NPHP1

Overview
NameNPHP1 (AKN21705.1)
Smed IDSMED30003011
Length (bp)3060
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NPHP1 (SMED30003011) t-SNE clustered cells

Violin plots show distribution of expression levels for NPHP1 (SMED30003011) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of NPHP1 (SMED30003011) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for NPHP1 (SMED30003011) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003011

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 24

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30003011SMESG000061008.1 SmedASXL_017488SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30003011SMESG000061008.1 dd_Smed_v4_9990_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30003011SMESG000061008.1 dd_Smed_v4_9990_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30003011SMESG000061008.1 dd_Smed_v4_9990_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003011SMESG000061008.1 dd_Smed_v4_9990_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30003011SMESG000061008.1 dd_Smed_v4_9990_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30003011SMESG000061008.1 dd_Smed_v4_9990_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30003011SMESG000061008.1 dd_Smed_v4_9990_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30003011SMESG000061008.1 dd_Smed_v4_9990_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30003011SMESG000061008.1 dd_Smed_v4_9990_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30003011SMESG000061008.1 dd_Smed_v4_9990_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30003011SMESG000061008.1 dd_Smed_v4_9990_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003011SMESG000061008.1 Contig11843newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30003011SMESG000061008.1 Contig11843uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30003011SMESG000061008.1 dd_Smed_v6_9990_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30003011SMESG000061008.1 dd_Smed_v6_9990_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30003011SMESG000061008.1 dd_Smed_v6_9990_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30003011SMESG000061008.1 dd_Smed_v6_9990_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30003011SMESG000061008.1 dd_Smed_v6_9990_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30003011SMESG000061008.1 dd_Smed_v6_9990_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30003011SMESG000061008.1 dd_Smed_v6_9990_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30003011SMESG000061008.1 Contig26073newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30003011SMESG000061008.1 dd_Smed_v4_9990_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30003011SMESG000061008.1 dd_Smed_v4_9990_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of NPHP1 vs. Ensembl Human
Match: NPHP1 (nephrocystin 1 [Source:HGNC Symbol;Acc:HGNC:7905])

HSP 1 Score: 198.749 bits (504), Expect = 3.734e-53
Identity = 150/495 (30.30%), Postives = 251/495 (50.71%), Query Frame = 2
Query: 1328 GKKYVLAKTFSSEEEDDLSXXXXXXXXXXXXXXXDWSYVKNNRGETGYVPTSYLKVKLNAPTPKIEEILVPKHNEDENEKGLDTLKEGNMPESELGTKIEDSSDS-WIQIKQSMHEKTINDILKECGNLPSGFRYSTIFNWSKENSNNSSFIAFLCPKLSDSHLNFSELQADQANSXXXXXXXXXXXXXNKF-----PFISEKFIIKSRHVRLCLFNGNKVLSNIHLIRATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILMEFCIQGYKSKLDTVANADTLKTIDEDFTNDELLEFSIGWTSIPLYESNGQPIITKKGDYVLNGGTPFEKGIEVDPLNKNDSSGKPKF-MLNQNKQPYVTIRLSVPSKENKELIDTLPSMIVGSTLHLVLLSFYRKLLTESILDLGRNLTSTKSIYSPFLVSFTQVAECPLLLDTLRNIWXXXXXXXXXXXXXXQVKMNEFFQKIYMDFIYPL---TKLKDFQ 2782
            G++Y+    F++++  DL+  +GE +L++E     W   K+ +G  G VP +YL+       P  EE    + +E+ +E+ ++ + E     +  G +++  +D  W  +++++ E    D+L   G +P+GFR ST+    +E  N      FL P+L  S L F +L  D      + +     + L  +     P       + SRHVRLCLF+GNKVLSNIH +RAT   K   TW F+ +V+  +  +  G+ FI+ N +S DL IL E  I   ++                  +  E  E S GW  + L++++G PI  K  +  LNGGTP+EKGIEVDP     + G   + ++   +QP + ++L   ++ ++ ++  LP  ++G+   + LL FYR++L + +L    +L ST  I  P L +F  + E P ++D LR+ W  K  T K   K+D+  +   F  +Y D + PL   T+L  F+
Sbjct:   92 GEEYIAVGDFTAQQVGDLTFKKGEILLVIEKKPDGWWIAKDAKGNEGLVPRTYLE-------PYSEEEEGQESSEEGSEEDVEAVDE-----TADGAEVKQRTDPHWSAVQKAISEINTVDVLTTMGAIPAGFRPSTLSQLLEEG-NQFRANYFLQPELMPSQLAFRDLMWDATEGTIRSRPSRISLILTLWSCKMIPLPGMSIQVLSRHVRLCLFDGNKVLSNIHTVRATWQPKKPKTWTFSPQVTRILPCLLDGDCFIRSNSASPDLGILFELGISYIRN------------------STGERGELSCGWVFLKLFDASGVPIPAKTYELFLNGGTPYEKGIEVDPSISRRAHGSVFYQIMTMRRQPQLLVKLRSLNRRSRNVLSLLPETLIGNMCSIHLLIFYRQILGDVLLKDRMSLQSTDLISHPMLATFPMLLEQPDVMDALRSSWAGKESTLKRSEKRDKEFLKSTFLLVYHDCVLPLLHSTRLPPFR 555          
BLAST of NPHP1 vs. Ensembl Human
Match: NPHP1 (nephrocystin 1 [Source:HGNC Symbol;Acc:HGNC:7905])

HSP 1 Score: 197.593 bits (501), Expect = 2.323e-52
Identity = 152/497 (30.58%), Postives = 254/497 (51.11%), Query Frame = 2
Query: 1328 GKKYVLAKTFSSEEEDDLSXXXXXXXXXXXXXXXDWSYVKNNRGETGYVPTSYLKVKLNAPTPKIEEILVPKHNEDENEKGLDTLKEGNMPESELGTKIEDSSDS-WIQIKQSMHEKTIN--DILKECGNLPSGFRYSTIFNWSKENSNNSSFIAFLCPKLSDSHLNFSELQADQANSXXXXXXXXXXXXXNKF-----PFISEKFIIKSRHVRLCLFNGNKVLSNIHLIRATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILMEFCIQGYKSKLDTVANADTLKTIDEDFTNDELLEFSIGWTSIPLYESNGQPIITKKGDYVLNGGTPFEKGIEVDPLNKNDSSGKPKF-MLNQNKQPYVTIRLSVPSKENKELIDTLPSMIVGSTLHLVLLSFYRKLLTESILDLGRNLTSTKSIYSPFLVSFTQVAECPLLLDTLRNIWXXXXXXXXXXXXXXQVKMNEFFQKIYMDFIYPL---TKLKDFQ 2782
            G++Y+    F++++  DL+  +GE +L++E     W   K+ +G  G VP +YL+       P  EE    + +E+ +E+ ++ + E     +  G +++  +D  W  +++++ E+ IN  D+L   G +P+GFR ST+    +E  N      FL P+L  S L F +L  D      + +     + L  +     P       + SRHVRLCLF+GNKVLSNIH +RAT   K   TW F+ +V+  +  +  G+ FI+ N +S DL IL E  I   ++                  +  E  E S GW  + L++++G PI  K  +  LNGGTP+EKGIEVDP     + G   + ++   +QP + ++L   ++ ++ ++  LP  ++G+   + LL FYR++L + +L    +L ST  I  P L +F  + E P ++D LR+ W  K  T K   K+D+  +   F  +Y D + PL   T+L  F+
Sbjct:  154 GEEYIAVGDFTAQQVGDLTFKKGEILLVIEKKPDGWWIAKDAKGNEGLVPRTYLE-------PYSEEEEGQESSEEGSEEDVEAVDE-----TADGAEVKQRTDPHWSAVQKAISEQ-INTVDVLTTMGAIPAGFRPSTLSQLLEEG-NQFRANYFLQPELMPSQLAFRDLMWDATEGTIRSRPSRISLILTLWSCKMIPLPGMSIQVLSRHVRLCLFDGNKVLSNIHTVRATWQPKKPKTWTFSPQVTRILPCLLDGDCFIRSNSASPDLGILFELGISYIRN------------------STGERGELSCGWVFLKLFDASGVPIPAKTYELFLNGGTPYEKGIEVDPSISRRAHGSVFYQIMTMRRQPQLLVKLRSLNRRSRNVLSLLPETLIGNMCSIHLLIFYRQILGDVLLKDRMSLQSTDLISHPMLATFPMLLEQPDVMDALRSSWAGKESTLKRSEKRDKEFLKSTFLLVYHDCVLPLLHSTRLPPFR 618          
BLAST of NPHP1 vs. Ensembl Human
Match: NPHP1 (nephrocystin 1 [Source:HGNC Symbol;Acc:HGNC:7905])

HSP 1 Score: 194.512 bits (493), Expect = 3.768e-51
Identity = 137/452 (30.31%), Postives = 231/452 (51.11%), Query Frame = 2
Query: 1328 GKKYVLAKTFSSEEEDDLSXXXXXXXXXXXXXXXDWSYVKNNRGETGYVPTSYLKVKLNAPTPKIEEILVPKHNEDENEKGLDTLKEGNMPESELGTKIEDSSDS-WIQIKQSMHEKTINDILKECGNLPSGFRYSTIFNWSKENSNNSSFIAFLCPKLSDSHLNFSELQADQANSXXXXXXXXXXXXXNKF-----PFISEKFIIKSRHVRLCLFNGNKVLSNIHLIRATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILMEFCIQGYKSKLDTVANADTLKTIDEDFTNDELLEFSIGWTSIPLYESNGQPIITKKGDYVLNGGTPFEKGIEVDPLNKNDSSGKPKF-MLNQNKQPYVTIRLSVPSKENKELIDTLPSMIVGSTLHLVLLSFYRKLLTESILDLGRNLTSTKSIYSPFLVSFTQVAECPLLLDTLRNIW 2662
            G++Y+    F++++  DL+  +GE +L++E     W   K+ +G  G VP +YL+       P  EE    + +E+ +E+ ++ + E     +  G +++  +D  W  +++++ E    D+L   G +P+GFR ST+    +E  N      FL P+L  S L F +L  D      + +     + L  +     P       + SRHVRLCLF+GNKVLSNIH +RAT   K   TW F+ +V+  +  +  G+ FI+ N +S DL IL E  I   ++                  +  E  E S GW  + L++++G PI  K  +  LNGGTP+EKGIEVDP     + G   + ++   +QP + ++L   ++ ++ ++  LP  ++G+   + LL FYR++L + +L    +L ST  I  P L +F  + E P ++D LR+ W
Sbjct:  154 GEEYIAVGDFTAQQVGDLTFKKGEILLVIEKKPDGWWIAKDAKGNEGLVPRTYLE-------PYSEEEEGQESSEEGSEEDVEAVDE-----TADGAEVKQRTDPHWSAVQKAISEINTVDVLTTMGAIPAGFRPSTLSQLLEEG-NQFRANYFLQPELMPSQLAFRDLMWDATEGTIRSRPSRISLILTLWSCKMIPLPGMSIQVLSRHVRLCLFDGNKVLSNIHTVRATWQPKKPKTWTFSPQVTRILPCLLDGDCFIRSNSASPDLGILFELGISYIRN------------------STGERGELSCGWVFLKLFDASGVPIPAKTYELFLNGGTPYEKGIEVDPSISRRAHGSVFYQIMTMRRQPQLLVKLRSLNRRSRNVLSLLPETLIGNMCSIHLLIFYRQILGDVLLKDRMSLQSTDLISHPMLATFPMLLEQPDVMDALRSSW 574          
BLAST of NPHP1 vs. Ensembl Human
Match: NPHP1 (nephrocystin 1 [Source:HGNC Symbol;Acc:HGNC:7905])

HSP 1 Score: 183.726 bits (465), Expect = 1.617e-47
Identity = 123/375 (32.80%), Postives = 190/375 (50.67%), Query Frame = 2
Query: 1685 DILKECGNLPSGFRYSTIFNWSKENSNNSSFIAFLCPKLSDSHLNFSELQADQANSXXXXXXXXXXXXXNKF-----PFISEKFIIKSRHVRLCLFNGNKVLSNIHLIRATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILMEFCIQGYKSKLDTVANADTLKTIDEDFTNDELLEFSIGWTSIPLYESNGQPIITKKGDYVLNGGTPFEKGIEVDPLNKNDSSGKPKF-MLNQNKQPYVTIRLSVPSKENKELIDTLPSMIVGSTLHLVLLSFYRKLLTESILDLGRNLTSTKSIYSPFLVSFTQVAECPLLLDTLRNIWXXXXXXXXXXXXXXQVKMNEFFQKIYMDFIYPL---TKLKDFQ 2782
            D+L   G +P+GFR ST+    +E  N      FL P+L  S L F +L  D      + +     + L  +     P       + SRHVRLCLF+GNKVLSNIH +RAT   K   TW F+ +V+  +  +  G+ FI+ N +S DL IL E  I   ++                  +  E  E S GW  + L++++G PI  K  +  LNGGTP+EKGIEVDP     + G   + ++   +QP + ++L   ++ ++ ++  LP  ++G+   + LL FYR++L + +L    +L ST  I  P L +F  + E P ++D LR+ W  K  T K   K+D+  +   F  +Y D + PL   T+L  F+
Sbjct:  318 DVLTTMGAIPAGFRPSTLSQLLEEG-NQFRANYFLQPELMPSQLAFRDLMWDATEGTIRSRPSRISLILTLWSCKMIPLPGMSIQVLSRHVRLCLFDGNKVLSNIHTVRATWQPKKPKTWTFSPQVTRILPCLLDGDCFIRSNSASPDLGILFELGISYIRN------------------STGERGELSCGWVFLKLFDASGVPIPAKTYELFLNGGTPYEKGIEVDPSISRRAHGSVFYQIMTMRRQPQLLVKLRSLNRRSRNVLSLLPETLIGNMCSIHLLIFYRQILGDVLLKDRMSLQSTDLISHPMLATFPMLLEQPDVMDALRSSWAGKESTLKRSEKRDKEFLKSTFLLVYHDCVLPLLHSTRLPPFR 673          
BLAST of NPHP1 vs. Ensembl Human
Match: NPHP1 (nephrocystin 1 [Source:HGNC Symbol;Acc:HGNC:7905])

