENRDPKAINQHLT-VAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCGLCTGHYTVTVNQ*M 507
            L NRDPK +N  +  + FED  AEPD   S D +W A++  +  +    YRLL+ + GI +ALIWG  +A ++F +IW   P      I+   I    +  I  +C+P  +  G       ++V + M
Sbjct:   49 LVNRDPKHLNDDVVKIDFEDVIAEPDGTHSFDGIWKASFTTFTVTKYWFYRLLTTIFGIPLALIWGIYFAILSFLHIWAVVPFMRSYLIEIQCISRVYSIGIHTFCDPLFEAMGKALSFIKISVRKEM 176          
BLAST of Caveolin vs. Ensembl Xenopus
Match: cav1 (caveolin 1 [Source:NCBI gene;Acc:548467])

HSP 1 Score: 82.0333 bits (201), Expect = 3.038e-19
Identity = 42/128 (32.81%), Postives = 65/128 (50.78%), Query Frame = 1
Query:  127 LENRDPKAINQHLT-VAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCGLCTGHYTVTVNQ*M 507
            L NRDPK +N  +  + FED  AEPD   S D +W A++  +  +    YRLL+ + GI +ALIWG  +A ++F +IW   P      I+   I    +  I  +C+P  +  G       ++V + M
Sbjct:   53 LVNRDPKHLNDDVVKIDFEDVIAEPDGTHSFDGIWKASFTTFTVTKYWFYRLLTTIFGIPLALIWGIYFAILSFLHIWAVVPFMRSYLIEIQCISRVYSIGIHTFCDPLFEAMGKALSFIKISVRKEM 180          
BLAST of Caveolin vs. Ensembl Xenopus
Match: cav1 (caveolin 1 [Source:NCBI gene;Acc:548467])

HSP 1 Score: 82.0333 bits (201), Expect = 3.126e-19
Identity = 42/128 (32.81%), Postives = 65/128 (50.78%), Query Frame = 1
Query:  127 LENRDPKAINQHLT-VAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCGLCTGHYTVTVNQ*M 507
            L NRDPK +N  +  + FED  AEPD   S D +W A++  +  +    YRLL+ + GI +ALIWG  +A ++F +IW   P      I+   I    +  I  +C+P  +  G       ++V + M
Sbjct:   50 LVNRDPKHLNDDVVKIDFEDVIAEPDGTHSFDGIWKASFTTFTVTKYWFYRLLTTIFGIPLALIWGIYFAILSFLHIWAVVPFMRSYLIEIQCISRVYSIGIHTFCDPLFEAMGKALSFIKISVRKEM 177          
BLAST of Caveolin vs. Ensembl Xenopus
Match: tmod2 (tropomodulin 2 [Source:Xenbase;Acc:XB-GENE-944511])

HSP 1 Score: 81.2629 bits (199), Expect = 3.537e-19
Identity = 41/126 (32.54%), Postives = 65/126 (51.59%), Query Frame = 1
Query:  127 LENRDPKAINQHLT-VAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCGLCTGHYTVTVNQ 501
            L  RDPK INQ +  V FED  AEPD   S D +W A+   +  +   CYR+ S + G+ +AL+WGF +AC++F +IW   PC     ++   +       +  +C+P  +  G       V++ +
Sbjct:   26 LVQRDPKKINQEVVQVDFEDVIAEPDGTHSFDGVWKASSTTFTVTKYWCYRVFSAIFGLPLALLWGFLFACLSFCHIWAVVPCVKSYLMEVQCLGQFYALCVRTFCDPIFEAIGKVLSGIKVSLRK 151          
BLAST of Caveolin vs. Ensembl Mouse
Match: Cav3 (caveolin 3 [Source:MGI Symbol;Acc:MGI:107570])

HSP 1 Score: 86.2705 bits (212), Expect = 3.106e-21
Identity = 48/119 (40.34%), Postives = 66/119 (55.46%), Query Frame = 1
Query:  127 LENRDPKAINQHLT-VAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEP-FAKYCGLCTG 477
            L NRDPK IN+ +  V FED  AEP+   S D +W  ++  +  S   CYRLLS L G+ +AL+WGF +ACI+F +IW   PC     I+   I    +  I  +C P FA    +C+ 
Sbjct:   24 LVNRDPKNINEDIVKVDFEDVIAEPEGTYSFDGVWKVSFTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVCSN 142          
BLAST of Caveolin vs. Ensembl Mouse
Match: Cav1 (caveolin 1, caveolae protein [Source:MGI Symbol;Acc:MGI:102709])

HSP 1 Score: 83.1889 bits (204), Expect = 4.496e-20
Identity = 40/114 (35.09%), Postives = 62/114 (54.39%), Query Frame = 1
Query:  127 LENRDPKAINQHLT-VAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCG 465
            L NRDPK +N  +  + FED  AEP+   S D +W A++  +  +    YRLLS + GI +ALIWG  +A ++F +IW   PC     I+   I    + ++  +C+P  +  G
Sbjct:   20 LVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIG 133          
BLAST of Caveolin vs. Ensembl Mouse
Match: Cav1 (caveolin 1, caveolae protein [Source:MGI Symbol;Acc:MGI:102709])

