G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30003012
Length (bp)1240
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30003012) t-SNE clustered cells

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30003012) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30003012) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30003012) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003012

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30003012SMESG000078101.1 dd_Smed_v4_14849_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003012SMESG000078101.1 dd_Smed_v4_14849_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30003012SMESG000078101.1 dd_Smed_v4_14849_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003012SMESG000078101.1 dd_Smed_v4_14849_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30003012SMESG000078101.1 dd_Smed_v4_14849_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30003012SMESG000078101.1 SMED30003012smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: HCRTR1 (hypocretin receptor 1 [Source:HGNC Symbol;Acc:HGNC:4848])

HSP 1 Score: 56.6102 bits (135), Expect = 3.678e-8
Identity = 79/349 (22.64%), Postives = 146/349 (41.83%), Query Frame = 3
Query:  162 GNILVLLVYYRKRGSEQNNETDCFFINSLALSDLIVCLVIVPCTM----STEWYNFHISLYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPLRKILTVNKAKXXXXXXXXXXXXXXXXXATLVGQN---PHIHNSTVPQKTEVCEEIKFHKNVINEVLIYYEVYERITHSV-FILSIIAVIICYALVYVEIIK------IRKREKTLLFKHKRESKKTKSVDMSTSSEAYSSPGEIALLTPRKSLAQGLRDSALFRNIKSAAILFVVAVVYILVFTPVILIITFKVVKFNVIXXXXXXXX---------------XAANPIVYCFMNSNFRRDLSKLFRRHLPNF 1121
            GN LV L  +R   +        +FI +L+L+D++V  + +P ++    +  W   H     CK+  ++   ++  + + ++ IA+DR   I  PL    T  +A+  +L +  +S+ + +  A ++  +   P + N T  +   VC+E ++            ++Y +I HS  FI++ +A +   A+ Y +I +      I      L+   KR S +   ++   S E    P   A L   K +             K+A +L VV +V+ L + P+ ++   K V F +                        +AANPI+Y F++  FR      F   LP  
Sbjct:   63 GNTLVCLAVWR---NHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHA---LCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRT--RLFSVCDE-RWAD----------DLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGE--PQPRARAFLAEVKQMRA---------RRKTAKMLMVVLLVFALCYLPISVLNVLKRV-FGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGL 380          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: HCRTR1 (hypocretin receptor 1 [Source:HGNC Symbol;Acc:HGNC:4848])

HSP 1 Score: 56.6102 bits (135), Expect = 3.678e-8
Identity = 79/349 (22.64%), Postives = 146/349 (41.83%), Query Frame = 3
Query:  162 GNILVLLVYYRKRGSEQNNETDCFFINSLALSDLIVCLVIVPCTM----STEWYNFHISLYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPLRKILTVNKAKXXXXXXXXXXXXXXXXXATLVGQN---PHIHNSTVPQKTEVCEEIKFHKNVINEVLIYYEVYERITHSV-FILSIIAVIICYALVYVEIIK------IRKREKTLLFKHKRESKKTKSVDMSTSSEAYSSPGEIALLTPRKSLAQGLRDSALFRNIKSAAILFVVAVVYILVFTPVILIITFKVVKFNVIXXXXXXXX---------------XAANPIVYCFMNSNFRRDLSKLFRRHLPNF 1121
            GN LV L  +R   +        +FI +L+L+D++V  + +P ++    +  W   H     CK+  ++   ++  + + ++ IA+DR   I  PL    T  +A+  +L +  +S+ + +  A ++  +   P + N T  +   VC+E ++            ++Y +I HS  FI++ +A +   A+ Y +I +      I      L+   KR S +   ++   S E    P   A L   K +             K+A +L VV +V+ L + P+ ++   K V F +                        +AANPI+Y F++  FR      F   LP  
Sbjct:   63 GNTLVCLAVWR---NHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHA---LCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRT--RLFSVCDE-RWAD----------DLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGE--PQPRARAFLAEVKQMRA---------RRKTAKMLMVVLLVFALCYLPISVLNVLKRV-FGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGL 380          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: GHSR (growth hormone secretagogue receptor [Source:HGNC Symbol;Acc:HGNC:4267])

HSP 1 Score: 53.1434 bits (126), Expect = 3.003e-7
Identity = 53/223 (23.77%), Postives = 107/223 (47.98%), Query Frame = 3
Query:  162 GNILVLLVYYRKRGSEQNNETDCFFINSLALSDLIVCLVIVPCTMSTEW----YNFHISLYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPLRKILTVNKAKXXXXXXXXXXXXXXXXXATLVGQNPHIHNSTVPQKTEVCEEIKFH-KNVINEVLIYYEVYERITHSVFILSIIAVIICYALVYVEIIKIRKREKTLLFKHKRESKKTKSVDMSTSSE 815
            GN+L +LV  R R  E    T+  +++S+A SDL++ L + P  +   W    +NF   L  CKL+ F++ +    + + I  ++V+R   I  PLR  + V K ++ ++I ++ ++     G   V       N T P  T  C   +F  ++ +  V+++      ++   F L +  + + Y+L+  ++ + R+R   ++    R+    ++V M   S+
Sbjct:   60 GNLLTMLVVSRFR--ELRTTTN-LYLSSMAFSDLLIFLCM-PLDLVRLWQYRPWNFGDLL--CKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFVLVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVW------VSSIFFFLPVFCLTVLYSLIGRKLWR-RRRGDAVVGASLRDQNHKQTVKMLGGSQ 269          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: GHSR (growth hormone secretagogue receptor [Source:HGNC Symbol;Acc:HGNC:4267])

HSP 1 Score: 52.373 bits (124), Expect = 8.262e-7
Identity = 51/218 (23.39%), Postives = 104/218 (47.71%), Query Frame = 3
Query:  162 GNILVLLVYYRKRGSEQNNETDCFFINSLALSDLIVCLVIVPCTMSTEW----YNFHISLYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPLRKILTVNKAKXXXXXXXXXXXXXXXXXATLVGQNPHIHNSTVPQKTEVCEEIKFH-KNVINEVLIYYEVYERITHSVFILSIIAVIICYALVYVEIIKIRKREKTLLFKHKRESKKTKSVDM 800
            GN+L +LV  R R   +   T   +++S+A SDL++ L + P  +   W    +NF   L  CKL+ F++ +    + + I  ++V+R   I  PLR  + V K ++ ++I ++ ++     G   V       N T P  T  C   +F  ++ +  V+++      ++   F L +  + + Y+L+  ++ + R+R   ++    R+    ++V M
Sbjct:   60 GNLLTMLVVSRFR---ELRTTTNLYLSSMAFSDLLIFLCM-PLDLVRLWQYRPWNFGDLL--CKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFVLVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVW------VSSIFFFLPVFCLTVLYSLIGRKLWR-RRRGDAVVGASLRDQNHKQTVKM 264          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: OXTR (oxytocin receptor [Source:HGNC Symbol;Acc:HGNC:8529])

HSP 1 Score: 50.0618 bits (118), Expect = 4.554e-6
Identity = 61/281 (21.71%), Postives = 115/281 (40.93%), Query Frame = 3
Query:  162 GNILVLLVYYRKRGSEQNNETDCFFINSLALSDLIVCLV-IVPCTMSTEWYNFHISLYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPLRKILTVNKAKXXXXXXXXXXXXXXXXXATLVGQNPHIHNSTVPQKTEVCEEIKFHKNVINEVLIYYEVYERITHSVFILSIIAVIICYALVYVEIIKIRKREKTLLFKHKRESKKTKSVDMSTSSEAYSSPGEIALLTPRKSLAQGLRDSALFRNIKSAAILFVVAVVYILVFTPVILIITFKVVKFN 1001
            GN  VLL     R + Q +    FF+  L+++DL+V +  ++P  +    + F+     C+L  ++    +  ST L+ L+++DRCL I  PLR +                  +L      LV   P +H  ++    EV + +     V  +          IT +V+I+ +I +  CY L+  +I +   R KT         +   + D    + A  S   + L++  K              I++  + F++ + +I+ +TP   +  + V   N
Sbjct:   56 GNACVLLAL---RTTRQKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQVVGMFASTYLLLLMSLDRCLAICQPLRSL----------RRRTDRLAVLATWLGCLVASAPQVHIFSL---REVADGVFDCWAVFIQPWGPKAYITWITLAVYIVPVIVLAACYGLISFKIWQ-NLRLKTAAAAAAEAPEGAAAGDGGRVALARVS--SVKLISKAK--------------IRTVKMTFIIVLAFIVCWTPFFFVQMWSVWDAN 303          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: npr-11 (Putative neuropeptide Y receptor 11 [Source:UniProtKB/Swiss-Prot;Acc:Q18179])

HSP 1 Score: 49.6766 bits (117), Expect = 2.183e-6
Identity = 32/75 (42.67%), Postives = 41/75 (54.67%), Query Frame = 3
Query:  222 TDCFFINSLALSDLIVCLVIVPCTMSTEWYNFH-ISLYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPLRK 443
            T  FFI +LALSD  VC+V  P T+ T  Y F   S   CK+   +   N+  ST  IA IAVDR + I  P ++
Sbjct:   73 TRNFFILNLALSDFFVCIVTAPTTLYTVLYMFWPFSRTLCKIAGSLQGFNIFLSTFSIASIAVDRYVLIIFPTKR 147          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: si:ch73-160i9.3 (si:ch73-160i9.3 [Source:ZFIN;Acc:ZDB-GENE-141212-252])