HSP 1 Score: 183.726 bits (465), Expect = 1.695e-47
Identity = 123/375 (32.80%), Postives = 190/375 (50.67%), Query Frame = 2
Query: 1685 DILKECGNLPSGFRYSTIFNWSKENSNNSSFIAFLCPKLSDSHLNFSELQADQANSXXXXXXXXXXXXXNKF-----PFISEKFIIKSRHVRLCLFNGNKVLSNIHLIRATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILMEFCIQGYKSKLDTVANADTLKTIDEDFTNDELLEFSIGWTSIPLYESNGQPIITKKGDYVLNGGTPFEKGIEVDPLNKNDSSGKPKF-MLNQNKQPYVTIRLSVPSKENKELIDTLPSMIVGSTLHLVLLSFYRKLLTESILDLGRNLTSTKSIYSPFLVSFTQVAECPLLLDTLRNIWXXXXXXXXXXXXXXQVKMNEFFQKIYMDFIYPL---TKLKDFQ 2782
            D+L   G +P+GFR ST+    +E  N      FL P+L  S L F +L  D      + +     + L  +     P       + SRHVRLCLF+GNKVLSNIH +RAT   K   TW F+ +V+  +  +  G+ FI+ N +S DL IL E  I   ++                  +  E  E S GW  + L++++G PI  K  +  LNGGTP+EKGIEVDP     + G   + ++   +QP + ++L   ++ ++ ++  LP  ++G+   + LL FYR++L + +L    +L ST  I  P L +F  + E P ++D LR+ W  K  T K   K+D+  +   F  +Y D + PL   T+L  F+
Sbjct:  319 DVLTTMGAIPAGFRPSTLSQLLEEG-NQFRANYFLQPELMPSQLAFRDLMWDATEGTIRSRPSRISLILTLWSCKMIPLPGMSIQVLSRHVRLCLFDGNKVLSNIHTVRATWQPKKPKTWTFSPQVTRILPCLLDGDCFIRSNSASPDLGILFELGISYIRN------------------STGERGELSCGWVFLKLFDASGVPIPAKTYELFLNGGTPYEKGIEVDPSISRRAHGSVFYQIMTMRRQPQLLVKLRSLNRRSRNVLSLLPETLIGNMCSIHLLIFYRQILGDVLLKDRMSLQSTDLISHPMLATFPMLLEQPDVMDALRSSWAGKESTLKRSEKRDKEFLKSTFLLVYHDCVLPLLHSTRLPPFR 674          
BLAST of NPHP1 vs. Ensembl Zebrafish
Match: nphp1 (nephronophthisis 1 [Source:ZFIN;Acc:ZDB-GENE-060929-1234])

HSP 1 Score: 176.407 bits (446), Expect = 1.407e-45
Identity = 136/487 (27.93%), Postives = 234/487 (48.05%), Query Frame = 2
Query: 1322 QIGKKYVLAKTFSSEEEDDLSXXXXXXXXXXXXXXXDWSYVKNNRGETGYVPTSYLKVKLNAPTPKIEEILVPKHNEDENEKGLDTLKEGNMPESELGTKIEDSSDSWIQIKQSMHEKTINDILKECGNLPSGFRYSTIFNWSKENSNNSSFIAFLCPKLSDSHLNFSELQADQANSXXXXXXXXXXXX-----XNKFPFISEKFIIKSRHVRLCLFNGNKVLSNIHLIRATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILMEFCIQGYKSKLDTVANADTLKTIDEDFTNDELLEFSIGWTSIPLYESNGQPIITKKGDYVLNGGTPFEKGIEVDPLN--KNDSSGKPKFMLNQNKQPYVTIRLSVPSKENKELIDTLPSMIVGSTLHLVLLSFYRKLLTESILDLGRNLTSTKSIYSPFLVSFTQVAECPLLLDTLRNIWXXXXXXXXXXXXXXQVKMNEFFQKIYMDFIYPL 2761
            Q    Y+   +F++EEE DLS  +GE + +L   +  W   +N+ G+ G VP ++LK+   + +P+  E       + E                    +    + +W  +++++ E    D+L   G +P GFR ST+    +E S+  +   F+ PKLS S L+F +L  D    +   +     +          P       + SRHVRLC FNG +VLSNIH +RAT + KN  TW+F+ +++  +  +  G+ F++ +  S+DL IL E  +   ++                  +  E  + S GWT + L++ +G PI  +  +  ++GGTPFEK +++D ++  K   +G    ML   K P + ++L   +  ++  ++ LP  IVGS   L LL+ YR++L +++L     + +   I S  L SF  V + P L+D  R  W+E     K   K+D   + + F  +YM  ++PL
Sbjct:  160 QGSASYITLSSFTAEEEGDLSIQKGEILKVLSKNKDGWWLAQNSNGQKGLVPKTFLKM---SSSPQDSERENEDEEDSEE------------------EQESSKTSNWNTVRKAVTEIDATDVLSAMGAIPPGFRPSTLSRLLEEGSSYRAS-HFIQPKLSQSQLSFKDLHMDPDTGKVHGRPSRVSLTLTLWSCRMIPSPGVGLQVLSRHVRLCAFNGTQVLSNIHTVRATYNSKNPKTWSFSPRMTGMLPCLLDGDCFLRCDSESSDLGILFELGVTYIRN------------------STGERGDLSCGWTFLKLFDESGAPIALRTQELTIHGGTPFEKDLDMDTMSTKKGYQTGVFHQMLLSRKMPKLVVKLKSLNSSSRSRLNLLPDTIVGSLSTLHLLATYRQILADALLLDRVTMCNADLICSSVLASFPNVLDQPDLMDAFRKSWSESESNLKRSEKRDINILKQMFVSVYMGSVFPL 606          
BLAST of NPHP1 vs. Ensembl Zebrafish
Match: nphp1 (nephronophthisis 1 [Source:ZFIN;Acc:ZDB-GENE-060929-1234])

HSP 1 Score: 166.777 bits (421), Expect = 2.038e-42
Identity = 135/487 (27.72%), Postives = 234/487 (48.05%), Query Frame = 2
Query: 1322 QIGKKYVLAKTFSSEEEDDLSXXXXXXXXXXXXXXXDWSYVKNNRGETGYVPTSYLKVKLNAPTPKIEEILVPKHNEDENEKGLDTLKEGNMPESELGTKIEDSSDSWIQIKQSMHEKTINDILKECGNLPSGFRYSTIFNWSKENSNNSSFIAFLCPKLSDSHLNFSELQADQANSXXXXXXXXXXXX-----XNKFPFISEKFIIKSRHVRLCLFNGNKVLSNIHLIRATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILMEFCIQGYKSKLDTVANADTLKTIDEDFTNDELLEFSIGWTSIPLYESNGQPIITKKGDYVLNGGTPFEKGIEVDPLN--KNDSSGKPKFMLNQNKQPYVTIRLSVPSKENKELIDTLPSMIVGSTLHLVLLSFYRKLLTESILDLGRNLTSTKSIYSPFLVSFTQVAECPLLLDTLRNIWXXXXXXXXXXXXXXQVKMNEFFQKIYMDFIYPL 2761
            Q    Y+   +F++EEE DLS  +GE + +L   +  W   +N+ G+ G VP ++L  K+++     E     + + +E ++   +     M  + L  +I+ +                 D+L   G +P GFR ST+    +E S+  +   F+ PKLS S L+F +L  D    +   +     +          P       + SRHVRLC FNG +VLSNIH +RAT + KN  TW+F+ +++  +  +  G+ F++ +  S+DL IL E  +   ++                  +  E  + S GWT + L++ +G PI  +  +  ++GGTPFEK +++D ++  K   +G    ML   K P + ++L   +  ++  ++ LP  IVGS   L LL+ YR++L +++L     + +   I S  L SF  V + P L+D  R  W+E     +   K+D   + + F  +YM  ++PL
Sbjct:  160 QGSASYITLSSFTAEEEGDLSIQKGEILKVLSKNKDGWWLAQNSNGQKGLVPKTFL--KMSSSLQDSERENEDEEDSEEEQESSYSPSHALMYCNVLHLQIDAT-----------------DVLSAMGAIPPGFRPSTLSRLLEEGSSYRAS-HFIQPKLSQSQLSFKDLHMDPDTGKVHGRPSRVSLTLTLWSCRMIPSPGVGLQVLSRHVRLCAFNGTQVLSNIHTVRATYNSKNPKTWSFSPRMTGMLPCLLDGDCFLRCDSESSDLGILFELGVTYIRN------------------STGERGDLSCGWTFLKLFDESGAPIALRTQELTIHGGTPFEKDLDMDTMSTKKGYQTGVFHQMLLSRKMPKLVVKLKSLNSSSRSRLNLLPDTIVGSLSTLHLLATYRQILADALLLDRVTMCNADLICSSVLASFPNVLDQPDLMDAFRKSWSESESNLRRSEKRDINILKQMFVSVYMGSVFPL 608          
BLAST of NPHP1 vs. Ensembl Xenopus
Match: nfic (nuclear factor I C [Source:Xenbase;Acc:XB-GENE-484367])

HSP 1 Score: 189.119 bits (479), Expect = 1.637e-49
Identity = 134/483 (27.74%), Postives = 243/483 (50.31%), Query Frame = 2
Query: 1331 KKYVLAKTFSSEEEDDLSXXXXXXXXXXXXXXXDWSYVKNNRGETGYVPTSYLKVKLNAPTPKIEEILVPKHNEDENEKGLDTLKEGNMPESELGTKIEDSSDSWIQIKQSMHEKTINDILKECGNLPSGFRYSTIFNWSKENSNNSSFIAFLCPKLSDSHLNFSELQADQANSXXXXXXXXXXXXXNKF-----PFISEKFIIKSRHVRLCLFNGNKVLSNIHLIRATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILMEFCIQGYKSKLDTVANADTLKTIDEDFTNDELLEFSIGWTSIPLYESNGQPIITKKGDYVLNGGTPFEKGIEVDP-LNKNDSSGKPKFMLNQNKQPYVTIRLSVPSKENKELIDTLPSMIVGSTLHLVLLSFYRKLLTESILDLGRNLTSTKSIYSPFLVSFTQVAECPLLLDTLRNIWXXXXXXXXXXXXXXQVKMNEFFQKIYMDFIYPL 2761
            K+Y+    F ++++DDL+  +G+ + +L+     W   ++++G  G VP +YL+V   +  P +++       + E  +   T+         + +K  + + S +   + + E +  D L   G +PSGFR ST+     +     +++ +L P L+ S L F +L  D+     +       + L  +     P       I SRHVRLCLF+G KV SNIH +RA+   KN  TW F+ +V+  + S+  G+ F++    S ++ IL E  +   ++                  +  E  E S GW  + L+++NG P+  +  +  L GGTP+E+G+EVDP + +  ++G    +  Q KQP + ++L   +   + +++ LP  I+GS+ HL +L +YR++L + +L   +++ ++  I  P L +F ++ E P +LD LR+ W EK  + K   K+D+  M   F  +Y +  YPL
Sbjct:  160 KEYITLGDFQAQQKDDLTFKKGQVLHILDKKLDGWWIAQDSKGNKGLVPKTYLQV-YKSGDPNLDQSEEESEEDVEETEDDKTVT--------MQSKQTEDTVSQLSSSRKIKEMSSVDGLVTMGTIPSGFRSSTLAQLLNQGEQYRTYM-YLQPDLNPSQLAFKDLLWDREACGIQSLPSRISLILTLWSCKMIPLPGASIQILSRHVRLCLFDGAKVWSNIHTVRASWLPKNSRTWTFSPRVTGILPSILDGDCFVRSGCHSPEIGILFELGVTYIRN------------------STGERGELSCGWAFLKLFDTNGIPMPARTYELTLYGGTPYERGVEVDPSVARRVNTGVFHQLRTQRKQPRLLVKLRTLNTTQRNMLNMLPQTIIGSSSHLPVLVYYRQILGDVLLKERKSMQNSDLICHPLLATFPRLMEQPDILDALRSGWAEKENSMKRSEKRDKEFMKNAFIHVYHNIAYPL 614          
BLAST of NPHP1 vs. Ensembl Xenopus
Match: nfic (nuclear factor I C [Source:Xenbase;Acc:XB-GENE-484367])

HSP 1 Score: 178.333 bits (451), Expect = 5.739e-46
Identity = 138/496 (27.82%), Postives = 243/496 (48.99%), Query Frame = 2
Query: 1331 KKYVLAKTFSSEEEDDLSXXXXXXXXXXXXXXXDWSYVKNNRGETGYVPTSYLKVKLNAPTPKIEEILVPKHNEDENEKGLDTLKEGNMPES---ELGTKIEDSSDSWIQIKQSMHEKTIN--------------DILKECGNLPSGFRYSTIFNWSKENSNNSSFIAFLCPKLSDSHLNFSELQADQ--ANSXXXXXXXXXXXXXNKFPFISEKFIIKSRHVRLCLFNGNKVLSNIHLIRATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILMEFCIQGYKSKLDTVANADTLKTIDEDFTNDELLEFSIGWTSIPLYESNGQPIITKKGDYVLNGGTPFEKGIEVDPLNKNDSSGKPKFMLNQNKQPYVTIRLSVPSKENKELIDTLPSMIVGSTLHLVLLSFYRKLLTESILDLGRNLTSTKSIYSPFLVSFTQVAECPLLLDTLRNIWXXXXXXXXXXXXXXQVKMNEFFQKIYMDFIYPL 2761
            K+Y+    F ++++DDL+  +G+ + +L+     W   ++++G  G VP +YL+V        I +       + E  +   T+    + E+   ++G  ++ +   W+ I+Q +++                  D L   G +PSGFR ST+     +     +++ +L P L+ S L F +L  D+   +   +I   L L      P       I SRHVRLCLF+G KV SNIH +RA+   KN  TW F+ +V+  + S+  G+ F++    S ++ IL E  +   ++                  +  E  E S GW  + L+++NG P+  +  +  L GGTP+E+G+EVDP       G    +  Q KQP + ++L   +   + +++ LP  I+GS+ HL +L +YR++L + +L   +++ ++  I  P L +F ++ E P +LD LR+ W EK  + K   K+D+  M   F  +Y +  YPL
Sbjct:  153 KEYITLGDFQAQQKDDLTFKKGQVLHILDKKLDGWWIAQDSKGNKGLVPKTYLQV--------IYQSEEESEEDVEETEDDKTVTMQRLVENVYLKIGYAVKVTV--WL-IRQYIYKMLWEVLVHFVLVPLMSSVDGLVTMGTIPSGFRSSTLAQLLNQGEQYRTYM-YLQPDLNPSQLAFKDLLWDREIQSLPSRISLILTLWSCKMIPLPGASIQILSRHVRLCLFDGAKVWSNIHTVRASWLPKNSRTWTFSPRVTGILPSILDGDCFVRSGCHSPEIGILFELGVTYIRN------------------STGERGELSCGWAFLKLFDTNGIPMPARTYELTLYGGTPYERGVEVDP--SVARRGVFHQLRTQRKQPRLLVKLRTLNTTQRNMLNMLPQTIIGSSSHLPVLVYYRQILGDVLLKERKSMQNSDLICHPLLATFPRLMEQPDILDALRSGWAEKENSMKRSEKRDKEFMKNAFIHVYHNIAYPL 616          
BLAST of NPHP1 vs. Ensembl Xenopus
Match: nfic (nuclear factor I C [Source:Xenbase;Acc:XB-GENE-484367])