HSP 1 Score: 83.1889 bits (204), Expect = 4.496e-20
Identity = 40/114 (35.09%), Postives = 62/114 (54.39%), Query Frame = 1
Query:  127 LENRDPKAINQHLT-VAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCG 465
            L NRDPK +N  +  + FED  AEP+   S D +W A++  +  +    YRLLS + GI +ALIWG  +A ++F +IW   PC     I+   I    + ++  +C+P  +  G
Sbjct:   20 LVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIG 133          
BLAST of Caveolin vs. Ensembl Mouse
Match: Cav1 (caveolin 1, caveolae protein [Source:MGI Symbol;Acc:MGI:102709])

HSP 1 Score: 82.8037 bits (203), Expect = 1.072e-19
Identity = 40/114 (35.09%), Postives = 62/114 (54.39%), Query Frame = 1
Query:  127 LENRDPKAINQHLT-VAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCG 465
            L NRDPK +N  +  + FED  AEP+   S D +W A++  +  +    YRLLS + GI +ALIWG  +A ++F +IW   PC     I+   I    + ++  +C+P  +  G
Sbjct:   51 LVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIG 164          
BLAST of Caveolin vs. Ensembl Mouse
Match: Cav1 (caveolin 1, caveolae protein [Source:MGI Symbol;Acc:MGI:102709])