HSP 1 Score: 51.2174 bits (121), Expect = 1.107e-6
Identity = 45/181 (24.86%), Postives = 81/181 (44.75%), Query Frame = 3
Query:  216 NETDCFFINSLALSDLIVCLVIVPCTMSTEWYNFH-ISLYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPL--RKILTVNKAKXXXXXXXXXXXXXXXXXATLVGQNPHIHNSTVPQKTEVCEEIKFHKNVINEVLIYYEVYERITHSVFILSIIAVIICYALVYVEIIKIRKREKT 749
            N T+ + +N LA +DLI CL  +   +S  ++++    L+ CK   F   AN+  S  L+A+I+VDR LC+  P+  RK  TV  A+        +  +   + A ++     ++    P K  +  +          +  Y   + R     F+L  + + ICY +  + I + R   K+
Sbjct:   63 NVTNVWLVN-LAAADLIFCLARISSLISKIFFDYWPFGLFLCKFNGFFKYANMFCSVFLLAVISVDRALCVWRPVFTRKRRTVCAAR--------VVSVGVWIMAVILSSPYFVYRQVFPDKNNL-SQCSLKAKGAGHLDKYVYHFVRFICG-FLLPFLVIFICYTMAAIGIRRTRLSGKS 232          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: htr2b (5-hydroxytryptamine (serotonin) receptor 2B, G protein-coupled [Source:ZFIN;Acc:ZDB-GENE-081022-57])

HSP 1 Score: 49.2914 bits (116), Expect = 5.966e-6
Identity = 36/107 (33.64%), Postives = 65/107 (60.75%), Query Frame = 3
Query:  162 GNILVLLVYYRKRGSEQNNETDCFFINSLALSDLIVCLVIVPCTMSTEWYN--FHISLYFCKLYYFMNTANLLFST---MLIALIAVDRCLCITLPLRKILTVNKAK 467
            GNILV+L    +R  +  N T+ FF+ SLA++DL+V L+++P  + T  YN  + ++ + C ++ F+   ++LFST   M +  I++DR + I  P++     ++AK
Sbjct:   31 GNILVILAVSLER--KLQNATN-FFLMSLAVADLLVGLLVMPIALVTVLYNSTWPLADFLCPIWLFL---DVLFSTASIMHLCAISLDRYIAIKKPIQHSQFKSRAK 131          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: si:ch73-160i9.1 (si:ch73-160i9.1 [Source:ZFIN;Acc:ZDB-GENE-141212-254])

HSP 1 Score: 48.9062 bits (115), Expect = 6.942e-6
Identity = 47/185 (25.41%), Postives = 87/185 (47.03%), Query Frame = 3
Query:  210 QNNETDCFFINSLALSDLIVCLVIVPCTMSTEWYNFH-ISLYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPL--RKILTVNKAKXXXXXXXXXXXXXXXXXATLVGQNPH-IHNSTVPQKTEVCE-EIKFHKNVINEVLIYYEVYERITHSVFILSIIAVIICYALVYVEIIKIRKREKT 749
            ++N T  + +N LA++DLI CL  +   +S  ++++    ++ CK   F+  AN+  S  L+A+I+VDR LCI  P   R+  TV  A+          + +G+    ++  +P+ ++    P K  +    +K + +    +   Y  Y       F+L  + + ICY L  + I + R   K 
Sbjct:   53 KSNVTKVWLVN-LAVADLIFCLTRISSLISKVFFDYWPFGVFLCKFNGFIKYANMFCSVFLLAVISVDRALCIWHPFFTRERRTVCAAR---------VVSVGVWIVAVIFSSPYFVYRQVFPGKNNLSHCSLKVNGSSETGISTKYVYYFIRFICGFLLPFLIIFICYTLAAIGIRRSRLSRKA 227          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-211g8.1 (si:dkey-211g8.1 [Source:ZFIN;Acc:ZDB-GENE-060503-436])

HSP 1 Score: 48.9062 bits (115), Expect = 7.067e-6
Identity = 50/186 (26.88%), Postives = 83/186 (44.62%), Query Frame = 3
Query:  216 NETDCFFINSLALSDLIVCLVIVPCTMSTEWYN-FHISLYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPL--RKILTVNKAKXXXXXXXXXXXXXXXXXATLVGQNPHIHNSTVPQKTEVCEEIKFHKNVINEV-----LIYYEVYERITHSVFILSIIAVIICYALVYVEIIKIRKREKT 749
            N T+ F +N LA +DLI CL  +   +   +++ +   L+ CK   F+  AN+  S  L+A+I+VDR LC+  P+  RK  TV  A+        +  +   + A +      ++    P K     +  F  N   E       +YY  + R     F+L  + + ICY L  + I + R   K+
Sbjct:   60 NVTNVFLVN-LAAADLIFCLTQISWLIKDIFFDHWPFGLFVCKFNGFVKYANMFCSVFLLAVISVDRALCVWCPVFTRKRRTVCAAR--------MVSVGVWIMAGIFSLPYFVYRQVFPDKKNF-SQCFFKVNETAEGNNSAKYVYY--FIRFICG-FLLPFLVIFICYTLAAIGIRRTRLSGKS 232          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Match: HCRTR2 (hypocretin (orexin) receptor 2 [Source:NCBI gene;Acc:100495420])

HSP 1 Score: 49.6766 bits (117), Expect = 5.849e-6
Identity = 79/334 (23.65%), Postives = 150/334 (44.91%), Query Frame = 3
Query:  162 GNILVLLVYYRKRGSEQNNETDCFFINSLALSDLIVCLVIVPCTMS---TEWYNFHISLYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPLRKILTVNKAKXXXXXXXXXXXXXXXXXATLVGQN---PHIHNSTVPQKTEVCEEIKFHKNVINEVLIYYEVYERITHSVFILSIIAVIICYA-LVYVEIIKIRKREKTLLFKHKRESKKTKSVDMSTSSEAYSSPGEIALLTPRKSLAQGLRDSALFRNIKSAAILFVVAVVYILVFTPVILIITFK--------------VVKFNVIXXXXXXXXXAANPIVYCFMNSNFRRDLSKLF 1100
            GNILV +  ++   +        +FI +L+L+D++V ++ +P T+    TE + F  +L  CK+  ++ T ++  S + ++ IA+DR   I  PL    T  +A+  ++I+ ++S  + I  A ++      P + N T+     VC+E ++            ++Y ++ H  F      V +C   L Y++I + +   + +        KK K +  S  S+   S       T  ++ A       +    K+A +L VV +V+ L + P+ ++   K              V  +    + L Y N+AANPI+Y F++  FR +    F
Sbjct:   69 GNILVCVAVWK---NHHMRTVTNYFIVNLSLADVLVTIICLPATLLVDITETWFFGKTL--CKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRAQQSIVIIWIVSCAIMIPQAIVMECRSVFPELANKTI--LFTVCDE-RWEG----------QIYSKVYHICFFCITYMVPLCLMILAYLQIFR-KLWCRQIPGTSSVVQKKWKPLQCSIQSKGQQS-------TKSRNNAVAAEIKQIHARRKTARMLMVVLLVFALCYLPISILNILKRVFGMFTHTNDRETVYAWFTFSHWLVYANSAANPIIYNFLSGKFREEFKAAF 376          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Hcrtr1 (hypocretin (orexin) receptor 1 [Source:MGI Symbol;Acc:MGI:2385650])

HSP 1 Score: 55.4546 bits (132), Expect = 5.955e-8
Identity = 82/348 (23.56%), Postives = 150/348 (43.10%), Query Frame = 3
Query:  162 GNILVLLVYYRKRGSEQNNETDCFFINSLALSDLIVCLVIVPCTMS---TEWYNFHISLYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPLRKILTVNKAKXXXXXXXXXXXXXXXXXATLVGQN---PHIHNSTVPQKTEVCEEIKFHKNVINEVLIYYEVYERITHSV-FILSIIAVIICYALVYVEII-KIRKRE-----KTLLFKHKRESKKTKSVDMSTSSEAYSSPGEIALLTPRKSLAQGLRDSALFRNIKSAAILFVVAVVYILVFTPVILIITFKVVKFNVIXXXXXXXX---------------XAANPIVYCFMNSNFRRDLSKLFRRHLPNF 1121
            GN LV L  +R   +        +FI +L+L+D++V  + +P ++    TE + F  +L  CK+  ++   ++  + + ++ IA+DR   I  PL    T  +A+  +L +  +S+ + +  A ++  +   P + N T  +   VC+E               E+Y +I HS  FI++ +A +   A+ Y +I  K+  R+       L+   KR S++ ++      +E    P   A L   K +             K+A +L VV +V+ L + P+ ++   K V F +                        +AANPI+Y F++  FR      F   LP  
Sbjct:   63 GNTLVCLAVWR---NHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGQAL--CKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAVMVPQAAVMECSSVLPELANRT--RLFSVCDEHWAD-----------ELYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSEQLEAQHQGLCTE--PQPRARAFLAEVKQMRA---------RRKTAKMLMVVLLVFALCYLPISVLNVLKRV-FGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGL 380          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Hcrtr1 (hypocretin (orexin) receptor 1 [Source:MGI Symbol;Acc:MGI:2385650])