HSP 1 Score: 174.481 bits (441), Expect = 7.177e-45
Identity = 112/364 (30.77%), Postives = 184/364 (50.55%), Query Frame = 2
Query: 1685 DILKECGNLPSGFRYSTIFNWSKENSNNSSFIAFLCPKLSDSHLNFSELQADQANSXXXXXXXXXXXXXNKF-----PFISEKFIIKSRHVRLCLFNGNKVLSNIHLIRATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILMEFCIQGYKSKLDTVANADTLKTIDEDFTNDELLEFSIGWTSIPLYESNGQPIITKKGDYVLNGGTPFEKGIEVDPLNKNDSSGKPKFMLNQNKQPYVTIRLSVPSKENKELIDTLPSMIVGSTLHLVLLSFYRKLLTESILDLGRNLTSTKSIYSPFLVSFTQVAECPLLLDTLRNIWXXXXXXXXXXXXXXQVKMNEFFQKIYMDFIYPL 2761
            D L   G +PSGFR ST+     +     +++ +L P L+ S L F +L  D+     +       + L  +     P       I SRHVRLCLF+G KV SNIH +RA+   KN  TW F+ +V+  + S+  G+ F++    S ++ IL E  +   ++                  +  E  E S GW  + L+++NG P+  +  +  L GGTP+E+G+EVDP       G    +  Q KQP + ++L   +   + +++ LP  I+GS+ HL +L +YR++L + +L   +++ ++  I  P L +F ++ E P +LD LR+ W EK  + K   K+D+  M   F  +Y +  YPL
Sbjct:  244 DGLVTMGTIPSGFRSSTLAQLLNQGEQYRTYM-YLQPDLNPSQLAFKDLLWDREACGIQSLPSRISLILTLWSCKMIPLPGASIQILSRHVRLCLFDGAKVWSNIHTVRASWLPKNSRTWTFSPRVTGILPSILDGDCFVRSGCHSPEIGILFELGVTYIRN------------------STGERGELSCGWAFLKLFDTNGIPMPARTYELTLYGGTPYERGVEVDP--SVARRGVFHQLRTQRKQPRLLVKLRTLNTTQRNMLNMLPQTIIGSSSHLPVLVYYRQILGDVLLKERKSMQNSDLICHPLLATFPRLMEQPDILDALRSGWAEKENSMKRSEKRDKEFMKNAFIHVYHNIAYPL 586          
BLAST of NPHP1 vs. Ensembl Xenopus
Match: nfic (nuclear factor I C [Source:Xenbase;Acc:XB-GENE-484367])

HSP 1 Score: 173.326 bits (438), Expect = 1.146e-44
Identity = 111/364 (30.49%), Postives = 182/364 (50.00%), Query Frame = 2
Query: 1685 DILKECGNLPSGFRYSTIFNWSKENSNNSSFIAFLCPKLSDSHLNFSELQADQANSXXXXXXXXXXX-----XXNKFPFISEKFIIKSRHVRLCLFNGNKVLSNIHLIRATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILMEFCIQGYKSKLDTVANADTLKTIDEDFTNDELLEFSIGWTSIPLYESNGQPIITKKGDYVLNGGTPFEKGIEVDPLNKNDSSGKPKFMLNQNKQPYVTIRLSVPSKENKELIDTLPSMIVGSTLHLVLLSFYRKLLTESILDLGRNLTSTKSIYSPFLVSFTQVAECPLLLDTLRNIWXXXXXXXXXXXXXXQVKMNEFFQKIYMDFIYPL 2761
            D L   G +PSGFR ST+     +     +++ +L P L+ S L F +L  D+     +       +          P       I SRHVRLCLF+G KV SNIH +RA+   KN  TW F+ +V+  + S+  G+ F++    S ++ IL E  +   ++                  +  E  E S GW  + L+++NG P+  +  +  L GGTP+E+G+EVDP       G    +  Q KQP + ++L   +   + +++ LP  I+GS+ HL +L +YR++L + +L   +++ ++  I  P L +F ++ E P +LD LR+ W EK  + K   K+D+  M   F  +Y +  YPL
Sbjct:  217 DGLVTMGTIPSGFRSSTLAQLLNQGEQYRTYM-YLQPDLNPSQLAFKDLLWDREACGIQSLPSRISLILTLWSCKMIPLPGASIQILSRHVRLCLFDGAKVWSNIHTVRASWLPKNSRTWTFSPRVTGILPSILDGDCFVRSGCHSPEIGILFELGVTYIRN------------------STGERGELSCGWAFLKLFDTNGIPMPARTYELTLYGGTPYERGVEVDP--SVARRGVFHQLRTQRKQPRLLVKLRTLNTTQRNMLNMLPQTIIGSSSHLPVLVYYRQILGDVLLKERKSMQNSDLICHPLLATFPRLMEQPDILDALRSGWAEKENSMKRSEKRDKEFMKNAFIHVYHNIAYPL 559          
BLAST of NPHP1 vs. Ensembl Xenopus
Match: nfic (nuclear factor I C [Source:Xenbase;Acc:XB-GENE-484367])

HSP 1 Score: 174.096 bits (440), Expect = 1.303e-44
Identity = 130/484 (26.86%), Postives = 236/484 (48.76%), Query Frame = 2
Query: 1331 KKYVLAKTFSSEEEDDLSXXXXXXXXXXXXXXXDWSYVKNNRGETGYVPTSYLKVKLNAPTPKIEEILVPKHNEDENEKGLDTLKEGNMPESELGTKIEDSSDSWIQIKQSMHEKTINDILKECGNLPSGFRYSTIFNWSKENSNNSSFIAFLCPKLSDSHLNFSELQADQANSXXXXXXXXXXXXXNKF-----PFISEKFIIKSRHVRLCLFNGNKVLSNIHLIRATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILMEFCIQGYKSKLDTVANADTLKTIDEDFTNDELLEFSIGWTSIPLYESNGQPIITKKGDYVLNGGTPFEKGIEVDP-LNKNDSSGKPKFMLNQNKQPYVTIRLSVPSKENKELIDTLPSMIVGSTLHLVLLSFYRKLLTESILDLGRNLTSTKSIYSPFLVSFTQVAECPLLLDTLR-NIWXXXXXXXXXXXXXXQVKMNEFFQKIYMDFIYPL 2761
            K+Y+    F ++++DDL+  +G+ + +L+     W   ++++G  G VP +YL+V   +  P +++       + E  +   T+    + E+ +  KI   S                D L   G +PSGFR ST+     +     +++ +L P L+ S L F +L  D+     +       + L  +     P       I SRHVRLCLF+G KV SNIH +RA+   KN  TW F+ +V+  + S+  G+ F++    S ++ IL E  +   ++                  +  E  E S GW  + L+++NG P+  +  +  L GGTP+E+G+EVDP + +  ++G    +  Q KQP + ++L   +   + +++ LP  I+GS+ HL +L +YR++L + +L   +++ ++  I  P L +F ++ E P +LD LR ++ +    +      +D+  M   F  +Y +  YPL
Sbjct:  158 KEYITLGDFQAQQKDDLTFKKGQVLHILDKKLDGWWIAQDSKGNKGLVPKTYLQV-YKSGDPNLDQSEEESEEDVEETEDDKTVTMQRLVEN-VYLKIGYMSSV--------------DGLVTMGTIPSGFRSSTLAQLLNQGEQYRTYM-YLQPDLNPSQLAFKDLLWDREACGIQSLPSRISLILTLWSCKMIPLPGASIQILSRHVRLCLFDGAKVWSNIHTVRASWLPKNSRTWTFSPRVTGILPSILDGDCFVRSGCHSPEIGILFELGVTYIRN------------------STGERGELSCGWAFLKLFDTNGIPMPARTYELTLYGGTPYERGVEVDPSVARRVNTGVFHQLRTQRKQPRLLVKLRTLNTTQRNMLNMLPQTIIGSSSHLPVLVYYRQILGDVLLKERKSMQNSDLICHPLLATFPRLMEQPDILDALRLSVPHLGCASYLFSLHRDKEFMKNAFIHVYHNIAYPL 606          
BLAST of NPHP1 vs. Ensembl Mouse
Match: Nphp1 (nephronophthisis 1 (juvenile) homolog (human) [Source:MGI Symbol;Acc:MGI:1858233])

HSP 1 Score: 192.971 bits (489), Expect = 6.494e-51
Identity = 134/458 (29.26%), Postives = 227/458 (49.56%), Query Frame = 2
Query: 1613 GTKIEDSSDS-WIQIKQSMHEKTIN--DILKECGNLPSGFRYSTIFNWSKENSNNSSFIAFLCPKLSDSHLNFSELQADQANSXXXXXXXXXXXXXNKF-----PFISEKFIIKSRHVRLCLFNGNKVLSNIHLIRATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILMEFCIQGYKSKLDTVANADTLKTIDEDFTNDELLEFSIGWTSIPLYESNGQPIITKKGDYVLNGGTPFEKGIEVDPLNKNDSSGKP-KFMLNQNKQPYVTIRLSVPSKENKELIDTLPSMIVGSTLHLVLLSFYRKLLTESILDLGRNLTSTKSIYSPFLVSFTQVAECPLLLDTLRNIWXXXXXXXXXXXXXXQVKMNEFFQKIYMDFIYPLTKLKDFQNYNLSKENLLQNEERKLSEIIQKMKLDMTSI--LVTDEHSFVPLQFAELDFNIMSRYGK 2953
            G +++  +DS W  +++++ E+ IN  D+L   G +P+GFR ST+     E  N      FL P+L+ S L F +L  D        +     + L  +     P       + SRH+RLCLF+G+KVLSNIH +RA    K   TW F+ +V+  +  +  G+ FI+ N S+ DL IL E  I   ++                  +  E  E S GW  + L++++G PI  K  +  LNGGTP+EKG+EVDP     + G   + M++  +QP + ++L   ++ ++ ++  LP  +VGS     LL FYR++L + +L    NL S   I  P L +F  + E P ++D LR+ W+EK  T K   K+D+  +   F  +Y D + PL        +  ++E       + +++ +++ + +  S+  L++ +    P   +E  F+ +    K
Sbjct:  250 GAQVKQRTDSHWSAVRKAISEQ-INTVDVLATMGAIPAGFRPSTLSQLLDEAGNQFRASYFLQPELTTSQLAFRDLTWDAKAGTIMSRPSRVSLILTLWSCKMIPLPGTSIQVLSRHIRLCLFDGSKVLSNIHTVRAVWQPKKPKTWTFSPQVTGILPCLLDGDCFIRSNSSTPDLGILFELGISYIRN------------------STGERGELSCGWVFLKLFDASGVPIPAKTYELFLNGGTPYEKGVEVDPSVSRRAQGSVFRQMISVRRQPQLLVKLRSLNRRSRAMLSLLPETLVGSMCSAHLLIFYRQILGDVLLRDRTNLQSADLISHPVLATFPLLLEQPDVMDALRSSWSEKESTLKRAEKRDKELLKAEFLLVYHDCVLPLLHSTLLPPFRWAEEETEAARWKAIADFLKQSRENEGSLKALLSPDGVHKPFDLSEQTFDFLGEIRK 688          
BLAST of NPHP1 vs. Ensembl Mouse
Match: Nphp1 (nephronophthisis 1 (juvenile) homolog (human) [Source:MGI Symbol;Acc:MGI:1858233])

HSP 1 Score: 189.504 bits (480), Expect = 8.023e-50
Identity = 135/459 (29.41%), Postives = 230/459 (50.11%), Query Frame = 2
Query: 1613 GTKIEDSSDS-WIQIKQSMHEKTIN--DILKECGNLPSGFRYSTIFNWSKE-NSNNSSFIAFLCPKLSDSHLNFSELQADQANSXXXXXXXXXXXXXNKF-----PFISEKFIIKSRHVRLCLFNGNKVLSNIHLIRATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILMEFCIQGYKSKLDTVANADTLKTIDEDFTNDELLEFSIGWTSIPLYESNGQPIITKKGDYVLNGGTPFEKGIEVDPLNKNDSSGKP-KFMLNQNKQPYVTIRLSVPSKENKELIDTLPSMIVGSTLHLVLLSFYRKLLTESILDLGRNLTSTKSIYSPFLVSFTQVAECPLLLDTLRNIWXXXXXXXXXXXXXXQVKMNEFFQKIYMDFIYPLTKLKDFQNYNLSKENLLQNEERKLSEIIQKMKLDMTSI--LVTDEHSFVPLQFAELDFNIMSRYGK 2953
            G +++  +DS W  +++++ E+ IN  D+L   G +P+GFR ST+     E N   +S+  FL P+L+ S L F +L  D        +     + L  +     P       + SRH+RLCLF+G+KVLSNIH +RA    K   TW F+ +V+  +  +  G+ FI+ N S+ DL IL E  I   ++                  +  E  E S GW  + L++++G PI  K  +  LNGGTP+EKG+EVDP     + G   + M++  +QP + ++L   ++ ++ ++  LP  +VGS     LL FYR++L + +L    NL S   I  P L +F  + E P ++D LR+ W+EK  T K   K+D+  +   F  +Y D + PL        +  ++E       + +++ +++ + +  S+  L++ +    P   +E  F+ +    K
Sbjct:  250 GAQVKQRTDSHWSAVRKAISEQ-INTVDVLATMGAIPAGFRPSTLSQLLDEGNQFRASY--FLQPELTTSQLAFRDLTWDAKAGTIMSRPSRVSLILTLWSCKMIPLPGTSIQVLSRHIRLCLFDGSKVLSNIHTVRAVWQPKKPKTWTFSPQVTGILPCLLDGDCFIRSNSSTPDLGILFELGISYIRN------------------STGERGELSCGWVFLKLFDASGVPIPAKTYELFLNGGTPYEKGVEVDPSVSRRAQGSVFRQMISVRRQPQLLVKLRSLNRRSRAMLSLLPETLVGSMCSAHLLIFYRQILGDVLLRDRTNLQSADLISHPVLATFPLLLEQPDVMDALRSSWSEKESTLKRAEKRDKELLKAEFLLVYHDCVLPLLHSTLLPPFRWAEEETEAARWKAIADFLKQSRENEGSLKALLSPDGVHKPFDLSEQTFDFLGEIRK 687          
BLAST of NPHP1 vs. UniProt/SwissProt
Match: sp|Q9TU19|NPHP1_CANLF (Nephrocystin-1 (Fragment) OS=Canis lupus familiaris OX=9615 GN=NPHP1 PE=1 SV=1)