HSP 1 Score: 82.8037 bits (203), Expect = 1.072e-19
Identity = 40/114 (35.09%), Postives = 62/114 (54.39%), Query Frame = 1
Query:  127 LENRDPKAINQHLT-VAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCG 465
            L NRDPK +N  +  + FED  AEP+   S D +W A++  +  +    YRLLS + GI +ALIWG  +A ++F +IW   PC     I+   I    + ++  +C+P  +  G
Sbjct:   51 LVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIG 164          
BLAST of Caveolin vs. UniProt
Match: sp|P51638|CAV3_RAT (Caveolin-3 OS=Rattus norvegicus OX=10116 GN=Cav3 PE=1 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 6.932e-21
Identity = 49/119 (41.18%), Postives = 66/119 (55.46%), Query Frame = 1
Query:  127 LENRDPKAINQHLT-VAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEP-FAKYCGLCTG 477
            L NRDPK IN+ +  V FED  AEP+   S D +W  +Y  +  S   CYRLLS L G+ +AL+WGF +ACI+F +IW   PC     I+   I    +  I  +C P FA    +C+ 
Sbjct:   24 LVNRDPKNINEDIVKVDFEDVIAEPEGTYSFDGVWRVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVCSN 142          
BLAST of Caveolin vs. UniProt
Match: sp|P51637|CAV3_MOUSE (Caveolin-3 OS=Mus musculus OX=10090 GN=Cav3 PE=1 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.172e-20
Identity = 48/119 (40.34%), Postives = 66/119 (55.46%), Query Frame = 1
Query:  127 LENRDPKAINQHLT-VAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEP-FAKYCGLCTG 477
            L NRDPK IN+ +  V FED  AEP+   S D +W  ++  +  S   CYRLLS L G+ +AL+WGF +ACI+F +IW   PC     I+   I    +  I  +C P FA    +C+ 
Sbjct:   24 LVNRDPKNINEDIVKVDFEDVIAEPEGTYSFDGVWKVSFTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVCSN 142          
BLAST of Caveolin vs. UniProt
Match: sp|P33724|CAV1_CANLF (Caveolin-1 OS=Canis lupus familiaris OX=9615 GN=CAV1 PE=1 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 3.086e-20
Identity = 42/114 (36.84%), Postives = 63/114 (55.26%), Query Frame = 1
Query:  127 LENRDPKAINQHLT-VAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCG 465
            L NRDPK +N  +  + FED  AEP+   S D +W A++  +  +    YRLLS L GI +ALIWG  +A ++F +IW   PC     I+   I    + ++  +C+PF +  G
Sbjct:   51 LVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPFFEAVG 164          
BLAST of Caveolin vs. UniProt
Match: sp|Q2KI43|CAV3_BOVIN (Caveolin-3 OS=Bos taurus OX=9913 GN=CAV3 PE=2 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 3.122e-20
Identity = 49/119 (41.18%), Postives = 65/119 (54.62%), Query Frame = 1
Query:  127 LENRDPKAINQHLT-VAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEP-FAKYCGLCTG 477
            L NRDPK IN+ +  V FED  AEP    S D +W  +Y  +  S   CYRLLS L G+ +AL+WGF +ACI+F +IW   PC     I+   I    +  I  +C P FA    +C+ 
Sbjct:   24 LVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVCSN 142          
BLAST of Caveolin vs. UniProt
Match: sp|Q3ZDQ5|CAV3_PIG (Caveolin-3 OS=Sus scrofa OX=9823 GN=CAV3 PE=2 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 3.156e-20
Identity = 49/119 (41.18%), Postives = 65/119 (54.62%), Query Frame = 1
Query:  127 LENRDPKAINQHLT-VAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEP-FAKYCGLCTG 477
            L NRDPK IN+ +  V FED  AEP    S D +W  +Y  +  S   CYRLLS L G+ +AL+WGF +ACI+F +IW   PC     I+   I    +  I  +C P FA    +C+ 
Sbjct:   24 LVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPVFAALGQVCSN 142          
BLAST of Caveolin vs. TrEMBL
Match: gnl|BL_ORD_ID|23504259 (tr|A0A210PEX1|A0A210PEX1_MIZYE Caveolin OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT11365 PE=3 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 1.983e-24
Identity = 51/122 (41.80%), Postives = 68/122 (55.74%), Query Frame = 1
Query:  127 LENRDPKAINQHLTVAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCGLCTGHYTVT 492
            LE+RDP ++N H+ VAFED   EPD   S DC+W  +Y  + C   CCY+ +S LCGI IAL WG  +A I F  +WCC P    + I   I +    + I C   P  +  GLC  + T+T
Sbjct:   10 LESRDPNSLNGHVQVAFEDVLGEPDTTHSIDCVWKNSYSCFNCGKNCCYKFMSTLCGICIALYWGCEFAMITFQMVWCCTPSLKVHTIMLGICQRFFGSCIQCCLAPLCETMGLCFSNITIT 131          
BLAST of Caveolin vs. TrEMBL
Match: gnl|BL_ORD_ID|16113801 (tr|A0A194ANJ4|A0A194ANJ4_PINFU Caveolin OS=Pinctada fucata OX=50426 PE=3 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 4.123e-24
Identity = 54/122 (44.26%), Postives = 70/122 (57.38%), Query Frame = 1
Query:  127 LENRDPKAINQHLTVAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCGLCTGHYTVT 492
            LENRD   IN H+ VAFED  AEP  + S DC+W A+Y  ++CS  CCY+L++ LCGI IAL WG  +A IAF ++WC  PC     I     +      + C   P  + CGLC    TV+
Sbjct:    8 LENRDINEINNHVQVAFEDVLAEPPGLHSLDCVWSASYAVFECSKNCCYKLMTLLCGICIALEWGCTFAEIAFQHVWCHTPCLRVFTINALCFQKFYGTCMNCCLAPVCETCGLCFSKITVS 129          
BLAST of Caveolin vs. TrEMBL
Match: gnl|BL_ORD_ID|23912617 (tr|K1QQJ2|K1QQJ2_CRAGI Caveolin OS=Crassostrea gigas OX=29159 GN=CGI_10028715 PE=3 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 1.001e-22
Identity = 50/122 (40.98%), Postives = 68/122 (55.74%), Query Frame = 1
Query:  127 LENRDPKAINQHLTVAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCGLCTGHYTVT 492
            L++RDP  IN H+ V+FED  AEP    S DC+W A+Y  + C   CCY +L+ LCGI+IAL WG  +A I FS +WC  PC     I    ++      + C+  P  + CGL     TV+
Sbjct:    5 LQDRDPNDINGHVKVSFEDVLAEPAGAHSIDCVWKASYCCFNCGKNCCYNILAALCGIFIALGWGCEFAWITFSMVWCITPCLRLYSISMGCLQKYFGTCVTCFLAPICETCGLLFSRITVS 126          
BLAST of Caveolin vs. TrEMBL
Match: gnl|BL_ORD_ID|15779388 (tr|A0A1I8G233|A0A1I8G233_9PLAT Caveolin OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030848g1 PE=3 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 1.217e-22
Identity = 52/122 (42.62%), Postives = 65/122 (53.28%), Query Frame = 1
Query:  127 LENRDPKAINQHLTVAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCGLCTGHYTVT 492
            L NRDP  IN  + V FED  AEPD   S DC+W  +Y  Y C L   Y++ + LCGI+IAL WG  + C+AF+ IW   P C    IQ S  R   T  + C   P    CG+   + TVT
Sbjct:    6 LVNRDPNGINSGIQVKFEDVLAEPDGAHSMDCVWQNSYKCYTCGLSLSYKIATLLCGIFIALHWGCTFGCLAFNQIWMITPKCKVFEIQMSCFRRFFTTILECCLGPCCATCGMFFSNITVT 127          
BLAST of Caveolin vs. TrEMBL
Match: gnl|BL_ORD_ID|174391499 (tr|A0A556VY27|A0A556VY27_BAGYA Caveolin OS=Bagarius yarrelli OX=175774 GN=Baya_2617 PE=3 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 5.075e-22
Identity = 49/114 (42.98%), Postives = 67/114 (58.77%), Query Frame = 1
Query:  127 LENRDPKAINQHLT-VAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCG 465
            L NRDPK IN+ +  V FED  AEPD   S D +W A+Y  +  S   CYR+LS + GI +AL+WGFC+ACI+F +IW   PC     I+   +    +  I  +C+PF +  G
Sbjct:   23 LINRDPKQINEDVVKVEFEDVIAEPDGTHSMDGVWKASYTTFTISKYWCYRILSAIFGIPVALLWGFCFACISFCHIWAVMPCIKSYLIETQCLSRIYSLCIHTFCDPFFEALG 136          
BLAST of Caveolin vs. Ensembl Cavefish
Match: cav3 (caveolin 3 [Source:NCBI gene;Acc:103034163])