HSP 1 Score: 55.4546 bits (132), Expect = 5.955e-8
Identity = 82/348 (23.56%), Postives = 150/348 (43.10%), Query Frame = 3
Query:  162 GNILVLLVYYRKRGSEQNNETDCFFINSLALSDLIVCLVIVPCTMS---TEWYNFHISLYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPLRKILTVNKAKXXXXXXXXXXXXXXXXXATLVGQN---PHIHNSTVPQKTEVCEEIKFHKNVINEVLIYYEVYERITHSV-FILSIIAVIICYALVYVEII-KIRKRE-----KTLLFKHKRESKKTKSVDMSTSSEAYSSPGEIALLTPRKSLAQGLRDSALFRNIKSAAILFVVAVVYILVFTPVILIITFKVVKFNVIXXXXXXXX---------------XAANPIVYCFMNSNFRRDLSKLFRRHLPNF 1121
            GN LV L  +R   +        +FI +L+L+D++V  + +P ++    TE + F  +L  CK+  ++   ++  + + ++ IA+DR   I  PL    T  +A+  +L +  +S+ + +  A ++  +   P + N T  +   VC+E               E+Y +I HS  FI++ +A +   A+ Y +I  K+  R+       L+   KR S++ ++      +E    P   A L   K +             K+A +L VV +V+ L + P+ ++   K V F +                        +AANPI+Y F++  FR      F   LP  
Sbjct:   63 GNTLVCLAVWR---NHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGQAL--CKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAVMVPQAAVMECSSVLPELANRT--RLFSVCDEHWAD-----------ELYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSEQLEAQHQGLCTE--PQPRARAFLAEVKQMRA---------RRKTAKMLMVVLLVFALCYLPISVLNVLKRV-FGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGL 380          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Hcrtr1 (hypocretin (orexin) receptor 1 [Source:MGI Symbol;Acc:MGI:2385650])

HSP 1 Score: 55.4546 bits (132), Expect = 5.955e-8
Identity = 82/348 (23.56%), Postives = 150/348 (43.10%), Query Frame = 3
Query:  162 GNILVLLVYYRKRGSEQNNETDCFFINSLALSDLIVCLVIVPCTMS---TEWYNFHISLYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPLRKILTVNKAKXXXXXXXXXXXXXXXXXATLVGQN---PHIHNSTVPQKTEVCEEIKFHKNVINEVLIYYEVYERITHSV-FILSIIAVIICYALVYVEII-KIRKRE-----KTLLFKHKRESKKTKSVDMSTSSEAYSSPGEIALLTPRKSLAQGLRDSALFRNIKSAAILFVVAVVYILVFTPVILIITFKVVKFNVIXXXXXXXX---------------XAANPIVYCFMNSNFRRDLSKLFRRHLPNF 1121
            GN LV L  +R   +        +FI +L+L+D++V  + +P ++    TE + F  +L  CK+  ++   ++  + + ++ IA+DR   I  PL    T  +A+  +L +  +S+ + +  A ++  +   P + N T  +   VC+E               E+Y +I HS  FI++ +A +   A+ Y +I  K+  R+       L+   KR S++ ++      +E    P   A L   K +             K+A +L VV +V+ L + P+ ++   K V F +                        +AANPI+Y F++  FR      F   LP  
Sbjct:   63 GNTLVCLAVWR---NHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGQAL--CKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAVMVPQAAVMECSSVLPELANRT--RLFSVCDEHWAD-----------ELYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSEQLEAQHQGLCTE--PQPRARAFLAEVKQMRA---------RRKTAKMLMVVLLVFALCYLPISVLNVLKRV-FGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGL 380          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Hcrtr1 (hypocretin (orexin) receptor 1 [Source:MGI Symbol;Acc:MGI:2385650])

HSP 1 Score: 55.4546 bits (132), Expect = 5.955e-8
Identity = 82/348 (23.56%), Postives = 150/348 (43.10%), Query Frame = 3
Query:  162 GNILVLLVYYRKRGSEQNNETDCFFINSLALSDLIVCLVIVPCTMS---TEWYNFHISLYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPLRKILTVNKAKXXXXXXXXXXXXXXXXXATLVGQN---PHIHNSTVPQKTEVCEEIKFHKNVINEVLIYYEVYERITHSV-FILSIIAVIICYALVYVEII-KIRKRE-----KTLLFKHKRESKKTKSVDMSTSSEAYSSPGEIALLTPRKSLAQGLRDSALFRNIKSAAILFVVAVVYILVFTPVILIITFKVVKFNVIXXXXXXXX---------------XAANPIVYCFMNSNFRRDLSKLFRRHLPNF 1121
            GN LV L  +R   +        +FI +L+L+D++V  + +P ++    TE + F  +L  CK+  ++   ++  + + ++ IA+DR   I  PL    T  +A+  +L +  +S+ + +  A ++  +   P + N T  +   VC+E               E+Y +I HS  FI++ +A +   A+ Y +I  K+  R+       L+   KR S++ ++      +E    P   A L   K +             K+A +L VV +V+ L + P+ ++   K V F +                        +AANPI+Y F++  FR      F   LP  
Sbjct:   63 GNTLVCLAVWR---NHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGQAL--CKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAVMVPQAAVMECSSVLPELANRT--RLFSVCDEHWAD-----------ELYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSEQLEAQHQGLCTE--PQPRARAFLAEVKQMRA---------RRKTAKMLMVVLLVFALCYLPISVLNVLKRV-FGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGL 380          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Ghsr (growth hormone secretagogue receptor [Source:MGI Symbol;Acc:MGI:2441906])

HSP 1 Score: 51.2174 bits (121), Expect = 1.324e-6
Identity = 52/218 (23.85%), Postives = 104/218 (47.71%), Query Frame = 3
Query:  162 GNILVLLVYYRKRGSEQNNETDCFFINSLALSDLIVCLVIVPCTMSTEW----YNFHISLYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPLRKILTVNKAKXXXXXXXXXXXXXXXXXATLVGQNPHIHNSTVPQKTEVCEEIKFH-KNVINEVLIYYEVYERITHSVFILSIIAVIICYALVYVEIIKIRKREKTLLFKHKRESKKTKSVDM 800
            GN+L +LV  R R   +   T   +++S+A SDL++ L + P  +   W    +NF   L  CKL+ F++ +    + + I  ++V+R   I  PLR  + V K ++ ++IL++ ++     G   V       N T P+ T  C   +F  ++ +  V+++      ++   F L +  + + Y+L+  ++   R+R    +    R+    ++V M
Sbjct:   59 GNLLTMLVVSRFR---ELRTTTNLYLSSMAFSDLLIFLCM-PLDLVRLWQYRPWNFGDLL--CKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVILVIWAVAFCSAGPIFVLVGVEHENGTDPRDTNECRATEFAVRSGLLTVMVW------VSSVFFFLPVFCLTVLYSLIGRKL--WRRRGDAAVGSSLRDQNHKQTVKM 262          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|O43613|OX1R_HUMAN (Orexin receptor type 1 OS=Homo sapiens OX=9606 GN=HCRTR1 PE=1 SV=2)

HSP 1 Score: 56.6102 bits (135), Expect = 1.766e-7
Identity = 79/349 (22.64%), Postives = 146/349 (41.83%), Query Frame = 3
Query:  162 GNILVLLVYYRKRGSEQNNETDCFFINSLALSDLIVCLVIVPCTM----STEWYNFHISLYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPLRKILTVNKAKXXXXXXXXXXXXXXXXXATLVGQN---PHIHNSTVPQKTEVCEEIKFHKNVINEVLIYYEVYERITHSV-FILSIIAVIICYALVYVEIIK------IRKREKTLLFKHKRESKKTKSVDMSTSSEAYSSPGEIALLTPRKSLAQGLRDSALFRNIKSAAILFVVAVVYILVFTPVILIITFKVVKFNVIXXXXXXXX---------------XAANPIVYCFMNSNFRRDLSKLFRRHLPNF 1121
            GN LV L  +R   +        +FI +L+L+D++V  + +P ++    +  W   H     CK+  ++   ++  + + ++ IA+DR   I  PL    T  +A+  +L +  +S+ + +  A ++  +   P + N T  +   VC+E ++            ++Y +I HS  FI++ +A +   A+ Y +I +      I      L+   KR S +   ++   S E    P   A L   K +             K+A +L VV +V+ L + P+ ++   K V F +                        +AANPI+Y F++  FR      F   LP  
Sbjct:   63 GNTLVCLAVWR---NHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHA---LCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRT--RLFSVCDE-RWAD----------DLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGE--PQPRARAFLAEVKQMRA---------RRKTAKMLMVVLLVFALCYLPISVLNVLKRV-FGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGL 380          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|P58307|OX1R_MOUSE (Orexin receptor type 1 OS=Mus musculus OX=10090 GN=Hcrtr1 PE=2 SV=3)

HSP 1 Score: 55.4546 bits (132), Expect = 4.165e-7
Identity = 82/348 (23.56%), Postives = 150/348 (43.10%), Query Frame = 3
Query:  162 GNILVLLVYYRKRGSEQNNETDCFFINSLALSDLIVCLVIVPCTMS---TEWYNFHISLYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPLRKILTVNKAKXXXXXXXXXXXXXXXXXATLVGQN---PHIHNSTVPQKTEVCEEIKFHKNVINEVLIYYEVYERITHSV-FILSIIAVIICYALVYVEII-KIRKRE-----KTLLFKHKRESKKTKSVDMSTSSEAYSSPGEIALLTPRKSLAQGLRDSALFRNIKSAAILFVVAVVYILVFTPVILIITFKVVKFNVIXXXXXXXX---------------XAANPIVYCFMNSNFRRDLSKLFRRHLPNF 1121
            GN LV L  +R   +        +FI +L+L+D++V  + +P ++    TE + F  +L  CK+  ++   ++  + + ++ IA+DR   I  PL    T  +A+  +L +  +S+ + +  A ++  +   P + N T  +   VC+E               E+Y +I HS  FI++ +A +   A+ Y +I  K+  R+       L+   KR S++ ++      +E    P   A L   K +             K+A +L VV +V+ L + P+ ++   K V F +                        +AANPI+Y F++  FR      F   LP  
Sbjct:   63 GNTLVCLAVWR---NHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGQAL--CKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAVMVPQAAVMECSSVLPELANRT--RLFSVCDEHWAD-----------ELYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSEQLEAQHQGLCTE--PQPRARAFLAEVKQMRA---------RRKTAKMLMVVLLVFALCYLPISVLNVLKRV-FGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGL 380          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|O97661|OX1R_PIG (Orexin receptor type 1 OS=Sus scrofa OX=9823 GN=HCRTR1 PE=2 SV=2)