HSP 1 Score: 205.682 bits (522), Expect = 2.853e-55
Identity = 150/487 (30.80%), Postives = 249/487 (51.13%), Query Frame = 2
Query: 1331 KKYVLAKTFSSEEEDDLSXXXXXXXXXXXXXXXDWSYVKNNRGETGYVPTSYLKVKLNAPTPKIEEILVPKHNEDENEKGLDTLKEGNMPESELGTKIEDSSDS-WIQIKQSMHEKTIN--DILKECGNLPSGFRYSTIFNWSKE-NSNNSSFIAFLCPKLSDSHLNFSELQADQANSXXXXXXXXXXXXXNKF-----PFISEKFIIKSRHVRLCLFNGNKVLSNIHLIRATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILMEFCIQGYKSKLDTVANADTLKTIDEDFTNDELLEFSIGWTSIPLYESNGQPIITKKGDYVLNGGTPFEKGIEVDPLNKNDSSGKP-KFMLNQNKQPYVTIRLSVPSKENKELIDTLPSMIVGSTLHLVLLSFYRKLLTESILDLGRNLTSTKSIYSPFLVSFTQVAECPLLLDTLRNIWXXXXXXXXXXXXXXQVKMNEFFQKIYMDFIYPL 2761
            K+Y+    F++++  DL+  + E +L++E     W   KN +G  G +P +Y++     P  K E        +D +E+           ++  G +++  +DS W  +++++ E+ IN  D+L   G +P+GFR ST+F   +E N   +S+  FL P+L+ S L F +L  D      + +       L  +     P       + SRHVRLC+F+GNKVLSNIH +RAT   K   TW F+ +V+  +  +  G+ FI+ N SS DL IL E  I   ++                  +  E  E S GW  + L++++G PI  K  +  LNGGTP+EKG+EVDP     + G     M+   +QP + ++L   ++ +++L+  LP  ++GS   + LL FYR++L + +L    ++ S   I +P L +F ++ E P ++D LR+ W EK  T K   K+D+  +   F  +Y D + PL
Sbjct:   43 KEYIAVGDFTAQQAGDLTFKKREILLIIEKKPDGWWIAKNAKGNKGLIPRTYVE-----PYNKEE-------GQDTSEEEDSEEDVEVGDQTAGGEEVKQRTDSHWSAVQKAISEQ-INTVDVLTTMGAIPAGFRPSTLFQLLEEGNQFRASY--FLQPELTPSQLAFRDLMWDAKTGTIRSRPSRVSFILTLWSCKMIPLPGTSIQVLSRHVRLCIFDGNKVLSNIHTVRATWQSKKPKTWTFSPQVTGILPCLLDGDCFIRSNSSSPDLGILFELGISYIRN------------------STGERGELSCGWVFLKLFDASGIPIPAKTYELFLNGGTPYEKGVEVDPSVSRRAYGSVFHQMMTMRRQPQLLVKLRSLNRRSRDLLSLLPETLIGSMCTIHLLIFYRQILGDVLLKDRTSMQSADLISNPVLATFPKLLEQPDMMDALRSSWAEKESTLKRSEKRDKEFLKAMFLLVYHDCVVPL 496          
BLAST of NPHP1 vs. UniProt/SwissProt
Match: sp|Q9QY53|NPHP1_MOUSE (Nephrocystin-1 OS=Mus musculus OX=10090 GN=Nphp1 PE=1 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 3.708e-51
Identity = 153/550 (27.82%), Postives = 266/550 (48.36%), Query Frame = 2
Query: 1337 YVLAKTFSSEEEDDLSXXXXXXXXXXXXXXXDWSYVKNNRGETGYVPTSYLKVKLNAPTPKIEEILVPKHNEDENEKGLDTLKEGNMPESELGTKIEDSSDS-WIQIKQSMHEKTIN--DILKECGNLPSGFRYSTIFNWSKENSNNSSFIAFLCPKLSDSHLNFSELQADQANSXXXXXXXXXXXXXNKF-----PFISEKFIIKSRHVRLCLFNGNKVLSNIHLIRATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILMEFCIQGYKSKLDTVANADTLKTIDEDFTNDELLEFSIGWTSIPLYESNGQPIITKKGDYVLNGGTPFEKGIEVDPLNKNDSSGKP-KFMLNQNKQPYVTIRLSVPSKENKELIDTLPSMIVGSTLHLVLLSFYRKLLTESILDLGRNLTSTKSIYSPFLVSFTQVAECPLLLDTLRNIWXXXXXXXXXXXXXXQVKMNEFFQKIYMDFIYPLTKLKDFQNYNLSKENLLQNEERKLSEIIQKMKLDMTSI--LVTDEHSFVPLQFAELDFNIMSRYGK 2953
            Y+    F++++  DL+  +G+ + ++E     W   K+  G  G +P +YL+     P  K E+ L      +E  +         + E+  G +++  +DS W  +++++ E+ IN  D+L   G +P+GFR ST+     E  N      FL P+L+ S L F +L  D        +     + L  +     P       + SRH+RLCLF+G+KVLSNIH +RA    K   TW F+ +V+  +  +  G+ FI+ N S+ DL IL E  I   ++                  +  E  E S GW  + L++++G PI  K  +  LNGGTP+EKG+EVDP     + G   + M++  +QP + ++L   ++ ++ ++  LP  +VGS     LL FYR++L + +L    NL S   I  P L +F  + E P ++D LR+ W+EK  T K   K+D+  +   F  +Y D + PL        +  ++E       + +++ +++ + +  S+  L++ +    P   +E  F+ +    K
Sbjct:  160 YIALGDFAAQQTGDLTFKKGDVLHIIEKKPDGWWLAKDAEGVEGLIPRTYLE-----PYNK-EDKLESSEGSEEGGEEDGEEDVEVVDETADGAQVKQRTDSHWSAVRKAISEQ-INTVDVLATMGAIPAGFRPSTLSQLLDEAGNQFRASYFLQPELTTSQLAFRDLTWDAKAGTIMSRPSRVSLILTLWSCKMIPLPGTSIQVLSRHIRLCLFDGSKVLSNIHTVRAVWQPKKPKTWTFSPQVTGILPCLLDGDCFIRSNSSTPDLGILFELGISYIRN------------------STGERGELSCGWVFLKLFDASGVPIPAKTYELFLNGGTPYEKGVEVDPSVSRRAQGSVFRQMISVRRQPQLLVKLRSLNRRSRAMLSLLPETLVGSMCSAHLLIFYRQILGDVLLRDRTNLQSADLISHPVLATFPLLLEQPDVMDALRSSWSEKESTLKRAEKRDKELLKAEFLLVYHDCVLPLLHSTLLPPFRWAEEETEAARWKAIADFLKQSRENEGSLKALLSPDGVHKPFDLSEQTFDFLGEIRK 684          
BLAST of NPHP1 vs. UniProt/SwissProt
Match: sp|O15259|NPHP1_HUMAN (Nephrocystin-1 OS=Homo sapiens OX=9606 GN=NPHP1 PE=1 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 7.765e-47
Identity = 123/375 (32.80%), Postives = 190/375 (50.67%), Query Frame = 2
Query: 1685 DILKECGNLPSGFRYSTIFNWSKENSNNSSFIAFLCPKLSDSHLNFSELQADQANSXXXXXXXXXXXXXNKF-----PFISEKFIIKSRHVRLCLFNGNKVLSNIHLIRATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILMEFCIQGYKSKLDTVANADTLKTIDEDFTNDELLEFSIGWTSIPLYESNGQPIITKKGDYVLNGGTPFEKGIEVDPLNKNDSSGKPKF-MLNQNKQPYVTIRLSVPSKENKELIDTLPSMIVGSTLHLVLLSFYRKLLTESILDLGRNLTSTKSIYSPFLVSFTQVAECPLLLDTLRNIWXXXXXXXXXXXXXXQVKMNEFFQKIYMDFIYPL---TKLKDFQ 2782
            D+L   G +P+GFR ST+    +E  N      FL P+L  S L F +L  D      + +     + L  +     P       + SRHVRLCLF+GNKVLSNIH +RAT   K   TW F+ +V+  +  +  G+ FI+ N +S DL IL E  I   ++                  +  E  E S GW  + L++++G PI  K  +  LNGGTP+EKGIEVDP     + G   + ++   +QP + ++L   ++ ++ ++  LP  ++G+   + LL FYR++L + +L    +L ST  I  P L +F  + E P ++D LR+ W  K  T K   K+D+  +   F  +Y D + PL   T+L  F+
Sbjct:  318 DVLTTMGAIPAGFRPSTLSQLLEEG-NQFRANYFLQPELMPSQLAFRDLMWDATEGTIRSRPSRISLILTLWSCKMIPLPGMSIQVLSRHVRLCLFDGNKVLSNIHTVRATWQPKKPKTWTFSPQVTRILPCLLDGDCFIRSNSASPDLGILFELGISYIRN------------------STGERGELSCGWVFLKLFDASGVPIPAKTYELFLNGGTPYEKGIEVDPSISRRAHGSVFYQIMTMRRQPQLLVKLRSLNRRSRNVLSLLPETLIGNMCSIHLLIFYRQILGDVLLKDRMSLQSTDLISHPMLATFPMLLEQPDVMDALRSSWAGKESTLKRSEKRDKEFLKSTFLLVYHDCVLPLLHSTRLPPFR 673          
BLAST of NPHP1 vs. TrEMBL
Match: A0A0H3YFE3 (NPHP1 OS=Schmidtea mediterranea OX=79327 GN=NPHP1 PE=2 SV=1)

HSP 1 Score: 1112.06 bits (2875), Expect = 0.000e+0
Identity = 589/589 (100.00%), Postives = 589/589 (100.00%), Query Frame = 2
Query: 1193 IDVIESHMSSLSNEASETTIQSQFSSKVRSYNDEEDLAGQNMLQIGKKYVLAKTFSSEEEDDLSXXXXXXXXXXXXXXXDWSYVKNNRGETGYVPTSYLKVKLNAPTPKIEEILVPKHNEDENEKGLDTLKEGNMPESELGTKIEDSSDSWIQIKQSMHEKTINDILKECGNLPSGFRYSTIFNWSKENSNNSSFIAFLCPKLSDSHLNFSELQADQANSXXXXXXXXXXXXXNKFPFISEKFIIKSRHVRLCLFNGNKVLSNIHLIRATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILMEFCIQGYKSKLDTVANADTLKTIDEDFTNDELLEFSIGWTSIPLYESNGQPIITKKGDYVLNGGTPFEKGIEVDPLNKNDSSGKPKFMLNQNKQPYVTIRLSVPSKENKELIDTLPSMIVGSTLHLVLLSFYRKLLTESILDLGRNLTSTKSIYSPFLVSFTQVAECPLLLDTLRNIWXXXXXXXXXXXXXXQVKMNEFFQKIYMDFIYPLTKLKDFQNYNLSKENLLQNEERKLSEIIQKMKLDMTSILVTDEHSFVPLQFAELDFNIMSRYGKHK 2959
            IDVIESHMSSLSNEASETTIQSQFSSKVRSYNDEEDLAGQNMLQIGKKYVLAKTFSSEEEDDLSGIEGEEILLLEIMEGDWSYVKNNRGETGYVPTSYLKVKLNAPTPKIEEILVPKHNEDENEKGLDTLKEGNMPESELGTKIEDSSDSWIQIKQSMHEKTINDILKECGNLPSGFRYSTIFNWSKENSNNSSFIAFLCPKLSDSHLNFSELQADQANSQQKIQRQLQLIKLNKFPFISEKFIIKSRHVRLCLFNGNKVLSNIHLIRATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILMEFCIQGYKSKLDTVANADTLKTIDEDFTNDELLEFSIGWTSIPLYESNGQPIITKKGDYVLNGGTPFEKGIEVDPLNKNDSSGKPKFMLNQNKQPYVTIRLSVPSKENKELIDTLPSMIVGSTLHLVLLSFYRKLLTESILDLGRNLTSTKSIYSPFLVSFTQVAECPLLLDTLRNIWNEKLKTTKDLNKKDQVKMNEFFQKIYMDFIYPLTKLKDFQNYNLSKENLLQNEERKLSEIIQKMKLDMTSILVTDEHSFVPLQFAELDFNIMSRYGKHK
Sbjct:  398 IDVIESHMSSLSNEASETTIQSQFSSKVRSYNDEEDLAGQNMLQIGKKYVLAKTFSSEEEDDLSGIEGEEILLLEIMEGDWSYVKNNRGETGYVPTSYLKVKLNAPTPKIEEILVPKHNEDENEKGLDTLKEGNMPESELGTKIEDSSDSWIQIKQSMHEKTINDILKECGNLPSGFRYSTIFNWSKENSNNSSFIAFLCPKLSDSHLNFSELQADQANSQQKIQRQLQLIKLNKFPFISEKFIIKSRHVRLCLFNGNKVLSNIHLIRATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILMEFCIQGYKSKLDTVANADTLKTIDEDFTNDELLEFSIGWTSIPLYESNGQPIITKKGDYVLNGGTPFEKGIEVDPLNKNDSSGKPKFMLNQNKQPYVTIRLSVPSKENKELIDTLPSMIVGSTLHLVLLSFYRKLLTESILDLGRNLTSTKSIYSPFLVSFTQVAECPLLLDTLRNIWNEKLKTTKDLNKKDQVKMNEFFQKIYMDFIYPLTKLKDFQNYNLSKENLLQNEERKLSEIIQKMKLDMTSILVTDEHSFVPLQFAELDFNIMSRYGKHK 986          

HSP 2 Score: 246.514 bits (628), Expect = 3.510e-64
Identity = 153/153 (100.00%), Postives = 153/153 (100.00%), Query Frame = 2
Query:   44 MEKLSXXXXXXXXXXSDVNDLIKESKNYKKLDKESLDKNIKKCQNLLLDVDDIIEVILACKKPPTISENDPTLATFDXXXXXXXXXXXXXXXVLEDNMSNLEKFYKKNFEDSIPKEQPDLEKSKKSPSNPIEKSGDLHTEVGKSISKPLDNNQ 502
            MEKLSEIITENEEIISDVNDLIKESKNYKKLDKESLDKNIKKCQNLLLDVDDIIEVILACKKPPTISENDPTLATFDSDKKSSHAKALKAKKVLEDNMSNLEKFYKKNFEDSIPKEQPDLEKSKKSPSNPIEKSGDLHTEVGKSISKPLDNNQ
Sbjct:    1 MEKLSEIITENEEIISDVNDLIKESKNYKKLDKESLDKNIKKCQNLLLDVDDIIEVILACKKPPTISENDPTLATFDSDKKSSHAKALKAKKVLEDNMSNLEKFYKKNFEDSIPKEQPDLEKSKKSPSNPIEKSGDLHTEVGKSISKPLDNNQ 153          

HSP 3 Score: 115.546 bits (288), Expect = 2.858e-22
Identity = 64/78 (82.05%), Postives = 64/78 (82.05%), Query Frame = 2
Query:  767 EIQEDPINVEHKDN--------------VVSKDLNITNKNHDEIEKSEKQELNENISPIESEQEDNEINMNSKLNEIQ 958
            EIQEDPINVEHKDN              VVSKDLNITNKNHDEIEKSEKQELNENISPIESEQEDNEINMNSKLNEIQ
Sbjct:  242 EIQEDPINVEHKDNGKGLNDDPNLNKVSVVSKDLNITNKNHDEIEKSEKQELNENISPIESEQEDNEINMNSKLNEIQ 319          
BLAST of NPHP1 vs. TrEMBL
Match: A0A1S3KEG0 (nephrocystin-1-like OS=Lingula unguis OX=7574 GN=LOC106181136 PE=4 SV=2)