HSP 1 Score: 96.2857 bits (238), Expect = 2.597e-25
Identity = 50/126 (39.68%), Postives = 70/126 (55.56%), Query Frame = 1
Query:  127 LENRDPKAINQHLT-VAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCGLCTGHYTVTVNQ 501
            L NRDPK IN+ +  V FED  AEPD   S D +W A+Y  +  S   CYR+LS + GI +AL+WGFC+ACI+F +IW   PC     I+   +    +  I  +C+PF +  G       V + +
Sbjct:   23 LINRDPKQINEDVVKVDFEDVIAEPDGTHSLDGVWKASYTTFTVSKYWCYRVLSAVFGIPVALLWGFCFACISFCHIWAVMPCIKSYLIETQCLSRIYSLCIHTFCDPFFEALGKVFSSVRVALRK 148          
BLAST of Caveolin vs. Ensembl Cavefish
Match: cav1 (caveolin-1 [Source:NCBI gene;Acc:103028370])

HSP 1 Score: 85.8853 bits (211), Expect = 6.433e-21
Identity = 44/126 (34.92%), Postives = 65/126 (51.59%), Query Frame = 1
Query:  127 LENRDPKAINQHLT-VAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCGLCTGHYTVTVNQ 501
            L NRDPK +N H+  V FED  AEP    S D +W A+Y  +  +    YRLL+ L GI +ALIWG  +A ++F +IW   PC     I+   +    +  +  +C+P  +  G C     +T  +
Sbjct:   53 LVNRDPKHLNDHVVKVDFEDVIAEPAGTYSFDGVWKASYTTFTVTKYWFYRLLTALVGIPLALIWGIFFAILSFLHIWAVVPCLKSYLIEIHCVSQVYSICVHTFCDPLFEAVGKCFSSVRITTTK 178          
BLAST of Caveolin vs. Ensembl Cavefish
Match: zgc:172270 (caveolin-2-like [Source:NCBI gene;Acc:103029205])

HSP 1 Score: 69.707 bits (169), Expect = 8.114e-15
Identity = 34/125 (27.20%), Postives = 65/125 (52.00%), Query Frame = 1
Query:  127 LENRDPKAINQHLTVAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCGLCTGHYTVTVNQ 501
            +  RDP+ IN+ L V+FED  AEP  V+S D +W+ +   ++ S    YR+++ L  + +++I G  +A ++  +IW   PC     I    +    ++ +     PF +    C G +++ +N+
Sbjct:   56 INERDPRQINECLKVSFEDVIAEPMTVRSGDRVWIWSNALFEVSRVWFYRIITVLLAVPVSIIAGILFAILSCLHIWLFTPCVKMVLINTGWLETLWSSILDIIILPFYQSVAKCCGGFSIQLNR 180          
BLAST of Caveolin vs. Ensembl Cavefish
Match: cav2 (caveolin 2 [Source:NCBI gene;Acc:103028678])

HSP 1 Score: 67.0106 bits (162), Expect = 5.884e-14
Identity = 28/82 (34.15%), Postives = 45/82 (54.88%), Query Frame = 1
Query:  133 NRDPKAINQHLTVAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCN 378
            +RDP+ IN HL V FED  AEP +  S D +W+ ++  ++      YRLL+ L  I +A + G  +  ++  +IW   P  +
Sbjct:   41 DRDPRDINAHLKVEFEDIIAEPSSTHSFDSVWIWSHAVFELLKYIFYRLLTTLLAIPMAFVAGIVFGLLSCVHIWVVMPLVH 122          
BLAST of Caveolin vs. Ensembl Cavefish
Match: zgc:158296 (caveolin-2-like [Source:NCBI gene;Acc:103043623])

HSP 1 Score: 60.077 bits (144), Expect = 3.347e-11
Identity = 28/81 (34.57%), Postives = 47/81 (58.02%), Query Frame = 1
Query:  130 ENRDPKAINQHLTVAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPC 372
            E+RDP  +N HL V F D  AEP + +S D +W+ +   ++ +    YR L+ +C + ++ + G  +A +A  +IWC  PC
Sbjct:   49 ESRDPYGVNNHLKVDFSDVLAEPASTRSYDRVWVYSGIGFESARIWSYRCLTAVCAVPVSCLSGCLFALLACLHIWCVMPC 129          
BLAST of Caveolin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007616.1 (pep scaffold:Pmarinus_7.0:GL484966:54:920:1 gene:ENSPMAG00000006881.1 transcript:ENSPMAT00000007616.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 6.044e-11
Identity = 34/108 (31.48%), Postives = 51/108 (47.22%), Query Frame = 1
Query:  169 VAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCGLCTGHYTVT 492
            V FED FA P+   S   +W  A+  Y  +   CY LLS LC + ++  WG  +AC  F ++W   PC     +    ++   +  + C CEP  + C LC  H  + 
Sbjct:    2 VLFEDVFAYPEGSHSIPGVWRCAFRTYNGTKWFCYLLLSVLCAVPLSCCWGCDFACAQFYHVW-VTPCLRMCRMNMLCLQMFWSTIVRCVCEPLCETCALCFSHIRIK 108          
BLAST of Caveolin vs. Ensembl Nematostella
Match: EDO33339 (Caveolin [Source:UniProtKB/TrEMBL;Acc:A7SSH5])