HSP 1 Score: 55.0694 bits (131), Expect = 5.441e-7
Identity = 80/349 (22.92%), Postives = 144/349 (41.26%), Query Frame = 3
Query:  162 GNILVLLVYYRKRGSEQNNETDCFFINSLALSDLIVCLVIVPCTM----STEWYNFHISLYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPLRKILTVNKAKXXXXXXXXXXXXXXXXXATLVGQN---PHIHNSTVPQKTEVCEEIKFHKNVINEVLIYYEVYERITHSV-FILSIIAVIICYALVYVEIIK------IRKREKTLLFKHKRESKKTKSVDMSTSSEAYSSPGEIALLTPRKSLAQGLRDSALFRNIKSAAILFVVAVVYILVFTPVILIITFKVVKFNVIXXXXXXXX---------------XAANPIVYCFMNSNFRRDLSKLFRRHLPNF 1121
            GN LV L  +R         T+ F +N L+L+D++V  + +P ++    +  W   H     CK+  ++   ++  + + ++ IA+DR   I  PL    T  +A+  +L +  +S  + +  A ++  +   P + N T  +   VC+E ++            ++Y +I HS  FI++ +A +   A+ Y +I +      I      L+   KR S + +  D      A   P   A L   K +             K+A +L VV +V+ L + P+ ++   K V F +                        +AANPI+Y F++  FR      F   LP  
Sbjct:   63 GNTLVCLAVWRNH--HMRTVTNYFIVN-LSLADVLVTAICLPASLLVDITESWLFGHA---LCKVIPYLQAVSVSVAVLTLSFIALDRWYAIYHPLLFKSTARRARGSILGIWAVSPAVMVPQAAVMECSSVLPELANRT--RLFSVCDE-RWAD----------DLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSDQLE--DQGQGPGAEPPPRARAFLAEVKQMRA---------RRKTAKMLMVVLLVFALCYLPISVLNVLKRV-FGMFRQTSDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGL 380          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|A5A4K9|GHSR_RABIT (Growth hormone secretagogue receptor type 1 OS=Oryctolagus cuniculus OX=9986 GN=GHSR PE=2 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 5.847e-7
Identity = 55/217 (25.35%), Postives = 103/217 (47.47%), Query Frame = 3
Query:  162 GNILVLLVYYRKRGSEQNNETDCFFINSLALSDLIVCLVIVPCTMSTEW----YNFHISLYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPLRKILTVNKAKXXXXXXXXXXXXXXXXXATLVGQNPHIHNSTVPQKTEVCEEIKFHKNVINEVLIYYEVYERITHSVFILSIIAVIICYALVYVEIIKIRKREKTLLFKHKRESKKTKSVDM 800
            GN+L +LV  R R   +   T   +++S+A SDL++ L + P  +   W    +NF   L  CKL+ F++ +    + + I  ++V+R   I  PLR  + V K ++ ++IL++ ++     G   V       N T PQ T  C   +F    +   L+   V+  ++   F L +  + + Y+L+  ++ + RKR    +    R+    ++V M
Sbjct:   60 GNLLTMLVVSRFR---ELRTTTNLYLSSMAFSDLLIFLCM-PLDLVRLWQYRPWNFGDLL--CKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVILVIWALAFCSAGPIFVLVGVEHENGTDPQDTNECRATEF---AVRSGLLTIMVW--VSSVFFFLPVFCLTVLYSLIGRKLWR-RKRGDGAVGSSLRDQNHRQTVKM 264          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|A5A4L1|GHSR_MUSPF (Growth hormone secretagogue receptor type 1 OS=Mustela putorius furo OX=9669 GN=GHSR PE=2 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 1.413e-6
Identity = 53/218 (24.31%), Postives = 106/218 (48.62%), Query Frame = 3
Query:  162 GNILVLLVYYRKRGSEQNNETDCFFINSLALSDLIVCLVIVPCTMSTEW----YNFHISLYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPLRKILTVNKAKXXXXXXXXXXXXXXXXXATLVGQNPHIHNSTVPQKTEVCEEIKFH-KNVINEVLIYYEVYERITHSVFILSIIAVIICYALVYVEIIKIRKREKTLLFKHKRESKKTKSVDM 800
            GN+L +LV  R R   +   T   +++S+A SDL++ L + P  +   W    +NF   L  CKL+ F++ +    + + I  ++V+R   I  PLR  + V K ++ ++IL++ ++     G   V       N T P+ T  C   +F  ++ +  V+++      ++   F L +  + + Y+L+  ++ + RKR +  +    R+    ++V M
Sbjct:   60 GNLLTMLVVSRFR---ELRTTTNLYLSSMAFSDLLIFLCM-PLDLVRLWQYRPWNFGDLL--CKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVILVIWAVAFCSAGPIFVLVGVEHENGTDPRDTNECRATEFAVRSGLLTVMVW------VSSVFFFLPVFCLTVLYSLIGRKLWR-RKRGEAAVGASLRDQNHKQTVKM 264          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A193KUN5 (GCR056 OS=Schmidtea mediterranea OX=79327 GN=gcr056 PE=2 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 1.172e-35
Identity = 108/341 (31.67%), Postives = 193/341 (56.60%), Query Frame = 3
Query:  165 NILVLLVYYRKRGSEQNNETDCFFINSLALSDLIVCLVIVPCTMSTEWYNFHISL-YFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPLRKILTVNKAKXXXXXXXXXXXXXXXXXATLV-----GQNPHIHNSTVPQKTEVCEEIKFHKNVINEVLIYYEVYERITHSVFILSIIAVIICYALVYVEIIKIRKREKTL-----------LFKHKRESKKTKSVDMSTSSEAYSSPGEIA--LLTP------RKSLAQGLRDSALFRNIKSAAILFVVAVVYILVFTPVILIITFKVVKFNVIXXXXXXXXXAANPIVYCFMNSNFRRDLSKLFRRHL 1112
            N+LVL++Y +KR     N+    FI +LA+SD IVCLVI+P T+  E+ ++ +S+   CK YYF+N +++ F  +LI LIA+DR  C+  P   ++TV ++K+ + I+ ++S++LG++    V      +N    NST+ Q    C ++  + N     L+++ + +R     + + I  VI  Y L+Y  ++   +++  L           L+    +S+  K ++  ++++  S P +    L+T        K++ +  +++ L +N K+A +LFVVA+ YI+ F P  L++    +  N+ ++ +YY+NNAANPI+YCFMN NFR D+   F +HL
Sbjct:   30 NLLVLIIYSQKRDKSTANQ----FIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFMMSVVLGVLSVFQVKTFKLSKNSTNMNSTLIQSE--CIDVSRYANPTKYELLFFTIVQRSQLISYAICICVVICLYILIYRFVLAAARKKARLKGLNSSSTTSFLWNKFFKSRSIKRINSDSNNDDTSVPCQTTEELMTKPGPSNNDKAIKRKFKETILIQNFKTALMLFVVAITYIVTFLPACLMVN-SSLALNLPVFYMYYINNAANPIIYCFMNKNFREDVVNFFHQHL 363          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A193KUC8 (GCR109 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=gcr109 PE=2 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 1.935e-35
Identity = 117/336 (34.82%), Postives = 178/336 (52.98%), Query Frame = 3
Query:   78 LSNESESPIEQXXXXXXXXXXXXXXXXXGNILVLLVYYRKRGSEQNNETDCFFINSLALSDLIVCLVIVPCTMSTEWYNFHISLYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPLRKILTVNKAKXXXX-----XXXXXXXXXXXXXATLVGQNP--HIHNSTVPQKTEVCEEIKFHKNVINEVLIYYEVYERITHSVFILSIIAVIICYALVYVEIIKIRKREKTLLF------KHKRESKKTKSVDMSTSSEAYSSPGEIALLTPR------------------KSLAQGLRDSALFRNIKSAAILFVVAVVYILVFTPVILIITFKVV 992
            +SNE   P   +  TI++L++V  VG IGN LVLLVY  KR  E N   D FFI  LA SDL VC+++VP T+  E   F IS   CK YYF+NT+NL+FST+LI +IA DR L I  PL+ IL + +AK +++      +    + +  +   L   +P  +I ++T   K  +C+EIK + N+    +I+YE+ E+  H ++  SII +I+ Y+ ++  II+ R+++    F          E +    V +      Y SP EI     R                  ++  +    S   +NI+SA++L VV   Y+L F PV+LI+ FKV+
Sbjct:    2 VSNEESIPNSHLCVTIILLSVVTVVGAIGNFLVLLVYRNKRRHENN---DIFFIIILAASDLAVCIILVPGTIYVELKAFEISEIACKSYYFLNTSNLVFSTLLILVIAFDRYLSICHPLKSILPLARAKKLVIFLFFISVTQGILAMLSVKLKLSTSSPGAYISSNTSIVKKFICDEIKHNLNITKSQMIFYEIVEKSNHFLYTSSIILIILFYSSIFKVIIRFRRKDNCYKFAPHFTDDFTTEYQPKSFVSLPKPRPKYLSP-EIETSKWRICCQNDFKTEFKREHFSNRNTDKKFERSKFLQNIRSASLLSVVTGAYVLSFLPVLLIVAFKVI 333          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A193KUG2 (GCR036 OS=Schmidtea mediterranea OX=79327 GN=gcr036 PE=2 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 6.613e-34
Identity = 111/339 (32.74%), Postives = 185/339 (54.57%), Query Frame = 3
Query:  162 GNILVLLVYYRKRGSEQNNETDCFFINSLALSDLIVCLVIVPCTMSTEWYNFHIS-LYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPLRKILTVNKAKXXXXXXXXXXXXXXXXXATLVGQNPHIHNSTVPQKTEVCEEIKFHKNVINEVLIYYEVYERITHSVFILSIIAVIICYALVYVEIIKIRKREKTLL----------FKHKRESKKTKSVDMSTS-----------SEAYSSPGEIALLT-----PRKSLAQGLRDSALFRNIKSAAILFVVAVVYILVFTPVILIITFKVVKFNVIXXXXXXXXXAANPIVYCFMNSNFRRDLSKL 1097
            GN LV++VY RK     +  T   FIN LA++D   C+ I+P T+  E++ + IS  + CKLYYF N   + FS  LI+LIA+DR +CI  P  K +T+ K+K+ + ++L +S++LGI     V     IH + +    E C +I    N      +++ + ++I    +   II VI  Y  +Y ++++ R R+K++L          +  +  S  T   D+  +           S A S+P   + LT      R+   + + D+ +F+N ++AA+L VVA++YI+ F P  L+I +  + + + L+ +YY+NNAANPI+YCFMN+ FR D+  +
Sbjct:   39 GNGLVIIVYTRK----HDQLTTTLFINILAITDCFTCITIIPMTIYIEYWEWGISSAFLCKLYYFFNNCTIPFSAFLISLIAIDRYICICHPFNKFMTLFKSKVSVGLVLTVSVLLGIASTFQVKMIKGIHPNDLTNSYE-CADISKLTNTTTTEKLFFSIVQKIQLLSYTTCIILVICLYVAIYCKVLQTR-RKKSILKGIKNVKKPSYLWESRSNLTNVPDLDENPIKLPDGDTMLSSAKSTPNSKSFLTVPKPEHRRVSLRSICDTQIFQNFRTAAMLSVVALMYIISFLPAFLMINYPQILY-IPLFYMYYINNAANPIIYCFMNARFREDIKAI 370          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A0R3TSS3 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS10712 PE=3 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 1.458e-30
Identity = 107/306 (34.97%), Postives = 166/306 (54.25%), Query Frame = 3
Query:  201 GSEQNNETDCFFINSLALSDLIVCLVIVPCTMSTEWYNFHISL-YFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPLRKILTVNKAKXXXXXXXXXXXXXXXXXATLVGQNPHIHNSTVPQKTEVCEEIKFHKNVINEVLIYYEVYERITHSVFILSIIAVIICYALVYVEIIKIRKREKTLLFKHK--RESKKTKSVDMSTSSEAYSSPGEIALLTPRKSLAQGLRDSA--LFRNIKSAAILFVVAVVYILVFTPVILIITFKVVKFNVIXXXXXXXXXAANPIVYCFMNSNFRRDLSKLFR 1103
            G+   ++T  FF+  LA+SDL VC++I+P T++ E + + IS+   CK++Y    AN  FS++LI+ +A+DR L I   L+ ILT+ +AK++   L L S+ +GI     VG         V     +C+EI+F   + +       V +   H+ F+ SI+ VI+ Y+ V+  I+  R R   L       R+S K  + D  +SS    S         R S+    R  A   F+N++SA +LFV+AVVYIL F    LII    +K N++L  LYY+N+AANP +Y     +FR+ ++ LFR
Sbjct:   78 GAFGRDKTLDFFVLVLAISDLFVCVIIIPSTITIELFKYRISIDLLCKMFYVFLVANTTFSSLLISTVALDRYLFICHSLKHILTLIRAKVIGTTLALFSLGVGIAAGCAVGIKTEDDGEVVQH---ICDEIEFIDGISHLQRRLSRVIKYFNHACFLASILIVIVLYSRVFWAIVVTRSRSHKLSVSVSIHRQSGKKSAYDSKSSSNGKDSRHR------RTSIPSRFRQKAHFTFQNLRSAIMLFVIAVVYILTFVTS-LIIANGWIKMNLVLLYLYYINSAANPCIYAIFTPSFRQTVATLFR 373          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A068Y9W8 (Orexin receptor type 2 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000897300 PE=3 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 1.690e-30
Identity = 112/323 (34.67%), Postives = 182/323 (56.35%), Query Frame = 3
Query:  189 YRKRGS---EQNNETDCF--------FINSLALSDLIVCLVIVPCTMSTEWYNFHISL-YFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPLRKILTVNKAKXXXXXXXXXXXXXXXXXATLVGQNPHIHNSTVPQKTE--VCEEIKFHKNVINEVLIYYEVYERITHSVFILSIIAVIICYALVYVEIIKIRKREKTLLFKHKRESKKTKSVDMSTSSEAYS--SPGEIALLTPRKSLAQGLRDSALF--RNIKSAAILFVVAVVYILVFTPVILIITFKVVKFNVIXXXXXXXXXAANPIVYCFMNSNFRRDLSKLFR 1103
            YR+R      +N+ET  F        FI  LA+SDL+VC+VI+P T++ E + F IS+   CKL+Y +   N  FS++LI+ +A+DR L I   L+ ILT+ +AKI++  L L S+ +GI   ++VG     HN+T    T   +CEE ++ + +        ++ + + H+ ++  I+ V+I Y+ V+  I+  R R + L    ++  +  ++  ++  S A S  S   IA L P K     LR  A F  +N++SA +LF++A+VYIL F P  L+I       N++L  LYY+N+AANP +Y     +FR+ ++ LFR
Sbjct:   66 YRRRNQFNIPENSETGAFDRDKTLDFFILVLAVSDLLVCVVIIPSTITMEIHQFRISVDVLCKLFYVLFVTNTTFSSLLISAVALDRYLFICHSLKHILTLIRAKILVSTLALFSLCVGIAAGSVVGVKAIHHNATEDNVTTNYICEENEYVREISELQKTVSQIIKYLNHACYLACILIVLILYSCVFWAIVTSRSRSQKLTMSSQKSRQNGRNSSLTGKSTANSRMSRQRIANL-PAK-----LRQKAQFTLQNLRSALMLFIIALVYILTFVPS-LVIANGWAPQNLVLLYLYYVNSAANPCIYAIFTPSFRQMVAVLFR 381          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: si:ch73-160i9.3 (C3a anaphylatoxin chemotactic receptor-like [Source:NCBI gene;Acc:103032193])