HSP 1 Score: 257.684 bits (657), Expect = 2.143e-72
Identity = 152/443 (34.31%), Postives = 255/443 (57.56%), Query Frame = 2
Query: 1643 WIQIKQSMHEKTINDILKECGNLPSGFRYSTIFNWSKENSNNSSFIAFLCPKLSDSHLNFSELQADQANSXXXXXXXX-----XXXXXNKFPFISEKFIIKSRHVRLCLFNGNKVLSNIHLIRATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILMEFCIQGYKSKLDTVANADTLKTIDEDFTNDELLEFSIGWTSIPLYESNGQPIITKKGDYVLNGGTPFEKGIEVDP-LNKNDSSGKPKFMLNQNKQPYVTIRLSVPSKENKELIDTLPSMIVGSTLHLVLLSFYRKLLTESILDLGRNLTSTKSIYSPFLVSFTQVAECPLLLDTLRNIWXXXXXXXXXXXXXXQVKMNEFFQKIYMDFIYPLTKLKDFQNYNLSKENLLQNEERKLSEIIQ--KMKLDMTSILVTDEHSFVPLQFAELDFNIMSRY 2947
            W  IK+S+ E +  D+L   G +PSGFR  T+     +  +  +   +L PKLS S+L+F +L  +   ++ + +         L    + P       + +  VR+CLF+G KVLSNI  +R+  + K L  W+F+ K+++++  V++ E+F++ N+   D+ +L E C+ GYK           +KT        EL EFS GW  +PL+  +G P + K  D  +NGGTP+EKGIEVDP +++ +S+ K + ++++N+QP ++++LS P+KE KE +DTLP ++VGS  HL  LS+YR+ L +++L    ++ ST  ++SPFL+SF  V E P +LD  R  W EKLK TK  +K+D   M E F++ +++  YPL    + Q+Y     ++ QN   +L++I Q  K K    + L++ + + +P    EL F+++  +
Sbjct:   27 WSSIKKSLKETSATDVLHAMGAVPSGFRLPTLGKLYADG-DEYTMKNYLIPKLSTSNLSFRDLFFNPVTNKIRPRPVRFQKIVTLQAARQIPHAGTGIEVINYCVRMCLFDGAKVLSNIVTVRSFCTDKELKNWSFHTKLTDNLPCVDYAEIFVRDNKGDKDIGVLFELCL-GYKR----------VKT-------GELGEFSCGWAHLPLFAEDGTPALNKTYDLYVNGGTPYEKGIEVDPSVSRRESTNKWRALVSKNRQPRLSVKLSAPTKEQKEQLDTLPDVLVGSMCHLGSLSYYRQFLADALLRDRLDMQSTDLVHSPFLMSFPSVMEQPDILDVFRASWIEKLKITKRGDKRDAEHMKELFRQTFLETCYPLCHSANLQHYKFGDADVEQNRAAELTKIAQMNKEKNSALAALLSPDVAHLPFDMKELSFDVLGPF 450          
BLAST of NPHP1 vs. TrEMBL
Match: A0A2T7NXL4 (SH3 domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_13595 PE=4 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 2.018e-65
Identity = 166/541 (30.68%), Postives = 282/541 (52.13%), Query Frame = 2
Query: 1367 EEDDLSXXXXXXXXXXXXXXXDWSYVKNNRGETGYVPTSYLKVKLNAPTPKIEEILVPKHNEDENEKGLDTLKEGNMPESELGTKIEDSSDSWIQIKQSMHEKTINDILKECGNLPSGFRYSTIFNWSKENSNNSSF--IAFLCPKLSDSHLNFSELQADQANSXXXXXXXX-----XXXXXNKFPFISEKFIIKSRHVRLCLFNGNKVLSNIHLIRATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILMEFCIQGYKSKLDTVANADTLKTIDEDFTNDELLEFSIGWTSIPLYESNGQPIITKKGDYVLNGGTPFEKGIEVDP-LNKNDSSGKPKFMLNQNKQPYVTIRLSVPSKENKELIDTLPSMIVGSTLHLVLLSFYRKLLTESILDLGRNLTSTKSIYSPFLVSFTQVAECPLLLDTLRNIWXXXXXXXXXXXXXXQVKMNEFFQKIYMDFIYPLTKLKDFQNYNLSKENLLQN---EERKLSEIIQKMKLDMTSILVTDEHSFVPLQFAELDFNIMSRYGKH 2956
            EE DLS   GE I ++E  E  W   +N+RG+TG VP++YL++                HN+  + +  D  +EG   E   G  +  +   W  IK+++ E T++D+L   G +PSGFR ST+   +K+++   ++  +++L  KLS S+L + +L  D ++++ + +         +    + P  S    +  R VR+CLF+GN +LSNIH ++ +   K+  TW+F  KV++ M      EVF++ N +  ++ IL E CI  +++                  +  E  E S GW  +PL   NG     K  D  +NGGTP+EKG+EVDP +++  +S     +++ N+QP + +RLS+P KE K+ +DTLP  +VG+T+ L   S+YR++L + +L    +L ST+ I++P L  F   AE   L+  LR  W EK ++   + K+D+  M + F++  MD +YP+  +    +Y     + +Q+   E  +  E+ Q  +  +  +L +D    +  Q  E+D  I S  G H
Sbjct:  168 EEGDLSFKRGEVITVIETREDGWWMAENDRGDTGLVPSTYLQL----------------HNKHRDVQQDDEEEEGADSEQGDGDTVRRTKKLWSGIKKAITETTVSDVLHAMGAVPSGFRQSTL---AKKHAEGVTYRTVSYLAIKLSPSNLIYKDLFFDPSSNRIRPRMVRIERIVTISACRQIPVPSAGIDVLDRTVRICLFDGNNILSNIHCVKVSSIDKSQNTWSFTTKVTDTMDLASHAEVFVRSNNTVDNIGILFELCITTFRA------------------STKERTEMSCGWAHLPLLGENGTATQNKSFDLHVNGGTPYEKGVEVDPRISRRTTSNALMSLISGNRQPRLVVRLSIPKKEFKDQMDTLPEPLVGNTILLPFYSYYRQILADVLLRDRLDLDSTELIHNPLLSLFPTAAEQMDLMQLLRASWLEKQRSAHRVEKRDEEYMKDLFKQAVMDTVYPVLHIAALPSYQPGDYDNVQSRFEEVHRFRELRQTRQSTLAVLLSSD----IIFQPFEMDEMIFSMLGPH 667          
BLAST of NPHP1 vs. TrEMBL
Match: A0A2G8L9U0 (Putative nephrocystin-1 OS=Stichopus japonicus OX=307972 GN=BSL78_06173 PE=4 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 3.605e-64
Identity = 175/560 (31.25%), Postives = 287/560 (51.25%), Query Frame = 2
Query: 1301 LAGQNMLQIGKKYVLAKTFSSEEEDDLSXXXXXXXXXXXXXXXDWSYVKNNRGETGYVPTSYLKVKLNAPTPKIEEILVPKHNEDENEKGLDTLKEGNMPESELGTKIEDSSDSWIQIKQSMHEKTINDILKECGNLPSGFRYSTIFNWSKENSNNSSFIAFLCPKLSDSHLNFSELQADQANSXXXXXXXXXXXXXN-----KFPFISEKFIIKSRHVRLCLFNGNKVLSNIHLIRATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILMEFCIQGYKSKLDTVANADTLKTIDEDFTNDELLEFSIGWTSIPLY-ESNGQPIITKKGDYVLNGGTPFEKGIEVDP-LNKNDSSGKPKFMLNQNKQPYVTIRLSVPSKENKELIDTLPSMIVGSTLHLVLLSFYRKLLTESILDLGRNLTSTKSIYSPFLVSFTQVAECPLLLDTLRNIWXXXXXXXXXXXXXXQVKMNEFFQKIYMDFIYPLTKLKDFQNYNLSKENLLQNEERKLSEI----IQKMKLDMTSILVTDEHSFVPLQFAELDFNIMSRY 2947
            L G+NM      +V+   F  EE  DL+  +G  + +L   E  W   ++  G  G VP++YLK+K ++      +   P+ + DEN            P S          + W  +++S+HE +  D+L   G +P+GFR S     +K +S       FL PKLS S+L+FS+L  D   SQ +         L+       P +      KSRH R+ +F+G +VLSNIH ++AT +  +L TW F+ +VS  + S+  GE FI+ ++S  ++ +L+E C+   ++K                    E  E S GW  +PL+ E  G PII K  +  +NGGTPFE+G+EVDP +++  S+ K + ML  NKQP + ++L  P+KE K  ++TLP  IV    +L LLSFYR++L +++L    ++ ST+ I+SP L +F + A  P ++D LR++WNEK ++TK   K+D  +M   F   +M+  YP+       +Y+      +++E+ +   I        +  + + L++      P   +E+ F+I+  Y
Sbjct:  270 LEGENM------FVVLCDFDGEEPTDLTVKQGNVVTILSTREDGWWMAEDEEGNKGMVPSTYLKLKRDSVDYNAVQSPEPEADADEN----------FSPRS--------GKELWKSVRKSVHETSATDVLSAMGAIPAGFRPSMTAQQNKLSS-------FLKPKLSPSNLSFSDLLWDPQTSQLRAVPCRLQKMLSLVLVRNMPAMGVGLETKSRHARIAIFDGKEVLSNIHTVQATWNESDLKTWRFSPRVSGILPSILDGECFIRSDKSDKNVGLLIELCVYYVRTK------------------TGEKGELSCGWVHLPLFSEETGGPIINKLYELQVNGGTPFEQGVEVDPSISRKVSTSKLRSMLTANKQPRLHLKLIAPTKEQKTQLETLPFTIVSVASYLPLLSFYRRILADAVLRDRIDIQSTELIHSPLLANFPKAANLPDVMDGLRSMWNEKKRSTKKSEKRDGEQMKALFISAFMESAYPVLYSATLPDYHWPD---IESEQVRWESISNFTAASHQKGILTALLSPGKMHTPFHTSEVSFDILGAY 777          
BLAST of NPHP1 vs. TrEMBL
Match: A0A1V4IGI0 (Nephrocystin-1 OS=Patagioenas fasciata monilis OX=372326 GN=NPHP1 PE=4 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 1.259e-62
Identity = 163/547 (29.80%), Postives = 284/547 (51.92%), Query Frame = 2
Query: 1331 KKYVLAKTFSSEEEDDLSXXXXXXXXXXXXXXXDWSYVKNNRGETGYVPTSYLKVKLNAPTPKIEEILVPKHNEDENEKGLDTLKEGNMPESELGTKIEDSSDS-WIQIKQSMHEKTINDILKECGNLPSGFRYSTIFNWSKE-NSNNSSFIAFLCPKLSDSHLNFSELQADQ-----ANSXXXXXXXXXXXXXNKFPFISEKFIIKSRHVRLCLFNGNKVLSNIHLIRATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILMEFCIQGYKSKLDTVANADTLKTIDEDFTNDELLEFSIGWTSIPLYESNGQPIITKKGDYVLNGGTPFEKGIEVDP-LNKNDSSGKPKFMLNQNKQPYVTIRLSVPSKENKELIDTLPSMIVGSTLHLVLLSFYRKLLTESILDLGRNLTSTKSIYSPFLVSFTQVAECPLLLDTLRNIWXXXXXXXXXXXXXXQVKMNEFFQKIYMDFIYPLTKLKDFQNYNLSKENLLQNEERKLSEIIQKMKLDMTSI--LVTDEHSFVPLQFAELDFNIMS 2941
            K+ +    FS+++E DL+  +GE +L+ +     W   +N+RGE G VP +YL V                +NEDE  +         + E+  GT+I+  +DS W  I++++ E    ++L   G +P+GFR ST+F   +E N   +S+  FL P+L+ S L F +L  D           ++   + +      P       + SRHVRLCLF+GN+VLSNIH +RAT   KN  TW+F+ KV+  + S+  G+ F++ N  S+D+ IL E  I   ++                  +  E  E S GW  + L+  NG P+  K  + +LNGGTP+E+G+EVDP +++   SG    ++   KQP + ++L   S ++K+ ++ LP  ++GS  +  LL FYR++L +++L    +  ST+ I +P L +F Q+ + P L+D LR+ W ++  T K   K+DQ  +   F   Y D ++PL       +Y  ++E    +  + +++ ++K + +  ++  L++ E++      +EL ++ + 
Sbjct:  160 KECIAVGNFSAQQEGDLTFTKGEVLLIHDKKADGWWVAENSRGERGLVPRTYLAV----------------YNEDEENQEQSEEHIEVVDETADGTEIKKRTDSHWSAIRRAIAENDTVEVLATTGAVPAGFRLSTLFQLLQEGNEFRASY--FLQPELTPSQLAFKDLVWDSEKNTICPRPTRVSLVVTVCSCKMIPLPGVSIQVLSRHVRLCLFDGNRVLSNIHTVRATWQPKNPQTWSFSPKVTGILPSLLDGDCFVRSNSLSSDIGILFELGITYIRN------------------STGERGELSCGWAFLKLFTPNGLPVPPKVHELLLNGGTPYERGVEVDPSISRRAGSGVFHQLITLKKQPVLAVKLKSLSAQSKDTLNLLPETLIGSMCYAHLLVFYRQILGDALLRDRISTQSTELICNPVLATFPQLMDQPDLMDALRSAWADRETTLKRSEKRDQEFLKSQFVLAYHDSVFPLLHSTALPDYKWAEEESEASRWKVIADFLKKSRENDGALQYLLSSENTHKAFDISELAYDFLG 670          
BLAST of NPHP1 vs. Ensembl Cavefish
Match: nphp1 (nephrocystin 1 [Source:NCBI gene;Acc:103027708])

HSP 1 Score: 172.17 bits (435), Expect = 2.850e-44
Identity = 151/569 (26.54%), Postives = 264/569 (46.40%), Query Frame = 2
Query: 1280 SYNDEEDLAGQNMLQIG--KKYVLAKTFSSEEEDDLSXXXXXXXXXXXXXXXDWSYVKNNRGETGYVPTSYLKVKLNAPTPKIEEILVPKHNEDENEKGLDTLKEGNMPESELGTKI-EDSSDS---WIQIKQSMHEKTINDILKECGNLPSGFRYSTIFNWSKENSNNSSFIAFLCPKLSDSHLNFSELQADQANSXXXXXXXXXXXXXNKF-----PFISEKFIIKSRHVRLCLFNGNKVLSNIHLIRATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILMEFCIQGYKSKLDTVANADTLKTIDEDFTNDELLEFSIGWTSIPLYESNGQPIITKKGDYVLNGGTPFEKGIEVDPLN--KNDSSGKPKFMLNQNKQPYVTIRLSVPSKENKELIDTLPSMIVG--STLHLVLLSFYRKLLTESILDLGRNLTSTKSIYSPFLVSFTQVAECPLLLDTLRNIWXXXXXXXXXXXXXXQVKMNEFFQKIYMDFIYPLTKLKDFQNYNLSKENLLQNEERKLSEIIQKMKLDMTSILVTDEHSFVPLQFAELDFNIMS 2941
            + +DE D   QN       + YV    F+ EEE DL+  +G  + +L+  E  W   ++ +G  G VP +YLKV             +  H++     G DT +E +  E   G KI ED   +   W  I++++ E    D+L   G +P GFR ST+    +E ++  +   ++ P+LS S L F +LQ D    +   +     + +  +     P       + SRH+R C FNG +VLSNIH +RAT +  +  TW+F+ ++S  +  +  G+ FI+ +  S +L IL E  I   ++                  +  E  + S GW  + L++ NG  I  +  +  ++GGTP+E   + D  +  +  S+G  + ML   K P + ++L  P    +E ++ LP  I G  ST+H  LLS YR+LL +++L     + +   I +  L +F  V +   L+D  R +W E     K   KKD   + + F+ +YM  ++PL    +   Y  + EN      R +     K+  +    +++  H+      +++ +++++
Sbjct:  141 AADDEVDETAQNYTARKGIRTYVALSDFTGEEEGDLTVQKGAVLRVLQKNEDGWWLAQDAKGNKGLVPRNYLKV-------------ISPHDQ-----GRDTEEEESDEEQGDGKKIAEDKQRTLQNWDTIRRAVTEIDATDVLSAMGAIPPGFRTSTLSRLLEEGTSYRAS-HYIQPRLSQSELCFKDLQMDPDTGKVHSRSSRVCLTVTLWSCRMIPPPGVGLQVLSRHIRFCAFNGTEVLSNIHTVRATYNPTSPKTWSFSPRMSNMLPCLLDGDCFIRCDSDSPELGILFELGITYIRN------------------STGERGDLSCGWAFLKLFDENGALIPLRTYELTVHGGTPYEAEADADATSTKRGTSTGVLQQMLLSRKLPKLIVKLKPPKTRVREQLNLLPDTITGCLSTVH--LLSLYRQLLADALLLDRVTMQNADLICNAVLATFPGVLDQSDLMDAFRKLWTESESNLKRSEKKDITVLKKHFESVYMSGVFPLLHSAEMPVYFWADENTENQRARLIYSPEHKISRE---TMLSSSHTHQAFDISQVSYDLLT 667          
BLAST of NPHP1 vs. Ensembl Cavefish
Match: nphp1 (nephrocystin 1 [Source:NCBI gene;Acc:103027708])