HSP 1 Score: 92.0485 bits (227), Expect = 3.222e-24
Identity = 42/113 (37.17%), Postives = 66/113 (58.41%), Query Frame = 1
Query:  127 LENRDPKAINQHLTVAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCG 465
            +E+RDP  IN H+ V ++D FAEP+   S D +W A++  +  +  CCYRLL+ + G+  A++ G  +AC++F YIWC  PC     IQ   +    +  I  +C+PF +  G
Sbjct:    1 MEDRDPSNINDHVKVFYQDVFAEPEGNHSIDGVWRASFSTFVNTKYCCYRLLTAIFGVPTAILCGCYFACLSFDYIWCIMPCLRAYVIQLQFLGKIFSLLIKTFCDPFFESFG 113          
BLAST of Caveolin vs. Ensembl Nematostella
Match: EDO41786 (Caveolin [Source:UniProtKB/TrEMBL;Acc:A7S3K1])

HSP 1 Score: 62.003 bits (149), Expect = 5.274e-13
Identity = 29/77 (37.66%), Postives = 45/77 (58.44%), Query Frame = 1
Query:  163 LTVAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQ 393
            L V F+D FAEP+   S D +W  +Y  +  +   CYR+++ + GI  A++ G  +AC++F YIWC  PC     I+
Sbjct:    2 LQVFFQDVFAEPEGTHSIDGVWRTSYKTFVATKYWCYRIITAIFGIPTAILCGCYFACLSFDYIWCVMPCLRGYLIE 78          
BLAST of Caveolin vs. Ensembl Medaka
Match: cav3 (caveolin 3 [Source:NCBI gene;Acc:101171655])

HSP 1 Score: 89.7373 bits (221), Expect = 1.030e-22
Identity = 48/114 (42.11%), Postives = 64/114 (56.14%), Query Frame = 1
Query:  127 LENRDPKAINQHLT-VAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCG 465
            L NRDPK IN+ +  V FED  AEPD   S D +W  +Y  +  S   CYR+LS + GI +AL+WGF +ACI+F +IW   PC     I+   I    T  I  + +PF +  G
Sbjct:   25 LINRDPKQINEDVVKVEFEDVIAEPDGTHSLDGVWKLSYTTFTVSKYWCYRILSAIFGIPVALLWGFLFACISFCHIWAVVPCIKSCLIESQCISRIYTLCIQTFFDPFFEAVG 138          
BLAST of Caveolin vs. Ensembl Medaka
Match: cav1 (caveolin-1 [Source:NCBI gene;Acc:101162818])

HSP 1 Score: 81.6481 bits (200), Expect = 3.048e-19
Identity = 42/116 (36.21%), Postives = 62/116 (53.45%), Query Frame = 1
Query:  127 LENRDPKAINQHLT-VAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCGLC 471
            L NRDPK IN  +  V FED  AEP    S D +W A++  +  +   CYRLL+ + GI +ALIWG  +A ++F +IW   PC     I+   +    +  +  +C+P  +  G C
Sbjct:   54 LVNRDPKQINDDVVKVDFEDIIAEPAGTYSFDGVWKASFTTFTVTKYWCYRLLTAVVGIPLALIWGIFFAILSFLHIWAVVPCVKSYLIEIHCLSRVYSICVHTFCDPLFEAMGRC 169          
BLAST of Caveolin vs. Ensembl Medaka
Match: cav2 (caveolin-2 [Source:NCBI gene;Acc:110014685])

HSP 1 Score: 72.7886 bits (177), Expect = 1.290e-15
Identity = 30/83 (36.14%), Postives = 47/83 (56.63%), Query Frame = 1
Query:  130 ENRDPKAINQHLTVAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCN 378
            ++RDP  IN H+ VAFED  AEP +  S D +W+ ++ A++     CYRLLS L  + +A + G  +  ++  +IW   P   
Sbjct:   94 DDRDPNDINAHVKVAFEDVIAEPVSTHSFDTVWVGSHAAFELVKFLCYRLLSTLLAVPVAFVLGLMFGVLSCLHIWLVGPVIR 176          
BLAST of Caveolin vs. Ensembl Medaka
Match: zgc:172270 (caveolin-2 [Source:NCBI gene;Acc:101164882])