HSP 1 Score: 51.6026 bits (122), Expect = 8.113e-7
Identity = 48/186 (25.81%), Postives = 86/186 (46.24%), Query Frame = 3
Query:  210 QNNETDCFFINSLALSDLIVCLVIVPCTMSTEWYN-FHISLYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPL--RKILTVNKAKXXXXXXXXXXXXXXXXXATLVGQNPHIHNSTVPQKTEVCE---EIKFHKNVINEVLIYYEVYERITHSVFILSIIAVIICYALVYVEIIKIRKREKT 749
            + N T+ + +N LA++DLI CL  V   +   +Y+ +   L+ CK   F   AN+  S  L+A+I++DR +C+ LP+  R+  TV  A+        L  +   + A L     +++      K  + +   E+K      N   +   +Y       F+L  + ++ CYAL  + I + R   K+
Sbjct:   63 KANVTNVWLVN-LAVADLIFCLTRVTSLIKKLFYDHWPFGLFLCKFNGFFKYANMFCSVFLLAVISLDRAICVWLPVFTRQRRTVRAAR--------LVSLGVWIVAGLFSSPYYVYRQVYIGKNNLSKCSLEVKEQTEGDNTAKL--ALYSIRFSCGFLLPFLVILTCYALAGIGIRRTRISRKS 237          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: si:ch73-160i9.3 (C3a anaphylatoxin chemotactic receptor-like [Source:NCBI gene;Acc:103032193])

HSP 1 Score: 51.6026 bits (122), Expect = 8.113e-7
Identity = 48/186 (25.81%), Postives = 86/186 (46.24%), Query Frame = 3
Query:  210 QNNETDCFFINSLALSDLIVCLVIVPCTMSTEWYN-FHISLYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPL--RKILTVNKAKXXXXXXXXXXXXXXXXXATLVGQNPHIHNSTVPQKTEVCE---EIKFHKNVINEVLIYYEVYERITHSVFILSIIAVIICYALVYVEIIKIRKREKT 749
            + N T+ + +N LA++DLI CL  V   +   +Y+ +   L+ CK   F   AN+  S  L+A+I++DR +C+ LP+  R+  TV  A+        L  +   + A L     +++      K  + +   E+K      N   +   +Y       F+L  + ++ CYAL  + I + R   K+
Sbjct:   63 KANVTNVWLVN-LAVADLIFCLTRVTSLIKKLFYDHWPFGLFLCKFNGFFKYANMFCSVFLLAVISLDRAICVWLPVFTRQRRTVRAAR--------LVSLGVWIVAGLFSSPYYVYRQVYIGKNNLSKCSLEVKEQTEGDNTAKL--ALYSIRFSCGFLLPFLVILTCYALAGIGIRRTRISRKS 237          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: si:ch73-160i9.3 (C3a anaphylatoxin chemotactic receptor-like [Source:NCBI gene;Acc:103032193])