HSP 1 Score: 165.236 bits (417), Expect = 4.623e-42
Identity = 143/570 (25.09%), Postives = 258/570 (45.26%), Query Frame = 2
Query: 1268 SKVRSYNDEEDLAGQNMLQIG--KKYVLAKTFSSEEEDDLSXXXXXXXXXXXXXXXDWSYVKNNRGETGYVPTSYLKVKLNAPTPKIEEILVPKHNEDENEKGLDTLKEGNMPES-ELGTKIEDSSDSWIQIKQSMHEKTINDILKECGNLPSGFRYSTIFNWSKENSNNSSFIAFLCPKLSDSHLNFSELQADQANSXXXXXXXXXXXXXNKF-----PFISEKFIIKSRHVRLCLFNGNKVLSNIHLIRATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILMEFCIQGYKSKLDTVANADTLKTIDEDFTNDELLEFSIGWTSIPLYESNGQPIITKKGDYVLNGGTPFEKGIEVDPLN--KNDSSGKPKFMLNQNKQPYVTIRLSVPSKENKELIDTLPSMIVG--STLHLVLLSFYRKLLTESILDLGRNLTSTKSIYSPFLVSFTQVAECPLLLDTLRNIWXXXXXXXXXXXXXXQVKMNEFFQKIYMDFIYPLTKLKDFQNYNLSKENLLQNEERKLSEIIQKMKLDMTSILVTDEHSFVPLQFAELDFNIMS 2941
            +K  + +DE D   QN       + YV    F+ EEE DL+  +G  + +L+  E  W   ++ +G  G VP +YLKV+                  + N + +    +   P           +  +W  I++++ E    D+L   G +P GFR ST+    +E ++  +   ++ P+LS S L F +LQ D    +   +     + +  +     P       + SRH+R C FNG +VLSNIH +RAT +  +  TW+F+ ++S  +  +  G+ FI+ +  S +L IL E  I   ++                  +  E  + S GW  + L++ NG  I  +  +  ++GGTP+E   + D  +  +  S+G  + ML   K P + ++L  P    +E ++ LP  I G  ST+H  LLS YR+LL +++L     + +   I +  L +F  V +   L+D  R +W E     K   KKD   + + F+ +YM  ++PL    +   Y  + EN      R +     K+  +    +++  H+      +++ +++++
Sbjct:  124 TKEDAADDEVDETAQNYTARKGIRTYVALSDFTGEEEGDLTVQKGAVLRVLQKNEDGWWLAQDAKGNKGLVPRNYLKVR--------------SQQNETNSRIVVCANQSLYPHPYPFPPSQPRTLQNWDTIRRAVTEIDATDVLSAMGAIPPGFRTSTLSRLLEEGTSYRAS-HYIQPRLSQSELCFKDLQMDPDTGKVHSRSSRVCLTVTLWSCRMIPPPGVGLQVLSRHIRFCAFNGTEVLSNIHTVRATYNPTSPKTWSFSPRMSNMLPCLLDGDCFIRCDSDSPELGILFELGITYIRN------------------STGERGDLSCGWAFLKLFDENGALIPLRTYELTVHGGTPYEAEADADATSTKRGTSTGVLQQMLLSRKLPKLIVKLKPPKTRVREQLNLLPDTITGCLSTVH--LLSLYRQLLADALLLDRVTMQNADLICNAVLATFPGVLDQSDLMDAFRKLWTESESNLKRSEKKDITVLKKHFESVYMSGVFPLLHSAEMPVYFWADENTENQRARLIYSPEHKISRE---TMLSSSHTHQAFDISQVSYDLLT 655          
BLAST of NPHP1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009598.1 (pep scaffold:Pmarinus_7.0:GL483378:8350:10551:1 gene:ENSPMAG00000008679.1 transcript:ENSPMAT00000009598.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 169.859 bits (429), Expect = 5.411e-44
Identity = 124/484 (25.62%), Postives = 230/484 (47.52%), Query Frame = 2
Query: 1331 KKYVLAKTFSSEEEDDLSXXXXXXXXXXXXXXXDWSYVKNNRGETGYVPTSYLKVKLNAPTPKIEEILVPKHNEDENEKGLDTLKEGNMPESELGTKIEDSSDSWIQIKQSMHEKTINDILKECGNLPSGFRYSTIFNW---SKENSNNSSFIAFLCPKLSDSHLNFSELQADQANSXXXXXXXXXX-----XXXNKFPFISEKFIIKSRHVRLCLFNGNKVLSNIHLIRATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILME----FCIQGYKSKLDTVANADTLKTIDEDFTNDELLEFSIGWTSIPLYESNGQPIITKKGDYVLNGGTPFEKGIEVDPLNKNDSSGKPKFMLNQNKQPYVTIRLSVPSKENKELIDTLPSMIVGSTLHLVLLSFYRKLLTESILDLGRNLTSTKSIYSPFLVSFTQVAECPLLLDTLRNIWXXXXXXXXXXXXXXQVKMNEFFQKIYMD 2746
            K +V    F+S+E  DLS  +G  +L+L      W   ++  G  G VP++YL+ +        ++    +  +D+ E   D  +     E E G++  D+S S   +K ++ + + +  +   G +P GFR ST+        E+++  S    L P+L  S L+F +LQ  +     + +                P       + S HVR+CLF+G +VLSN+H +RAT   +N   W F+ +V   + S+  GE F + + +S +L +L E    + ++ + +  DT   A+            EL E S GW  + L+   G  I +K  +  ++GGTP+E+ +E+DP     + G  + + + N +P + +R+  P+   +  +D LP  +V    ++ +L  YR+LL  ++L+   + T  + +    L S  ++   P ++D LR++W E+    +   + D+  M E F++ + D
Sbjct:  165 KTFVALSDFTSQEAGDLSFRKGAVLLVLRKKPDGWWEAQDEHGARGMVPSTYLQHQKPG-----KDEDDEEDQDDDEEDDEDDEESVPSSEEEAGSRRHDTS-SGRGLKAALDDTSASAAMTAMGAVPPGFRPSTLHRLLLLRGESADEFSTRGHLLPRLGPSQLSFRDLQWSEEQGGVRPRTCRVSRTFYLAGAKAIPPPGPSVQVASLHVRVCLFDGRRVLSNVHAVRATWRPRNPGRWTFSPRVGGLLPSLLDGEFFARSDNASPNLGLLFELGISYVMRSHAAATDTSPAAEL-----------ELGELSCGWAFMRLFAETGLAIASKSYELDVHGGTPYERDVELDPSAAGRAGGALRQIFS-NARPRLLVRVRTPAAPLRRALDRLPQTLVSCVCYVSVLVMYRQLLAGALLEGRGDETDARPVADDVLASLGELVGLPDVMDALRSVWAERRAGLRRAERGDRRLMEETFRRAHRD 630          
BLAST of NPHP1 vs. Ensembl Nematostella
Match: EDO32509 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUV8])

HSP 1 Score: 82.0333 bits (201), Expect = 1.340e-16
Identity = 59/213 (27.70%), Postives = 103/213 (48.36%), Query Frame = 2
Query: 1433 WSYVKNNRGETGYVPTSYLKVKLNAPTPKIEEILVPKHNEDENEKGLDTLKEGNMPESELGTKIEDSSDSWIQIKQ-SMHEKTINDILKECGNLPSGFRYSTIFNWSKENSNNSSFIAFLCPKLSDSHLNFSELQADQANSXXXXXXXX-----XXXXXNKFPFISEKFIIKSRHVRLCLFNGNK--VLSNIHLIRATVSGKNLTTWNFNLKV 2047
            W   +N+ G+ G +P + +K+  N    + ++ L   H+++ ++        G++P S            W  +K+ S  E ++ D+LK  G +PSGF+ +T+   +KE     S  +++ PKL  SHL F +L  D  N Q             ++   K P       +  RHVR+ L++  +  +LSN+H +RAT + K+  TW+F  KV
Sbjct:  152 WWIAENSVGKRGVIPKTLVKIVGNEDKERQKKELA--HDQENDQ-------VGDLPPSP----TRSGKQLWNSLKKGSKQETSVTDVLKVMGAMPSGFKSTTLGRLAKEERFMVS--SWVVPKLRASHLGFRDLVWDPVNKQIAPWPVKVNRVFTVVVARKIPLPGTGVQVLCRHVRIALWDWRRKQILSNVHTVRATTTEKDPLTWSFTAKV 349          
BLAST of NPHP1 vs. Ensembl Medaka
Match: nphp1 (nephrocystin 1 [Source:NCBI gene;Acc:101156350])

HSP 1 Score: 121.709 bits (304), Expect = 2.228e-28
Identity = 102/378 (26.98%), Postives = 177/378 (46.83%), Query Frame = 2
Query: 1337 YVLAKTFSSEEEDDLSXXXXXXXXXXXXXXXDWSYVKNNRGETGYVPTSYLKVKLNAPTPKIEEILVPKHNEDENEKGLDTLKEGNMPESELGTKIEDSSDS-WIQIKQSMHEKTINDILKECGNLPSGFRYSTIFNWSKENSNNSSFIAFLCPKLSDSHLNFSELQADQANSXXXXXXXXXXXXXNKFPFISEKFI--------IKSRHVRLCLFNGNKVLSNIHLIRATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILMEFCIQGYKSKLDTVANADTLKTIDEDFTNDELLEFSIGWTSIPLYESNGQPIITKKGDYVLNGGTPFEKGIEVDPLNKNDSSGKP----KFMLNQNKQPYVTIRL 2431
            Y +   F  EEE DLS   GE + ++      W   ++++G  G VP ++LK          E+    + +E+E+E   + ++     +   G + ++SS S W  +++++ E    D+L   G +P GFR ST+    +E         ++ P+LS S L+F +L     N         Q+     F   S + I        + SRHVR+C F+G++VLSNIH +RA  + KN  TW+F+ K++  +  +  G+ F++ N  S +L IL E  +   ++                  +  E  E S GW  + L++  G P+  K  +  +NGGTP++K +    L  + S G P    + MLN  + P + +++
Sbjct:  152 YTVLSDFKGEEEGDLSVQRGEVLRIIRKTVDGWWLAQDSKGNRGVVPKTFLKFGCGVDDDNEEDNGDEEDSEEEDEAEDEEVEAEVGKDFN-GEQDKNSSVSNWSTVRKALKEVDATDVLSAMGAIPPGFRPSTLGKLLEEEGETYRASRYIKPELSQSQLSFKDLLL---NPDTGRVHARQVKTSVCFTLWSCRLIPTPGVGVQVLSRHVRVCAFDGSQVLSNIHTVRAAYNPKNPKTWSFSPKMTGLLPVLMDGDCFLRCNSVSPNLGILFELGVTFIRN------------------STGEKGELSCGWAFLKLFDETGNPLSNKTYELPVNGGTPYDKDVT---LETSVSRGSPGSVFQQMLNARRLPKLVVKM 504          
BLAST of NPHP1 vs. Planmine SMEST
Match: SMESG000061008.1 (SMESG000061008.1)

HSP 1 Score: 1108.59 bits (2866), Expect = 0.000e+0
Identity = 586/589 (99.49%), Postives = 587/589 (99.66%), Query Frame = 2
Query: 1193 IDVIESHMSSLSNEASETTIQSQFSSKVRSYNDEEDLAGQNMLQIGKKYVLAKTFSSEEEDDLSXXXXXXXXXXXXXXXDWSYVKNNRGETGYVPTSYLKVKLNAPTPKIEEILVPKHNEDENEKGLDTLKEGNMPESELGTKIEDSSDSWIQIKQSMHEKTINDILKECGNLPSGFRYSTIFNWSKENSNNSSFIAFLCPKLSDSHLNFSELQADQANSXXXXXXXXXXXXXNKFPFISEKFIIKSRHVRLCLFNGNKVLSNIHLIRATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILMEFCIQGYKSKLDTVANADTLKTIDEDFTNDELLEFSIGWTSIPLYESNGQPIITKKGDYVLNGGTPFEKGIEVDPLNKNDSSGKPKFMLNQNKQPYVTIRLSVPSKENKELIDTLPSMIVGSTLHLVLLSFYRKLLTESILDLGRNLTSTKSIYSPFLVSFTQVAECPLLLDTLRNIWXXXXXXXXXXXXXXQVKMNEFFQKIYMDFIYPLTKLKDFQNYNLSKENLLQNEERKLSEIIQKMKLDMTSILVTDEHSFVPLQFAELDFNIMSRYGKHK 2959
            IDVIESHMSSLSNEASETTIQSQFSSKVRSYNDEEDLAGQNMLQIGKKYVLAKTFSSEEEDDLSGIEGEEILLLEIMEGDWSYVKNNRGETGYVPTSYLKVKLNAPTPK+EEILVPKHNEDENEKGLDTLKEGNMPESELGTKIEDSSDSWIQIKQSMHEKTINDILKECGNLPSGFRYSTIFNWSKENSNNSSFIAFLCPKLSDSHLNFSELQADQANSQQKIQRQLQLIKLNKFPFISEKFIIKSRHVRLCLFNGNKVLSNIHLIRATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILMEFCIQGYKSKLDTVANADTLKTIDEDFTNDELLEFSIGWTSIPLYESNGQPIITKKGDYVLNGGTPFEKGIEVDPLNKNDSSGKPKFMLNQNKQPYVTIRLSVPSKENKELIDTLPSMIVGSTLHLVLLSFYRKLLTESILDL RNLTSTKSIYSPFLVSFTQVAECPLLLDTLRNIWNEKLKTTKDLNKKDQVKMNEFFQKIYMDFIYPLTKLKDFQNYNLSKENLLQNEERKLSEIIQKMKLDMTSILVTDEHSF PLQFAELDFNIMSRYGKHK
Sbjct:  378 IDVIESHMSSLSNEASETTIQSQFSSKVRSYNDEEDLAGQNMLQIGKKYVLAKTFSSEEEDDLSGIEGEEILLLEIMEGDWSYVKNNRGETGYVPTSYLKVKLNAPTPKVEEILVPKHNEDENEKGLDTLKEGNMPESELGTKIEDSSDSWIQIKQSMHEKTINDILKECGNLPSGFRYSTIFNWSKENSNNSSFIAFLCPKLSDSHLNFSELQADQANSQQKIQRQLQLIKLNKFPFISEKFIIKSRHVRLCLFNGNKVLSNIHLIRATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILMEFCIQGYKSKLDTVANADTLKTIDEDFTNDELLEFSIGWTSIPLYESNGQPIITKKGDYVLNGGTPFEKGIEVDPLNKNDSSGKPKFMLNQNKQPYVTIRLSVPSKENKELIDTLPSMIVGSTLHLVLLSFYRKLLTESILDLRRNLTSTKSIYSPFLVSFTQVAECPLLLDTLRNIWNEKLKTTKDLNKKDQVKMNEFFQKIYMDFIYPLTKLKDFQNYNLSKENLLQNEERKLSEIIQKMKLDMTSILVTDEHSFAPLQFAELDFNIMSRYGKHK 966          