HSP 1 Score: 65.855 bits (159), Expect = 5.503e-13
Identity = 32/121 (26.45%), Postives = 64/121 (52.89%), Query Frame = 1
Query:  127 LENRDPKAINQHLTVAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCGLCTGHYTV 489
            ++ RDP+ IN  L V FED  AEP +V+S D +W+ +   ++ S    YR+L+ +  I ++++ G  +A  +  ++W   PC  +  I    +++     +  +  PF++    C G +++
Sbjct:  112 IKTRDPRGINDCLKVTFEDVIAEPVSVRSGDRVWIWSNALFEVSRVWLYRILTVVLAIPMSVLSGVLFAIFSCFHVWMVGPCVEYVLIGTRWLQSLWNVVLGVFVLPFSRTAKRCCGGFSI 232          
BLAST of Caveolin vs. Ensembl Medaka
Match: zgc:158296 (caveolin-2-like [Source:NCBI gene;Acc:101156574])

HSP 1 Score: 53.9138 bits (128), Expect = 5.613e-9
Identity = 32/123 (26.02%), Postives = 54/123 (43.90%), Query Frame = 1
Query:  133 NRDPKAINQHLTVAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCGLCTGHYTVTVNQ 501
            +RDPK IN+HL V   D  +EP A  S   +W  +   ++ +    YR L+ L  + +A + G   A +A   +W   PC   + +    +R+     +     PF     LC     +T+ +
Sbjct:   57 SRDPKGINKHLKVEVSDVLSEPTAPHSTAAVWTVSVCGFERTRVWTYRCLTLLLAVPMAFVCGLSVAVLASLRVWFLVPCIQLSSLFIPCLRSLCLCAVDVVVSPFCVSLALCCSQIIITLTR 179          
BLAST of Caveolin vs. Planmine SMEST
Match: SMESG000047637.1 (SMESG000047637.1)

HSP 1 Score: 258.07 bits (658), Expect = 2.602e-89
Identity = 125/125 (100.00%), Postives = 125/125 (100.00%), Query Frame = 1
Query:  127 LENRDPKAINQHLTVAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCGLCTGHYTVTVNQ 501
            LENRDPKAINQHLTVAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCGLCTGHYTVTVNQ
Sbjct:    9 LENRDPKAINQHLTVAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCGLCTGHYTVTVNQ 133          
BLAST of Caveolin vs. Planmine SMEST
Match: SMESG000052389.1 (SMESG000052389.1)

HSP 1 Score: 126.331 bits (316), Expect = 2.193e-37
Identity = 60/125 (48.00%), Postives = 80/125 (64.00%), Query Frame = 1
Query:  127 LENRDPKAINQHLTVAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCGLCTGHYTVTVNQ 501
            LENRDP+ IN H+   +ED+ AEPD VKSCDCLW  ++  +QC L CCY+ LSGL G+ IAL WG CY C AF +IWCC PC     +  +  +     ++ C   P  + CGLC GH+ VT+++
Sbjct:    6 LENRDPRNINAHIQAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCAFCKKINKAYMDCIYGPICEICGLCGGHFRVTMDK 130          
BLAST of Caveolin vs. Planmine SMEST
Match: SMESG000063381.1 (SMESG000063381.1)

HSP 1 Score: 104.76 bits (260), Expect = 6.546e-29
Identity = 52/122 (42.62%), Postives = 72/122 (59.02%), Query Frame = 1
Query:  127 LENRDPKAINQHLTVAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCGLCTGHYTVT 492
            LENRDP+ IN HL V FED  AEP+   S DC+W  +Y  Y+  + CCY+ L+ LCG+ +AL WG  +AC+AF YIW   P C    +  +I ++ + +     CEP  + CG C  +  VT
Sbjct:    6 LENRDPRNINNHLKVTFEDILAEPEGAHSIDCVWRTSYCCYKFGIGCCYKFLTTLCGLCLALCWGCVFACVAFEYIWFLTPICKVYGLHCAIFKSLMDSITGICCEPCCRACGACFSNIQVT 127          
BLAST of Caveolin vs. Planmine SMEST
Match: SMESG000063380.1 (SMESG000063380.1)

HSP 1 Score: 101.679 bits (252), Expect = 8.757e-28
Identity = 53/122 (43.44%), Postives = 70/122 (57.38%), Query Frame = 1
Query:  127 LENRDPKAINQHLTVAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCGLCTGHYTVT 492
            ++NRD   IN HL V FE+  AEP+   S DC+W  +Y  +Q SL CCY+  + LCG+ IAL WG  +AC+AF +IWCC P C    +  S  RA I +     CEP  +  G C  +  VT
Sbjct:    1 MDNRDVNNINSHLKVTFENVLAEPEGAHSIDCIWKNSYKCFQFSLGCCYKFYTVLCGLCIALCWGCVFACVAFEHIWCCSPVCKVYNLHCSSCRALIDSICGVCCEPCYRAMGACCSNIQVT 122          
BLAST of Caveolin vs. Planmine SMEST
Match: SMESG000063380.1 (SMESG000063380.1)