HSP 1 Score: 51.2174 bits (121), Expect = 1.108e-6
Identity = 48/186 (25.81%), Postives = 86/186 (46.24%), Query Frame = 3
Query:  210 QNNETDCFFINSLALSDLIVCLVIVPCTMSTEWYN-FHISLYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPL--RKILTVNKAKXXXXXXXXXXXXXXXXXATLVGQNPHIHNSTVPQKTEVCE---EIKFHKNVINEVLIYYEVYERITHSVFILSIIAVIICYALVYVEIIKIRKREKT 749
            + N T+ + +N LA++DLI CL  V   +   +Y+ +   L+ CK   F   AN+  S  L+A+I++DR +C+ LP+  R+  TV  A+        L  +   + A L     +++      K  + +   E+K      N   +   +Y       F+L  + ++ CYAL  + I + R   K+
Sbjct:   76 KANVTNVWLVN-LAVADLIFCLTRVTSLIKKLFYDHWPFGLFLCKFNGFFKYANMFCSVFLLAVISLDRAICVWLPVFTRQRRTVRAAR--------LVSLGVWIVAGLFSSPYYVYRQVYIGKNNLSKCSLEVKEQTEGDNTAKL--ALYSIRFSCGFLLPFLVILTCYALAGIGIRRTRISRKS 250          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO37217 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGB7])

HSP 1 Score: 55.0694 bits (131), Expect = 2.098e-8
Identity = 37/96 (38.54%), Postives = 51/96 (53.12%), Query Frame = 3
Query:  162 GNILVLLVYYRKRGSEQNNETDCFFINSLALSDLIVCLVIVPCTMSTEWYNFHISLYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPLRKIL 449
            GN+LVLLV  R+R    N+     FI +LA+SDL + LV +P     +   F  S ++CK  + M T +L  S   I L+AV RC  I  P   I+
Sbjct:   34 GNLLVLLVVKRRRARTFND----IFIFNLAVSDLCLILVCIPAFTYKKLSGFRGSQFYCKAIWPMMTISLCSSVFTITLMAVYRCKVILHPFEPII 125          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO50023 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF33])

HSP 1 Score: 49.6766 bits (117), Expect = 1.304e-6
Identity = 34/107 (31.78%), Postives = 55/107 (51.40%), Query Frame = 3
Query:  162 GNILVLLVYYRKRGSEQNNETDCFFINSLALSDLIVCLVIVPCTMSTE------WYNFHISLYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPLRKILTVNKA 464
            GNILV++     R       T+   +N +A++DL++ +  +P T ST       WY     +  CKL  F+ + ++  S + +  IAVDR   + LPLR+ +T N A
Sbjct:   37 GNILVIVTVVTNR--RMRTVTNYLIVN-MAVADLLLTVFNMPSTTSTVISPSYFWYTGEFWIAMCKLLPFIQSVSVASSVLNMTAIAVDRFFAVVLPLRRYITFNVA 140          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO40106 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S856])

HSP 1 Score: 46.9802 bits (110), Expect = 6.186e-6
Identity = 29/93 (31.18%), Postives = 49/93 (52.69%), Query Frame = 3
Query:  162 GNILVLLVYYRKRGSEQNNETDCFFINSLALSDLIVCLVIVPCTMSTEWYNFHISLYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPLR 440
            GN+LV++V   ++    N+    FFI +LA+SDL   LV +P      +  F    ++CK+ + M +  L  S   +  ++V+RC  I  PL+
Sbjct:   25 GNLLVMVVIKSRKKRSVND----FFIFNLAISDLTFVLVSLPFYTYELFLRFDKFGFYCKVVWPMMSVTLCVSIFTLTFMSVERCRAIVFPLK 113          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO42552 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S178])

HSP 1 Score: 46.9802 bits (110), Expect = 7.246e-6
Identity = 31/102 (30.39%), Postives = 52/102 (50.98%), Query Frame = 3
Query:  162 GNILVLLVYYRKRGSEQNNETDCFFINSLALSDLIVCLVIVPCTMSTEWYNFHISLYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPLRKILTVNKAK 467
            GN +V+   Y       N  T  FFI +LALSDL V ++ +P  +  E  ++      CK+++ +    L+ S M + +I++DR   +  P +K  T  +AK
Sbjct:   61 GNCIVI---YGVMQQGANKTTSSFFIANLALSDLAVLVLSLPVGLLQELASWPFGEMACKIFFPLGDVFLMVSIMTLTIISLDRLRAVVTP-KKRFTKGQAK 158          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO46030 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR08])

HSP 1 Score: 46.595 bits (109), Expect = 8.981e-6
Identity = 40/145 (27.59%), Postives = 73/145 (50.34%), Query Frame = 3
Query:  162 GNILVLLVYYRKRGSEQNNETDCFFINSLALSDLIVCLVIVPCTMSTEW--YNFHISLYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPLRKILTVNKAKXXXXXXXXXXXXXXXXXATLVGQNPHIHNSTVPQKTEVCEE 590
            GN L + V  R+R  +       +FI +LA++DL + L+ +P  +  +   Y +    + CK+ Y + T  L  S   +  ++V R   I  PLR  LTV +AK++ + + +L         ++V  +P+I+     ++T+ CEE
Sbjct:   21 GNSLTVFVIMRRRKMKTVTN---YFILNLAIADLTLTLICIPFDIPVQEMDYIWPYGPFMCKILYPLQTMCLFASVFTLTSVSVARYRAIIHPLRPQLTVKRAKVITVFIWML---------SVVPVSPYIYVLEHKEETQYCEE 153          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: CCKAR (cholecystokinin A receptor [Source:NCBI gene;Acc:101166993])

HSP 1 Score: 54.6842 bits (130), Expect = 9.206e-8
Identity = 83/341 (24.34%), Postives = 137/341 (40.18%), Query Frame = 3
Query:  162 GNILVLLVYYRKRGSEQNNETDCFFINSLALSDLIVCLVIVPCTMSTEWY-NFHISLYFCKL-YYFMNTANLLFSTMLIALIAVDRCLCITLPLRKILTVNKAKXXXXXXXXXXXXXXXXXATLVGQNPHIHNSTVPQKTEVCEEIKFHKNVINEVLIYYEVYERITHSVFILSIIAVIICYALVYVEIIKIRKREKTLLFKHKRESKKTKSVDMSTSSEAYSSPGEIALLT---------------PRKSLAQGLRDSALFRNIKSAAILFVVAVVYILVFTPVILIITFKVVKFNV-----------IXXXXXXXXXAANPIVYCFMNSNFRRDLSKLF 1100
            GN L++ V  R R       T+ F + SLA+SDL+V LV +P T+      NF   +  CKL  YFM  A +  ST  +  I+++R   I  PL   +   K+    +I            A+ +   P+   STV         IK  + V+     +   Y  +   +F++  I ++  Y L+ +E+ +  K E       +     T S+    S   Y  P +   LT                R S +  +  S L    +   +L V+  ++ L +TP+ ++  +K                  ++ L Y +   NPI+YCFMN  FR+ +   F
Sbjct:   63 GNSLIIAVLVRNR--RMRTVTNLFLL-SLAVSDLMVSLVCIPFTLIPNLMKNFIFGIGMCKLVMYFMGVA-VSVSTFNLVAISLERYSAICNPLTSRVWQTKSHAAKVITTTWV-------ASFILMLPYAIFSTVESNNS---PIKMCRLVMPNDTSFQSWYVSLLLVLFLIPGIIMMTAYGLISLELYRGIKYELPKRKSSRDRQSSTGSIKPGDSDGCYLQPSKRKSLTLGSGSFGSSSGKQAVGRVSCSSSV--SNLMAKKRVIRMLLVIVFLFFLCWTPIFVVNAWKAFDMESAHRHLTGAPISFIHLLSYTSACVNPIIYCFMNKRFRQGMLATF 387          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: opn4b (melanopsin-A-like [Source:NCBI gene;Acc:101157094])

HSP 1 Score: 50.447 bits (119), Expect = 2.036e-6
Identity = 35/103 (33.98%), Postives = 51/103 (49.51%), Query Frame = 3
Query:  162 GNILVLLVYYRKRGSEQNNETDCFFINSLALSDLIVCLVIVPCTMSTEWYNFHI-SLYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPLRKILTVNKAK 467
            GN LV+  + R R       ++ F IN LA++D ++CL   P    T  Y   I     C+LY F      + S M + +IAVDRC+ IT PL  +  ++  K
Sbjct:   77 GNFLVIYAFSRSR--SLRTPSNIFIIN-LAVTDFLMCLTQTPIFFITSMYKHWIFGKKGCELYAFCGALFGICSMMTLMVIAVDRCVVITRPLASLGAMSNKK 176          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000078101.1 (SMESG000078101.1)

HSP 1 Score: 651.744 bits (1680), Expect = 0.000e+0
Identity = 371/371 (100.00%), Postives = 371/371 (100.00%), Query Frame = 3
Query:   60 MDSVQQLSNESESPIEQXXXXXXXXXXXXXXXXXGNILVLLVYYRKRGSEQNNETDCFFINSLALSDLIVCLVIVPCTMSTEWYNFHISLYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPLRKILTVNKAKXXXXXXXXXXXXXXXXXATLVGQNPHIHNSTVPQKTEVCEEIKFHKNVINEVLIYYEVYERITHSVFILSIIAVIICYALVYVEIIKIRKREKTLLFKHKRESKKTKSVDMSTSSEAYSSPGEIALLTPRKSLAQGLRDSALFRNIKSAAILFVVAVVYILVFTPVILIITFKVVKFNVIXXXXXXXXXAANPIVYCFMNSNFRRDLSKLFRRHLPNFMKKKEDNFYFPSRTIRI 1172
            MDSVQQLSNESESPIEQVIATIVILTIVVFVGTIGNILVLLVYYRKRGSEQNNETDCFFINSLALSDLIVCLVIVPCTMSTEWYNFHISLYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPLRKILTVNKAKIMMLILLLLSIILGIMGATLVGQNPHIHNSTVPQKTEVCEEIKFHKNVINEVLIYYEVYERITHSVFILSIIAVIICYALVYVEIIKIRKREKTLLFKHKRESKKTKSVDMSTSSEAYSSPGEIALLTPRKSLAQGLRDSALFRNIKSAAILFVVAVVYILVFTPVILIITFKVVKFNVILYNLYYLNNAANPIVYCFMNSNFRRDLSKLFRRHLPNFMKKKEDNFYFPSRTIRI
Sbjct:    1 MDSVQQLSNESESPIEQVIATIVILTIVVFVGTIGNILVLLVYYRKRGSEQNNETDCFFINSLALSDLIVCLVIVPCTMSTEWYNFHISLYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPLRKILTVNKAKIMMLILLLLSIILGIMGATLVGQNPHIHNSTVPQKTEVCEEIKFHKNVINEVLIYYEVYERITHSVFILSIIAVIICYALVYVEIIKIRKREKTLLFKHKRESKKTKSVDMSTSSEAYSSPGEIALLTPRKSLAQGLRDSALFRNIKSAAILFVVAVVYILVFTPVILIITFKVVKFNVILYNLYYLNNAANPIVYCFMNSNFRRDLSKLFRRHLPNFMKKKEDNFYFPSRTIRI 371          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000064085.1 (SMESG000064085.1)