HSP 2 Score: 223.016 bits (567), Expect = 5.287e-60
Identity = 146/153 (95.42%), Postives = 146/153 (95.42%), Query Frame = 2
Query:   44 MEKLSXXXXXXXXXXSDVNDLIKESKNYKKLDKESLDKNIKKCQNLLLDVDDIIEVILACKKPPTISENDPTLATFDXXXXXXXXXXXXXXXVLEDNMSNLEKFYKKNFEDSIPKEQPDLEKSKKSPSNPIEKSGDLHTEVGKSISKPLDNNQ 502
            MEKLSEIITENEEIISDVNDLIKESKNYKKLDKESLDKNIKKCQNLLLDVDDIIEVILACKK     ENDPTLATFDSDKKSSHAKALKAKKVLEDNMSNLEKFYKKNFEDSIPKEQPDLEKSKKSPSNPIEKSGDL TEVGKSISK LDNNQ
Sbjct:    1 MEKLSEIITENEEIISDVNDLIKESKNYKKLDKESLDKNIKKCQNLLLDVDDIIEVILACKK-----ENDPTLATFDSDKKSSHAKALKAKKVLEDNMSNLEKFYKKNFEDSIPKEQPDLEKSKKSPSNPIEKSGDLQTEVGKSISKTLDNNQ 148          

HSP 3 Score: 119.398 bits (298), Expect = 4.505e-27
Identity = 62/64 (96.88%), Postives = 62/64 (96.88%), Query Frame = 2
Query:  767 EIQEDPINVEHKDNVVSKDLNITNKNHDEIEKSEKQELNENISPIESEQEDNEINMNSKLNEIQ 958
            EIQEDPINVEHKDNVVSKDLNITNKNHDEIEKSEKQELNENI  IESEQEDNEINMNSKLNEIQ
Sbjct:  236 EIQEDPINVEHKDNVVSKDLNITNKNHDEIEKSEKQELNENIFTIESEQEDNEINMNSKLNEIQ 299          
BLAST of NPHP1 vs. Planmine SMEST
Match: SMESG000061008.1 (SMESG000061008.1)

HSP 1 Score: 1103.97 bits (2854), Expect = 0.000e+0
Identity = 586/591 (99.15%), Postives = 587/591 (99.32%), Query Frame = 2
Query: 1193 IDVIESHMSSLSNEASETTIQSQFSSKVRSYNDEEDLAGQNMLQIGKKYVLAKTFSSEEEDDLSXXXXXXXXXXXXXXXDWSYVKNNRGETGYVPTSYLKVKLNAPTPKIEEILVPKHNEDENEKGLDTLKEGNMPESELGTKIEDSSDSWIQIKQSMHEKTINDILKECGNLPSGFRYSTIFNWSKENSNNSSFIAFLCPKLSDSHLNFSELQADQANSXXXXXXXXXXXXXNKFPFISEKFIIKSRHVRLCLFNGNKVLSNIHLIRATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILMEFCIQGYKSKLDTVANADTLKT--IDEDFTNDELLEFSIGWTSIPLYESNGQPIITKKGDYVLNGGTPFEKGIEVDPLNKNDSSGKPKFMLNQNKQPYVTIRLSVPSKENKELIDTLPSMIVGSTLHLVLLSFYRKLLTESILDLGRNLTSTKSIYSPFLVSFTQVAECPLLLDTLRNIWXXXXXXXXXXXXXXQVKMNEFFQKIYMDFIYPLTKLKDFQNYNLSKENLLQNEERKLSEIIQKMKLDMTSILVTDEHSFVPLQFAELDFNIMSRYGKHK 2959
            IDVIESHMSSLSNEASETTIQSQFSSKVRSYNDEEDLAGQNMLQIGKKYVLAKTFSSEEEDDLSGIEGEEILLLEIMEGDWSYVKNNRGETGYVPTSYLKVKLNAPTPK+EEILVPKHNEDENEKGLDTLKEGNMPESELGTKIEDSSDSWIQIKQSMHEKTINDILKECGNLPSGFRYSTIFNWSKENSNNSSFIAFLCPKLSDSHLNFSELQADQANSQQKIQRQLQLIKLNKFPFISEKFIIKSRHVRLCLFNGNKVLSNIHLIRATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILMEFCIQGYKSKLDTVANADTLKT  IDEDFTNDELLEFSIGWTSIPLYESNGQPIITKKGDYVLNGGTPFEKGIEVDPLNKNDSSGKPKFMLNQNKQPYVTIRLSVPSKENKELIDTLPSMIVGSTLHLVLLSFYRKLLTESILDL RNLTSTKSIYSPFLVSFTQVAECPLLLDTLRNIWNEKLKTTKDLNKKDQVKMNEFFQKIYMDFIYPLTKLKDFQNYNLSKENLLQNEERKLSEIIQKMKLDMTSILVTDEHSF PLQFAELDFNIMSRYGKHK
Sbjct:  378 IDVIESHMSSLSNEASETTIQSQFSSKVRSYNDEEDLAGQNMLQIGKKYVLAKTFSSEEEDDLSGIEGEEILLLEIMEGDWSYVKNNRGETGYVPTSYLKVKLNAPTPKVEEILVPKHNEDENEKGLDTLKEGNMPESELGTKIEDSSDSWIQIKQSMHEKTINDILKECGNLPSGFRYSTIFNWSKENSNNSSFIAFLCPKLSDSHLNFSELQADQANSQQKIQRQLQLIKLNKFPFISEKFIIKSRHVRLCLFNGNKVLSNIHLIRATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILMEFCIQGYKSKLDTVANADTLKTIQIDEDFTNDELLEFSIGWTSIPLYESNGQPIITKKGDYVLNGGTPFEKGIEVDPLNKNDSSGKPKFMLNQNKQPYVTIRLSVPSKENKELIDTLPSMIVGSTLHLVLLSFYRKLLTESILDLRRNLTSTKSIYSPFLVSFTQVAECPLLLDTLRNIWNEKLKTTKDLNKKDQVKMNEFFQKIYMDFIYPLTKLKDFQNYNLSKENLLQNEERKLSEIIQKMKLDMTSILVTDEHSFAPLQFAELDFNIMSRYGKHK 968          

HSP 2 Score: 223.016 bits (567), Expect = 6.048e-60
Identity = 146/153 (95.42%), Postives = 146/153 (95.42%), Query Frame = 2
Query:   44 MEKLSXXXXXXXXXXSDVNDLIKESKNYKKLDKESLDKNIKKCQNLLLDVDDIIEVILACKKPPTISENDPTLATFDXXXXXXXXXXXXXXXVLEDNMSNLEKFYKKNFEDSIPKEQPDLEKSKKSPSNPIEKSGDLHTEVGKSISKPLDNNQ 502
            MEKLSEIITENEEIISDVNDLIKESKNYKKLDKESLDKNIKKCQNLLLDVDDIIEVILACKK     ENDPTLATFDSDKKSSHAKALKAKKVLEDNMSNLEKFYKKNFEDSIPKEQPDLEKSKKSPSNPIEKSGDL TEVGKSISK LDNNQ
Sbjct:    1 MEKLSEIITENEEIISDVNDLIKESKNYKKLDKESLDKNIKKCQNLLLDVDDIIEVILACKK-----ENDPTLATFDSDKKSSHAKALKAKKVLEDNMSNLEKFYKKNFEDSIPKEQPDLEKSKKSPSNPIEKSGDLQTEVGKSISKTLDNNQ 148          

HSP 3 Score: 119.398 bits (298), Expect = 4.963e-27
Identity = 62/64 (96.88%), Postives = 62/64 (96.88%), Query Frame = 2
Query:  767 EIQEDPINVEHKDNVVSKDLNITNKNHDEIEKSEKQELNENISPIESEQEDNEINMNSKLNEIQ 958
            EIQEDPINVEHKDNVVSKDLNITNKNHDEIEKSEKQELNENI  IESEQEDNEINMNSKLNEIQ
Sbjct:  236 EIQEDPINVEHKDNVVSKDLNITNKNHDEIEKSEKQELNENIFTIESEQEDNEINMNSKLNEIQ 299          
BLAST of NPHP1 vs. Planmine SMEST
Match: SMESG000061008.1 (SMESG000061008.1)

HSP 1 Score: 1103.2 bits (2852), Expect = 0.000e+0
Identity = 586/591 (99.15%), Postives = 587/591 (99.32%), Query Frame = 2
Query: 1193 IDVIESHMSSLSNEASETTIQSQFSSKVRSYNDEEDLAGQNMLQIGKKYVLAKTFSSEEEDDLSXXXXXXXXXXXXXXXDWSYVKNNRGETGYVPTSYLKVKLNAPTPKIEEILVPKHNEDENEKGLDTLKEGNMPESELGTKIEDSSDSWIQIKQSMHEKTINDILKECGNLPSGFRYSTIFNWSKENSNNSSFIAFLCPKLSDSHLNFSELQADQANSXXXXXXXXXXXXXNKFPFISEKFIIKSRHVRLCLFNGNKVLSNIHLIRATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILMEFCIQGYKSKLDTVANADTLKT--IDEDFTNDELLEFSIGWTSIPLYESNGQPIITKKGDYVLNGGTPFEKGIEVDPLNKNDSSGKPKFMLNQNKQPYVTIRLSVPSKENKELIDTLPSMIVGSTLHLVLLSFYRKLLTESILDLGRNLTSTKSIYSPFLVSFTQVAECPLLLDTLRNIWXXXXXXXXXXXXXXQVKMNEFFQKIYMDFIYPLTKLKDFQNYNLSKENLLQNEERKLSEIIQKMKLDMTSILVTDEHSFVPLQFAELDFNIMSRYGKHK 2959
            IDVIESHMSSLSNEASETTIQSQFSSKVRSYNDEEDLAGQNMLQIGKKYVLAKTFSSEEEDDLSGIEGEEILLLEIMEGDWSYVKNNRGETGYVPTSYLKVKLNAPTPK+EEILVPKHNEDENEKGLDTLKEGNMPESELGTKIEDSSDSWIQIKQSMHEKTINDILKECGNLPSGFRYSTIFNWSKENSNNSSFIAFLCPKLSDSHLNFSELQADQANSQQKIQRQLQLIKLNKFPFISEKFIIKSRHVRLCLFNGNKVLSNIHLIRATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILMEFCIQGYKSKLDTVANADTLKT  IDEDFTNDELLEFSIGWTSIPLYESNGQPIITKKGDYVLNGGTPFEKGIEVDPLNKNDSSGKPKFMLNQNKQPYVTIRLSVPSKENKELIDTLPSMIVGSTLHLVLLSFYRKLLTESILDL RNLTSTKSIYSPFLVSFTQVAECPLLLDTLRNIWNEKLKTTKDLNKKDQVKMNEFFQKIYMDFIYPLTKLKDFQNYNLSKENLLQNEERKLSEIIQKMKLDMTSILVTDEHSF PLQFAELDFNIMSRYGKHK
Sbjct:  383 IDVIESHMSSLSNEASETTIQSQFSSKVRSYNDEEDLAGQNMLQIGKKYVLAKTFSSEEEDDLSGIEGEEILLLEIMEGDWSYVKNNRGETGYVPTSYLKVKLNAPTPKVEEILVPKHNEDENEKGLDTLKEGNMPESELGTKIEDSSDSWIQIKQSMHEKTINDILKECGNLPSGFRYSTIFNWSKENSNNSSFIAFLCPKLSDSHLNFSELQADQANSQQKIQRQLQLIKLNKFPFISEKFIIKSRHVRLCLFNGNKVLSNIHLIRATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILMEFCIQGYKSKLDTVANADTLKTIQIDEDFTNDELLEFSIGWTSIPLYESNGQPIITKKGDYVLNGGTPFEKGIEVDPLNKNDSSGKPKFMLNQNKQPYVTIRLSVPSKENKELIDTLPSMIVGSTLHLVLLSFYRKLLTESILDLRRNLTSTKSIYSPFLVSFTQVAECPLLLDTLRNIWNEKLKTTKDLNKKDQVKMNEFFQKIYMDFIYPLTKLKDFQNYNLSKENLLQNEERKLSEIIQKMKLDMTSILVTDEHSFAPLQFAELDFNIMSRYGKHK 973          

HSP 2 Score: 240.35 bits (612), Expect = 8.646e-66
Identity = 151/153 (98.69%), Postives = 151/153 (98.69%), Query Frame = 2
Query:   44 MEKLSXXXXXXXXXXSDVNDLIKESKNYKKLDKESLDKNIKKCQNLLLDVDDIIEVILACKKPPTISENDPTLATFDXXXXXXXXXXXXXXXVLEDNMSNLEKFYKKNFEDSIPKEQPDLEKSKKSPSNPIEKSGDLHTEVGKSISKPLDNNQ 502
            MEKLSEIITENEEIISDVNDLIKESKNYKKLDKESLDKNIKKCQNLLLDVDDIIEVILACKKPPTISENDPTLATFDSDKKSSHAKALKAKKVLEDNMSNLEKFYKKNFEDSIPKEQPDLEKSKKSPSNPIEKSGDL TEVGKSISK LDNNQ
Sbjct:    1 MEKLSEIITENEEIISDVNDLIKESKNYKKLDKESLDKNIKKCQNLLLDVDDIIEVILACKKPPTISENDPTLATFDSDKKSSHAKALKAKKVLEDNMSNLEKFYKKNFEDSIPKEQPDLEKSKKSPSNPIEKSGDLQTEVGKSISKTLDNNQ 153          