HSP 1 Score: 101.679 bits (252), Expect = 1.184e-27
Identity = 53/122 (43.44%), Postives = 70/122 (57.38%), Query Frame = 1
Query:  127 LENRDPKAINQHLTVAFEDSFAEPDAVKSCDCLWMAAYGAYQCSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSIIRAAITNFIFCWCEPFAKYCGLCTGHYTVT 492
            ++NRD   IN HL V FE+  AEP+   S DC+W  +Y  +Q SL CCY+  + LCG+ IAL WG  +AC+AF +IWCC P C    +  S  RA I +     CEP  +  G C  +  VT
Sbjct:    6 MDNRDVNNINSHLKVTFENVLAEPEGAHSIDCIWKNSYKCFQFSLGCCYKFYTVLCGLCIALCWGCVFACVAFEHIWCCSPVCKVYNLHCSSCRALIDSICGVCCEPCYRAMGACCSNIQVT 127          
The following BLAST results are available for this feature:
BLAST of Caveolin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CAV37.233e-2141.18caveolin 3 [Source:HGNC Symbol;Acc:HGNC:1529][more]
CAV37.233e-2141.18caveolin 3 [Source:HGNC Symbol;Acc:HGNC:1529][more]
CAV14.047e-2035.96caveolin 1 [Source:HGNC Symbol;Acc:HGNC:1527][more]
CAV15.181e-2032.54caveolin 1 [Source:HGNC Symbol;Acc:HGNC:1527][more]
CAV15.181e-2032.54caveolin 1 [Source:HGNC Symbol;Acc:HGNC:1527][more]
back to top
BLAST of Caveolin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cav-25.170e-1127.19Caveolin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q1887... [more]
cav-21.550e-930.95Caveolin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q1887... [more]
cav-22.108e-930.95Caveolin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q1887... [more]
cav-23.651e-930.95Caveolin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q1887... [more]
cav-11.160e-724.79Caveolin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9405... [more]
back to top
BLAST of Caveolin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Caveolin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cav31.840e-2442.11caveolin 3 [Source:ZFIN;Acc:ZDB-GENE-050522-426][more]
cav15.756e-2134.92caveolin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2415][more]
cav11.872e-2034.92caveolin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2415][more]
cav21.322e-1628.00caveolin 2 [Source:ZFIN;Acc:ZDB-GENE-040625-164][more]
zgc:1722703.253e-1534.52zgc:172270 [Source:ZFIN;Acc:ZDB-GENE-080204-67][more]
back to top
BLAST of Caveolin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cav3.11.782e-1933.59caveolin 3, gene 1 [Source:NCBI gene;Acc:100125124... [more]
cav12.869e-1932.81caveolin 1 [Source:NCBI gene;Acc:548467][more]
cav13.038e-1932.81caveolin 1 [Source:NCBI gene;Acc:548467][more]
cav13.126e-1932.81caveolin 1 [Source:NCBI gene;Acc:548467][more]
tmod23.537e-1932.54tropomodulin 2 [Source:Xenbase;Acc:XB-GENE-944511][more]
back to top
BLAST of Caveolin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cav33.106e-2140.34caveolin 3 [Source:MGI Symbol;Acc:MGI:107570][more]
Cav14.496e-2035.09caveolin 1, caveolae protein [Source:MGI Symbol;Ac... [more]
Cav14.496e-2035.09caveolin 1, caveolae protein [Source:MGI Symbol;Ac... [more]
Cav11.072e-1935.09caveolin 1, caveolae protein [Source:MGI Symbol;Ac... [more]
Cav11.072e-1935.09caveolin 1, caveolae protein [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Caveolin vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P51638|CAV3_RAT6.932e-2141.18Caveolin-3 OS=Rattus norvegicus OX=10116 GN=Cav3 P... [more]
sp|P51637|CAV3_MOUSE2.172e-2040.34Caveolin-3 OS=Mus musculus OX=10090 GN=Cav3 PE=1 S... [more]
sp|P33724|CAV1_CANLF3.086e-2036.84Caveolin-1 OS=Canis lupus familiaris OX=9615 GN=CA... [more]
sp|Q2KI43|CAV3_BOVIN3.122e-2041.18Caveolin-3 OS=Bos taurus OX=9913 GN=CAV3 PE=2 SV=1[more]
sp|Q3ZDQ5|CAV3_PIG3.156e-2041.18Caveolin-3 OS=Sus scrofa OX=9823 GN=CAV3 PE=2 SV=1[more]
back to top
BLAST of Caveolin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|235042591.983e-2441.80tr|A0A210PEX1|A0A210PEX1_MIZYE Caveolin OS=Mizuhop... [more]
gnl|BL_ORD_ID|161138014.123e-2444.26tr|A0A194ANJ4|A0A194ANJ4_PINFU Caveolin OS=Pinctad... [more]
gnl|BL_ORD_ID|239126171.001e-2240.98tr|K1QQJ2|K1QQJ2_CRAGI Caveolin OS=Crassostrea gig... [more]
gnl|BL_ORD_ID|157793881.217e-2242.62tr|A0A1I8G233|A0A1I8G233_9PLAT Caveolin OS=Macrost... [more]
gnl|BL_ORD_ID|1743914995.075e-2242.98tr|A0A556VY27|A0A556VY27_BAGYA Caveolin OS=Bagariu... [more]
back to top
BLAST of Caveolin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cav32.597e-2539.68caveolin 3 [Source:NCBI gene;Acc:103034163][more]
cav16.433e-2134.92caveolin-1 [Source:NCBI gene;Acc:103028370][more]
zgc:1722708.114e-1527.20caveolin-2-like [Source:NCBI gene;Acc:103029205][more]
cav25.884e-1434.15caveolin 2 [Source:NCBI gene;Acc:103028678][more]
zgc:1582963.347e-1134.57caveolin-2-like [Source:NCBI gene;Acc:103043623][more]
back to top
BLAST of Caveolin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000007616.16.044e-1131.48pep scaffold:Pmarinus_7.0:GL484966:54:920:1 gene:E... [more]
back to top
BLAST of Caveolin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Caveolin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO333393.222e-2437.17Caveolin [Source:UniProtKB/TrEMBL;Acc:A7SSH5][more]
EDO417865.274e-1337.66Caveolin [Source:UniProtKB/TrEMBL;Acc:A7S3K1][more]
back to top
BLAST of Caveolin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cav31.030e-2242.11caveolin 3 [Source:NCBI gene;Acc:101171655][more]
cav13.048e-1936.21caveolin-1 [Source:NCBI gene;Acc:101162818][more]
cav21.290e-1536.14caveolin-2 [Source:NCBI gene;Acc:110014685][more]
zgc:1722705.503e-1326.45caveolin-2 [Source:NCBI gene;Acc:101164882][more]
zgc:1582965.613e-926.02caveolin-2-like [Source:NCBI gene;Acc:101156574][more]
back to top
BLAST of Caveolin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000047637.12.602e-89100.00SMESG000047637.1[more]
SMESG000052389.12.193e-3748.00SMESG000052389.1[more]
SMESG000063381.16.546e-2942.62SMESG000063381.1[more]
SMESG000063380.18.757e-2843.44SMESG000063380.1[more]
SMESG000063380.11.184e-2743.44SMESG000063380.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003024 ID=SMED30003024|Name=Caveolin|organism=Schmidtea mediterranea sexual|type=transcript|length=579bp
GTCCGGTGCATATTTCATGTTAGCAACGAGATAGCTTTCATTCTTATTTA
GGTAACATCAGAACTGATAAGCTTAAAACTTACTTTGCAAATAACTATTA
AAATGAAGATAAAAACTGACATCGACCTCGAAAACCGTGATCCGAAGGCA
ATAAACCAACATCTCACAGTTGCGTTTGAAGATTCATTTGCAGAGCCGGA
TGCTGTTAAATCTTGTGACTGTCTTTGGATGGCAGCTTATGGAGCATATC
AATGTTCTCTGTGCTGCTGTTACAGATTATTGAGTGGACTTTGTGGAATA
TGGATTGCTTTGATTTGGGGATTTTGCTACGCTTGTATAGCATTTTCTTA
CATCTGGTGTTGCCGCCCATGTTGCAATCACAACTATATACAATATTCCA
TAATTAGAGCTGCTATAACCAATTTTATATTTTGTTGGTGTGAGCCATTC
GCCAAATATTGCGGCCTCTGCACAGGCCATTACACAGTCACTGTGAACCA
ATAGATGAGAGAACTTATTATCCCAATTATTTTTGATAAATGAAATTAAT
AAATAAAATAGATTTAGGAAAAAAAAGAT
back to top