HSP 1 Score: 170.629 bits (431), Expect = 6.164e-49
Identity = 137/370 (37.03%), Postives = 203/370 (54.86%), Query Frame = 3
Query:   78 LSNESESPIEQXXXXXXXXXXXXXXXXXGNILVLLVYYRKRGSEQNNETDCFFINSLALSDLIVCLVIVPCTMSTEWYNFHISLYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPLRKILTVNKAKXXX-----XXXXXXXXXXXXXXATLVGQNP--HIHNSTVPQKTEVCEEIKFHKNVINEVLIYYEVYERITHSVFILSIIAVIICYALVYVEIIKIRKREKTLLF------KHKRESKKTKSVDMSTSSEAYSSP------------GEIALLTPRKSLAQGLRD-----SALFRNIKSAAILFVVAVVYILVFTPVILIITFKVVKFNVIXXXXXXXXXAANPIVYCFMNSNFRRDLSKL 1097
            +SNE   P   +  TI++L+ V  VG IGN LVLLVY  KR  E N   D FFI  LA SDL VC+++VP T+  E   F IS   CK YYF+NT+NL+FST+LI +IA DR L I  PL+ IL + +AK ++     + +    + +  +   L   +P  +I ++T   K  +C+EIK + N+    +I+YE+ E+  H ++  SII +I+ Y+ ++  II+ R+++    F          E +    V +      Y SP             +      R+ L+    D     S   +NI+SA++L VV   Y+L F PV+LI+ FKV+ FN+ILY+ YY+NNA NPI+YCFM S F   L ++
Sbjct:    2 VSNEESIPNSHLCVTIILLSFVTVVGAIGNFLVLLVYRNKRRHENN---DIFFIIILAASDLAVCIILVPGTIYVELKAFEISEIACKSYYFLNTSNLVFSTLLILVIAFDRYLSICHPLKSILPLARAKKLVIFLFFISVTQGILAMLSVKLKLSTSSPGTYISSNTSIVKKFICDEIKHNLNITKSQMIFYEIVEKSNHFLYTSSIILIILFYSSIFKVIIRFRRKDNYYKFAPHFTDDFTTEYQPKSFVSLPKPRPKYLSPEIETSKWRICCQNDFKTEFKREHLSNRNTDKKFERSKFLQNIRSASLLSVVTGAYVLSFLPVLLIVAFKVINFNLILYHFYYVNNAVNPIIYCFMKSRFLYQLKQM 368          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000029598.1 (SMESG000029598.1)

HSP 1 Score: 149.828 bits (377), Expect = 5.204e-41
Identity = 131/372 (35.22%), Postives = 197/372 (52.96%), Query Frame = 3
Query:  165 NILVLLVYYRKRGSEQNNETDCFFINSLALSDLIVCLVIVPCTMSTEWYNFHISLYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPLRKILTVNK--------AKXXXXXXXXXXXXXXXXXATLVGQNPHIHNST---------VPQKTEVCEEIKFHKNVINEVLIYYEVYERITHSVFILSIIAVIICYALVYVEIIKIRKREKTLLFKHKRESKKTKSVDMST---------SSEAYSSPGEIAL--------LTPR-----------------------KSLA-QGLRDSALFRNIKSAAILFVVAVVYILVFTPVILIITFKVVKFNVIXXXXXXXXXAANPIVYCFMNSNFRRDLSKLFRR 1106
            N LV++VY +K     N  T  FFI  LA+SDL+VCLVIVP TM+ E+  F+IS  FCK                   +A+DR LCI  P  + LTV +        A I   I +++++ + +  +T    +  I NS+         +     VC+EI    NV    L++Y + E+I H+V+I SII+VII Y+ +   ++KIR R+K       +E+    S D++T         ++E  +    + L         TP+                       KS++ Q L  +   +N++SAA+LFVVA+VYI+ F+PV++I++FK   FN+ILYNLYYLNNAANP++YCFMNS FR++L+ +F R
Sbjct:   31 NALVIVVYKKKL---YNKHTADFFIVVLAISDLLVCLVIVPSTMAVEYLTFNISSVFCKA------------------VALDRYLCICHPFVQYLTVGRSIKLVMFLALISFTIGIMVALNVEVRVSTDTTHDMSISNSSDFSISHYYAMSNTKYVCDEIIHFNNVTRAQLVFYTIVEKINHTVYIASIISVIILYSFILRVVVKIRHRDKI------KEASIVNS-DLNTFQDSGNTVENTEVTNEMWRVKLKPKPKPRNRTPKSKRNYNKLLMDINKNRERTAKKQKSMSRQNLVSNVTIQNMRSAAMLFVVALVYIIAFSPVLMIVSFKF-SFNLILYNLYYLNNAANPLIYCFMNSKFRKELANVFLR 373          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000030128.1 (SMESG000030128.1)

HSP 1 Score: 144.436 bits (363), Expect = 3.259e-39
Identity = 108/341 (31.67%), Postives = 193/341 (56.60%), Query Frame = 3
Query:  165 NILVLLVYYRKRGSEQNNETDCFFINSLALSDLIVCLVIVPCTMSTEWYNFHISL-YFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPLRKILTVNKAKXXXXXXXXXXXXXXXXXATLV-----GQNPHIHNSTVPQKTEVCEEIKFHKNVINEVLIYYEVYERITHSVFILSIIAVIICYALVYVEIIKIRKREKTL-----------LFKHKRESKKTKSVDMSTSSEAYSSPGEIA--LLTP------RKSLAQGLRDSALFRNIKSAAILFVVAVVYILVFTPVILIITFKVVKFNVIXXXXXXXXXAANPIVYCFMNSNFRRDLSKLFRRHL 1112
            N+LVL++Y +KR     N+    FI +LA+SD IVCLVI+P T+  E+ ++ +S+   CK YYF+N +++ F  +LI LIA+DR  C+  P   ++TV ++K+ + I+ ++S++LG++    V      +N    NST+ Q    C ++  + N     L+++ + +R     + + I  VI  Y L+Y  ++   +++  L           L+    +S+  K ++  ++++  S P +    L+T        K++ +  +++ L +N K+A +LFVVA+ YI+ F P  L++    +  N+ ++ +YY+NNAANPI+YCFMN NFR D+   F +HL
Sbjct:   30 NLLVLIIYSQKRDKSTANQ----FIKTLAISDCIVCLVIIPFTIYIEFNDWKVSIDMICKSYYFLNNSSIPFGALLITLIAIDRFFCVCYPFLSLMTVKRSKVCVFIVFMMSVVLGVLSVFQVKTFKLSKNSTNMNSTLIQSE--CIDVSRYANPTKYELLFFTIVQRSQLISYAICICVVICLYILIYRFVLAAARKKARLKGLNSSSTTSFLWNKFFKSRSIKRINSDSNNDDTSVPCQTTEELMTKPGPSNNDKAIKRKFKETILIQNFKTALMLFVVAITYIVTFLPACLMVN-SSLALNLPVFYMYYINNAANPIIYCFMNKNFREDVVNFFHQHL 363          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000064403.1 (SMESG000064403.1)

HSP 1 Score: 140.198 bits (352), Expect = 1.839e-37
Identity = 111/339 (32.74%), Postives = 185/339 (54.57%), Query Frame = 3
Query:  162 GNILVLLVYYRKRGSEQNNETDCFFINSLALSDLIVCLVIVPCTMSTEWYNFHIS-LYFCKLYYFMNTANLLFSTMLIALIAVDRCLCITLPLRKILTVNKAKXXXXXXXXXXXXXXXXXATLVGQNPHIHNSTVPQKTEVCEEIKFHKNVINEVLIYYEVYERITHSVFILSIIAVIICYALVYVEIIKIRKREKTLL----------FKHKRESKKTKSVDMSTS-----------SEAYSSPGEIALLT-----PRKSLAQGLRDSALFRNIKSAAILFVVAVVYILVFTPVILIITFKVVKFNVIXXXXXXXXXAANPIVYCFMNSNFRRDLSKL 1097
            GN LV++VY RK     +  T   FIN LA++D   C+ I+P T+  E++ + IS  + CKLYYF N   + FS  LI+LIA+DR +CI  P  K +T+ K+K+ + ++L +S++LGI     V     IH + +    E C +I    N      +++ + ++I    +   II VI  Y  +Y ++++ R R+K++L          +  +  S  T   D+  +           S A S+P   + LT      R+   + + D+ +F+N ++AA+L VVA++YI+ F P  L+I +  + + + L+ +YY+NNAANPI+YCFMN+ FR D+  +
Sbjct:   39 GNGLVIIVYTRK----HDQLTTTLFINILAITDCFTCITIIPMTIYIEYWEWGISSAFLCKLYYFFNNCTIPFSAFLISLIAIDRYICICHPFNKFMTLFKSKVSVGLVLTVSVLLGIASTFQVKMIKGIHPNDLTNSYE-CADISKLTNTTTTEKLFFSIVQKIQLLSYTTCIILVICLYVAIYCKVLQTR-RKKSILKGIKNVKKPSYLWESRSNLTNVPDLDENPIKLPDGDTMLSSAKSTPNSKSFLTVPKPEHRRVSLRSICDTQIFQNFRTAAMLSVVALMYIISFLPAFLMINYPQILY-IPLFYMYYINNAANPIIYCFMNARFREDIKAI 370          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HCRTR13.678e-822.64hypocretin receptor 1 [Source:HGNC Symbol;Acc:HGNC... [more]
HCRTR13.678e-822.64hypocretin receptor 1 [Source:HGNC Symbol;Acc:HGNC... [more]
GHSR3.003e-723.77growth hormone secretagogue receptor [Source:HGNC ... [more]
GHSR8.262e-723.39growth hormone secretagogue receptor [Source:HGNC ... [more]
OXTR4.554e-621.71oxytocin receptor [Source:HGNC Symbol;Acc:HGNC:852... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
npr-112.183e-642.67Putative neuropeptide Y receptor 11 [Source:UniPr... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
si:ch73-160i9.31.107e-624.86si:ch73-160i9.3 [Source:ZFIN;Acc:ZDB-GENE-141212-2... [more]
htr2b5.966e-633.645-hydroxytryptamine (serotonin) receptor 2B, G pro... [more]
si:ch73-160i9.16.942e-625.41si:ch73-160i9.1 [Source:ZFIN;Acc:ZDB-GENE-141212-2... [more]
si:dkey-211g8.17.067e-626.88si:dkey-211g8.1 [Source:ZFIN;Acc:ZDB-GENE-060503-4... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
HCRTR25.849e-623.65hypocretin (orexin) receptor 2 [Source:NCBI gene;A... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hcrtr15.955e-823.56hypocretin (orexin) receptor 1 [Source:MGI Symbol;... [more]
Hcrtr15.955e-823.56hypocretin (orexin) receptor 1 [Source:MGI Symbol;... [more]
Hcrtr15.955e-823.56hypocretin (orexin) receptor 1 [Source:MGI Symbol;... [more]
Hcrtr15.955e-823.56hypocretin (orexin) receptor 1 [Source:MGI Symbol;... [more]
Ghsr1.324e-623.85growth hormone secretagogue receptor [Source:MGI S... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O43613|OX1R_HUMAN1.766e-722.64Orexin receptor type 1 OS=Homo sapiens OX=9606 GN=... [more]
sp|P58307|OX1R_MOUSE4.165e-723.56Orexin receptor type 1 OS=Mus musculus OX=10090 GN... [more]
sp|O97661|OX1R_PIG5.441e-722.92Orexin receptor type 1 OS=Sus scrofa OX=9823 GN=HC... [more]
sp|A5A4K9|GHSR_RABIT5.847e-725.35Growth hormone secretagogue receptor type 1 OS=Ory... [more]
sp|A5A4L1|GHSR_MUSPF1.413e-624.31Growth hormone secretagogue receptor type 1 OS=Mus... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUN51.172e-3531.67GCR056 OS=Schmidtea mediterranea OX=79327 GN=gcr05... [more]
A0A193KUC81.935e-3534.82GCR109 (Fragment) OS=Schmidtea mediterranea OX=793... [more]
A0A193KUG26.613e-3432.74GCR036 OS=Schmidtea mediterranea OX=79327 GN=gcr03... [more]
A0A0R3TSS31.458e-3034.97G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A068Y9W81.690e-3034.67Orexin receptor type 2 OS=Echinococcus multilocula... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
si:ch73-160i9.38.113e-725.81C3a anaphylatoxin chemotactic receptor-like [Sourc... [more]
si:ch73-160i9.38.113e-725.81C3a anaphylatoxin chemotactic receptor-like [Sourc... [more]
si:ch73-160i9.31.108e-625.81C3a anaphylatoxin chemotactic receptor-like [Sourc... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO372172.098e-838.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO500231.304e-631.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO401066.186e-631.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO425527.246e-630.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460308.981e-627.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CCKAR9.206e-824.34cholecystokinin A receptor [Source:NCBI gene;Acc:1... [more]
opn4b2.036e-633.98melanopsin-A-like [Source:NCBI gene;Acc:101157094][more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078101.10.000e+0100.00SMESG000078101.1[more]
SMESG000064085.16.164e-4937.03SMESG000064085.1[more]
SMESG000029598.15.204e-4135.22SMESG000029598.1[more]
SMESG000030128.13.259e-3931.67SMESG000030128.1[more]
SMESG000064403.11.839e-3732.74SMESG000064403.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003012 ID=SMED30003012|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1240bp
TCTAATCCAATCAAAATCCAAATTTATTTTCCGATCAATCAAATCAAAAT
TTATTTCATATGGATTCCGTTCAACAGTTGAGCAATGAAAGCGAAAGTCC
AATAGAACAAGTCATCGCAACAATTGTTATCTTGACAATCGTTGTGTTTG
TTGGAACAATTGGAAATATTCTCGTTCTGTTGGTCTATTACCGAAAAAGA
GGCTCAGAACAGAACAACGAAACAGACTGCTTCTTTATCAACAGTCTAGC
ATTGTCAGATTTAATCGTTTGTTTAGTTATTGTTCCTTGCACAATGTCGA
CGGAATGGTACAATTTTCATATATCATTGTATTTTTGTAAACTCTATTAT
TTCATGAACACAGCCAATCTGTTGTTTTCAACTATGTTGATAGCATTAAT
CGCCGTTGATAGATGTCTTTGCATTACGTTACCATTGAGAAAAATTCTCA
CCGTCAATAAAGCCAAGATAATGATGTTAATTCTTTTACTATTGTCAATT
ATTCTCGGAATAATGGGAGCGACATTAGTCGGCCAAAATCCTCATATTCA
CAACTCGACAGTACCTCAGAAAACCGAAGTCTGCGAAGAGATTAAATTCC
ATAAGAACGTCATTAATGAGGTTCTGATTTACTATGAAGTCTACGAAAGA
ATCACTCATTCTGTCTTCATTCTATCCATAATAGCCGTCATTATTTGTTA
TGCTCTTGTCTATGTGGAAATAATTAAAATTCGAAAGCGAGAAAAGACAT
TGTTGTTTAAACATAAAAGAGAATCAAAGAAAACCAAATCCGTGGACATG
TCAACTTCATCAGAAGCTTACAGCAGTCCGGGAGAGATAGCTCTTTTAAC
ACCGAGAAAATCACTGGCTCAAGGTTTAAGAGATTCTGCGTTATTTCGCA
ATATTAAATCCGCAGCTATTCTTTTCGTCGTTGCTGTAGTCTACATTTTA
GTATTCACTCCTGTCATATTAATCATAACTTTTAAAGTAGTGAAATTTAA
TGTCATTCTTTATAACTTATATTATTTAAACAATGCCGCAAATCCCATCG
TTTACTGTTTCATGAATTCCAATTTTCGTCGAGATCTTAGTAAGCTATTC
CGACGACATTTACCAAATTTCATGAAGAAAAAAGAAGACAATTTCTATTT
TCCATCGAGAACAATTCGAATTAGTCTATCACAAAATGGTAACAACAACA
ATATCAGTTCAGACAATAACTAATAATAAAAGATAAAACA
back to top

protein sequence of SMED30003012-orf-1

>SMED30003012-orf-1 ID=SMED30003012-orf-1|Name=SMED30003012-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=388bp
MDSVQQLSNESESPIEQVIATIVILTIVVFVGTIGNILVLLVYYRKRGSE
QNNETDCFFINSLALSDLIVCLVIVPCTMSTEWYNFHISLYFCKLYYFMN
TANLLFSTMLIALIAVDRCLCITLPLRKILTVNKAKIMMLILLLLSIILG
IMGATLVGQNPHIHNSTVPQKTEVCEEIKFHKNVINEVLIYYEVYERITH
SVFILSIIAVIICYALVYVEIIKIRKREKTLLFKHKRESKKTKSVDMSTS
SEAYSSPGEIALLTPRKSLAQGLRDSALFRNIKSAAILFVVAVVYILVFT
PVILIITFKVVKFNVILYNLYYLNNAANPIVYCFMNSNFRRDLSKLFRRH
LPNFMKKKEDNFYFPSRTIRISLSQNGNNNNISSDNN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 20..44
score: 26.29
coord: 314..340
score: 30.96
coord: 284..308
score: 18.22
coord: 100..122
score: 25.81
coord: 56..77
score: 30.48
coord: 195..218
score: 15.89
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 35..332
e-value: 3.0E-25
score: 89.0
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 106..122
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 11..347
e-value: 1.6E-51
score: 177.3
NoneNo IPR availablePANTHERPTHR24230G-PROTEIN COUPLED RECEPTORcoord: 8..359
NoneNo IPR availableCDDcd006377tm_classA_rhodopsin-likecoord: 22..336
e-value: 2.68815E-22
score: 93.4962
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 14..353
NoneNo IPR availableTMHMMTMhelixcoord: 57..79
NoneNo IPR availableTMHMMTMhelixcoord: 94..116
NoneNo IPR availableTMHMMTMhelixcoord: 286..308
NoneNo IPR availableTMHMMTMhelixcoord: 313..335
NoneNo IPR availableTMHMMTMhelixcoord: 22..44
NoneNo IPR availableTMHMMTMhelixcoord: 197..219
NoneNo IPR availableTMHMMTMhelixcoord: 137..159
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 35..332
score: 27.072