protein sequence of SMED30003024-orf-1

>SMED30003024-orf-1 ID=SMED30003024-orf-1|Name=SMED30003024-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=101bp
IFFFLNLFYLLISFIKNNWDNKFSHLLVHSDCVMACAEAAIFGEWLTPTK
YKIGYSSSNYGILYIVVIATWAATPDVRKCYTSVAKSPNQSNPYSTKSTQ
*
back to top

protein sequence of SMED30003024-orf-2

>SMED30003024-orf-2 ID=SMED30003024-orf-2|Name=SMED30003024-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=134bp
MKIKTDIDLENRDPKAINQHLTVAFEDSFAEPDAVKSCDCLWMAAYGAYQ
CSLCCCYRLLSGLCGIWIALIWGFCYACIAFSYIWCCRPCCNHNYIQYSI
IRAAITNFIFCWCEPFAKYCGLCTGHYTVTVNQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000106ciliated epithelial cell
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR001612Caveolin
Vocabulary: biological process
TermDefinition
GO:0070836caveola assembly
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0005794Golgi apparatus
GO:0005886plasma membrane
GO:0005901caveola
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001612CaveolinPFAMPF01146Caveolincoord: 3..130
e-value: 4.6E-32
score: 110.8
IPR001612CaveolinPANTHERPTHR10844CAVEOLINcoord: 5..124
NoneNo IPR availablePANTHERPTHR10844:SF19CAVEOLIN-2coord: 5..124
NoneNo IPR availableTMHMMTMhelixcoord: 63..85
NoneNo IPR availableTMHMMTMhelixcoord: 100..122