HSP 3 Score: 119.398 bits (298), Expect = 4.701e-27
Identity = 62/64 (96.88%), Postives = 62/64 (96.88%), Query Frame = 2
Query:  767 EIQEDPINVEHKDNVVSKDLNITNKNHDEIEKSEKQELNENISPIESEQEDNEINMNSKLNEIQ 958
            EIQEDPINVEHKDNVVSKDLNITNKNHDEIEKSEKQELNENI  IESEQEDNEINMNSKLNEIQ
Sbjct:  241 EIQEDPINVEHKDNVVSKDLNITNKNHDEIEKSEKQELNENIFTIESEQEDNEINMNSKLNEIQ 304          
The following BLAST results are available for this feature:
BLAST of NPHP1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPHP13.734e-5330.30nephrocystin 1 [Source:HGNC Symbol;Acc:HGNC:7905][more]
NPHP12.323e-5230.58nephrocystin 1 [Source:HGNC Symbol;Acc:HGNC:7905][more]
NPHP13.768e-5130.31nephrocystin 1 [Source:HGNC Symbol;Acc:HGNC:7905][more]
NPHP11.617e-4732.80nephrocystin 1 [Source:HGNC Symbol;Acc:HGNC:7905][more]
NPHP11.695e-4732.80nephrocystin 1 [Source:HGNC Symbol;Acc:HGNC:7905][more]
back to top
BLAST of NPHP1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NPHP1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NPHP1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nphp11.407e-4527.93nephronophthisis 1 [Source:ZFIN;Acc:ZDB-GENE-06092... [more]
nphp12.038e-4227.72nephronophthisis 1 [Source:ZFIN;Acc:ZDB-GENE-06092... [more]
back to top
BLAST of NPHP1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nfic1.637e-4927.74nuclear factor I C [Source:Xenbase;Acc:XB-GENE-484... [more]
nfic5.739e-4627.82nuclear factor I C [Source:Xenbase;Acc:XB-GENE-484... [more]
nfic7.177e-4530.77nuclear factor I C [Source:Xenbase;Acc:XB-GENE-484... [more]
nfic1.146e-4430.49nuclear factor I C [Source:Xenbase;Acc:XB-GENE-484... [more]
nfic1.303e-4426.86nuclear factor I C [Source:Xenbase;Acc:XB-GENE-484... [more]
back to top
BLAST of NPHP1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Nphp16.494e-5129.26nephronophthisis 1 (juvenile) homolog (human) [Sou... [more]
Nphp18.023e-5029.41nephronophthisis 1 (juvenile) homolog (human) [Sou... [more]
back to top
BLAST of NPHP1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q9TU19|NPHP1_CANLF2.853e-5530.80Nephrocystin-1 (Fragment) OS=Canis lupus familiari... [more]
sp|Q9QY53|NPHP1_MOUSE3.708e-5127.82Nephrocystin-1 OS=Mus musculus OX=10090 GN=Nphp1 P... [more]
sp|O15259|NPHP1_HUMAN7.765e-4732.80Nephrocystin-1 OS=Homo sapiens OX=9606 GN=NPHP1 PE... [more]
back to top
BLAST of NPHP1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YFE33.510e-64100.00NPHP1 OS=Schmidtea mediterranea OX=79327 GN=NPHP1 ... [more]
A0A1S3KEG02.143e-7234.31nephrocystin-1-like OS=Lingula unguis OX=7574 GN=L... [more]
A0A2T7NXL42.018e-6530.68SH3 domain-containing protein OS=Pomacea canalicul... [more]
A0A2G8L9U03.605e-6431.25Putative nephrocystin-1 OS=Stichopus japonicus OX=... [more]
A0A1V4IGI01.259e-6229.80Nephrocystin-1 OS=Patagioenas fasciata monilis OX=... [more]
back to top
BLAST of NPHP1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nphp12.850e-4426.54nephrocystin 1 [Source:NCBI gene;Acc:103027708][more]
nphp14.623e-4225.09nephrocystin 1 [Source:NCBI gene;Acc:103027708][more]
back to top
BLAST of NPHP1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000009598.15.411e-4425.62pep scaffold:Pmarinus_7.0:GL483378:8350:10551:1 ge... [more]
back to top
BLAST of NPHP1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NPHP1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO325091.340e-1627.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of NPHP1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nphp12.228e-2826.98nephrocystin 1 [Source:NCBI gene;Acc:101156350][more]
back to top
BLAST of NPHP1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000061008.15.287e-6099.49SMESG000061008.1[more]
SMESG000061008.16.048e-6099.15SMESG000061008.1[more]
SMESG000061008.18.646e-6699.15SMESG000061008.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30003011
GenBankAKN21705.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003011 ID=SMED30003011|Name=NPHP1|organism=Schmidtea mediterranea sexual|type=transcript|length=3060bp
TCTATATAAATCTTATATGTGATAGTCATTATTATCAAATATAATGGAGA
AACTGTCTGAAATAATCACAGAAAATGAAGAAATAATATCTGATGTAAAC
GATTTAATTAAAGAATCAAAGAATTACAAAAAGCTTGACAAAGAGAGCCT
AGACAAGAACATAAAAAAATGCCAAAATTTATTGTTGGATGTTGATGATA
TTATAGAAGTTATTTTGGCATGTAAAAAACCACCAACTATCTCTGAAAAT
GATCCAACACTTGCGACGTTCGATTCCGATAAAAAATCTTCACATGCTAA
AGCTTTAAAAGCTAAAAAAGTTCTGGAAGATAATATGTCAAACCTTGAAA
AGTTCTATAAAAAAAACTTTGAGGATTCGATTCCAAAGGAACAACCAGAT
TTAGAAAAAAGTAAAAAAAGCCCTTCGAATCCTATTGAAAAATCTGGTGA
CTTACATACTGAAGTTGGCAAATCAATTTCAAAACCTCTTGATAATAACC
AAGAAGAAAAAAGTTCAAAGGAAAAAACAAAAAAAAAATCTGAAAACAAA
AAAAATAAAAAAAGTAAAAAAGACAATAAAGAAGAAAAAGAAGAAAATGT
TGATAAAGAAGAATCAGTAGACAAAGATGAAAAAATAAAATCAAGTGAAG
AAATCGAAGCATCATCAACAAAAAATTCACAAAAATCAACAAAAAAAGGA
ATTTTGAAATCGTCATTTAAAAGCAAGGACAAAGGAAAAAATAAAAATAA
GCAAGACGATGAAAATGAAATTCAAGAAGACCCTATAAACGTTGAACACA
AAGACAACGTAGTATCAAAAGATCTCAACATAACTAATAAAAATCATGAC
GAAATAGAAAAAAGCGAAAAACAAGAATTGAATGAAAATATTTCCCCAAT
TGAAAGTGAACAGGAGGATAATGAAATAAACATGAATTCAAAATTAAATG
AAATTCAAAAAGAAAAAAACTCATCTAAAAAAAACAAGAAGCTCACAAAA
AGCAAAAAGGAGAAAGTTTCGAAAGTCAAAACCAGTAAAGAAGATAAAAC
CAAATTAAAAGAAAGTGAGTCTAAAGATTCTGATAAAAATTTAAGTACCG
GCGATTTATCAATAAAAAAAGAAAAAAGTAAAAGTTTATCGAAAAATAAT
TCCGATATTTCTGAAAACAAAAATGAAGCAGAAGAGAAGGAAATAGATGT
TATTGAAAGCCACATGTCATCTTTGTCAAACGAAGCATCTGAAACGACTA
TCCAATCCCAATTCTCTTCAAAGGTTCGGTCTTACAACGATGAAGAGGAT
CTCGCCGGACAAAATATGTTACAAATTGGAAAGAAATATGTATTGGCGAA
GACATTTTCCTCCGAAGAGGAAGATGATTTAAGTGGAATTGAAGGCGAAG
AAATTCTGTTGCTTGAAATTATGGAAGGTGATTGGTCATATGTAAAAAAC
AATCGAGGAGAAACGGGGTATGTTCCAACATCTTATCTCAAGGTCAAATT
AAATGCTCCTACGCCGAAGATAGAAGAGATCTTGGTTCCGAAACACAACG
AAGACGAAAATGAAAAGGGGTTGGACACTTTAAAGGAAGGTAACATGCCT
GAGAGTGAACTAGGGACCAAGATTGAGGACTCCTCTGATTCTTGGATTCA
AATTAAGCAATCAATGCACGAGAAAACGATAAATGACATCCTAAAAGAAT
GCGGAAATTTACCATCGGGTTTCCGGTACAGTACCATTTTTAACTGGTCC
AAAGAAAATTCTAATAATTCAAGCTTCATTGCTTTTCTCTGTCCAAAGTT
ATCAGATTCTCATTTGAATTTCTCTGAATTACAAGCTGATCAGGCCAACT
CCCAGCAAAAGATACAAAGGCAATTACAATTAATTAAACTAAATAAATTC
CCATTTATTAGTGAAAAGTTTATTATAAAAAGCCGCCATGTAAGACTTTG
TCTTTTCAATGGAAATAAAGTTTTAAGTAATATTCATTTGATTCGTGCTA
CTGTTAGCGGGAAAAATTTAACTACCTGGAATTTTAATTTAAAGGTTAGT
GAGGACATGAAATCAGTGGAATTTGGAGAAGTATTTATAAAGTTTAATCA
GTCATCCACAGATCTTTCAATACTTATGGAGTTTTGCATTCAAGGATATA
AATCAAAATTGGACACGGTTGCAAATGCGGACACTCTCAAAACCATAGAT
GAAGACTTTACAAATGATGAATTACTAGAATTTAGCATTGGGTGGACAAG
TATACCACTTTACGAAAGTAACGGCCAACCAATAATTACAAAGAAAGGTG
ACTACGTGCTTAATGGGGGAACTCCTTTCGAGAAAGGTATAGAGGTTGAT
CCTCTTAATAAAAACGATAGCTCTGGGAAACCGAAATTTATGCTTAATCA
AAATAAACAACCGTATGTAACTATTAGACTATCCGTTCCCAGTAAGGAAA
ATAAGGAATTAATAGATACTTTGCCAAGTATGATAGTTGGAAGCACATTG
CATTTGGTTTTGCTCTCATTTTATAGAAAGCTTCTTACAGAATCAATCTT
GGATCTTGGACGAAATCTAACATCCACAAAATCAATTTATTCACCATTTT
TAGTTTCTTTCACTCAAGTGGCTGAATGTCCTCTCCTCCTTGACACTTTA
AGAAATATCTGGAATGAAAAATTAAAGACGACAAAAGATTTAAATAAAAA
GGACCAAGTAAAGATGAACGAGTTTTTTCAAAAGATTTATATGGATTTCA
TATATCCACTTACCAAATTGAAAGACTTCCAAAACTATAATTTATCAAAG
GAAAACTTACTCCAAAATGAAGAAAGAAAATTATCGGAAATTATTCAAAA
AATGAAATTGGATATGACATCTATTTTAGTCACTGATGAGCACTCTTTTG
TACCTTTGCAATTTGCAGAATTAGATTTCAACATTATGTCGAGGTATGGA
AAACACAAATGAGCATAGATATCGTAAAAAGAACTGTTACTTATTTTTAG
TCGAAATTATTATGGTATTATAATTATATAGTACATTTATGATATTTAGT
ACTAAAATAT
back to top

protein sequence of SMED30003011-orf-1

>SMED30003011-orf-1 ID=SMED30003011-orf-1|Name=SMED30003011-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=973bp
MEKLSEIITENEEIISDVNDLIKESKNYKKLDKESLDKNIKKCQNLLLDV
DDIIEVILACKKPPTISENDPTLATFDSDKKSSHAKALKAKKVLEDNMSN
LEKFYKKNFEDSIPKEQPDLEKSKKSPSNPIEKSGDLHTEVGKSISKPLD
NNQEEKSSKEKTKKKSENKKNKKSKKDNKEEKEENVDKEESVDKDEKIKS
SEEIEASSTKNSQKSTKKGILKSSFKSKDKGKNKNKQDDENEIQEDPINV
EHKDNVVSKDLNITNKNHDEIEKSEKQELNENISPIESEQEDNEINMNSK
LNEIQKEKNSSKKNKKLTKSKKEKVSKVKTSKEDKTKLKESESKDSDKNL
STGDLSIKKEKSKSLSKNNSDISENKNEAEEKEIDVIESHMSSLSNEASE
TTIQSQFSSKVRSYNDEEDLAGQNMLQIGKKYVLAKTFSSEEEDDLSGIE
GEEILLLEIMEGDWSYVKNNRGETGYVPTSYLKVKLNAPTPKIEEILVPK
HNEDENEKGLDTLKEGNMPESELGTKIEDSSDSWIQIKQSMHEKTINDIL
KECGNLPSGFRYSTIFNWSKENSNNSSFIAFLCPKLSDSHLNFSELQADQ
ANSQQKIQRQLQLIKLNKFPFISEKFIIKSRHVRLCLFNGNKVLSNIHLI
RATVSGKNLTTWNFNLKVSEDMKSVEFGEVFIKFNQSSTDLSILMEFCIQ
GYKSKLDTVANADTLKTIDEDFTNDELLEFSIGWTSIPLYESNGQPIITK
KGDYVLNGGTPFEKGIEVDPLNKNDSSGKPKFMLNQNKQPYVTIRLSVPS
KENKELIDTLPSMIVGSTLHLVLLSFYRKLLTESILDLGRNLTSTKSIYS
PFLVSFTQVAECPLLLDTLRNIWNEKLKTTKDLNKKDQVKMNEFFQKIYM
DFIYPLTKLKDFQNYNLSKENLLQNEERKLSEIIQKMKLDMTSILVTDEH
SFVPLQFAELDFNIMSRYGKHK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0031514motile cilium
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005911cell-cell junction
GO:0005912adherens junction
GO:0005923bicellular tight junction
GO:0005929cilium
GO:0030054cell junction
GO:0042995cell projection
Vocabulary: biological process
TermDefinition
GO:1903348positive regulation of bicellular tight junction assembly
GO:0007283spermatogenesis
GO:0030030cell projection organization
GO:0030154cell differentiation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0000463cholinergic neuron
PLANA:0000464GABAergic neuron
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR039687NPHP1
IPR036028SH3-like_dom_sf
IPR001452SH3_domain
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 915..935
NoneNo IPR availableCOILSCoilCoilcoord: 364..396
NoneNo IPR availableCOILSCoilCoilcoord: 149..191
NoneNo IPR availableGENE3DG3DSA:2.30.30.40coord: 423..495
e-value: 2.8E-9
score: 38.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 204..219
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 221..281
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 323..379
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 282..303
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 108..129
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 130..148
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 149..164
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 173..203
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 108..379
NoneNo IPR availablePANTHERPTHR15176NEPHROCYSTINcoord: 263..938
IPR001452SH3 domainSMARTSM00326SH3_2coord: 429..485
e-value: 6.8E-8
score: 42.2
IPR001452SH3 domainPFAMPF00018SH3_1coord: 437..478
e-value: 2.5E-5
score: 23.8
IPR001452SH3 domainPROSITEPS50002SH3coord: 426..486
score: 17.588
IPR039687Nephrocystin-1PANTHERPTHR15176:SF1NEPHROCYSTIN-1coord: 263..938
IPR036028SH3-like domain superfamilySUPERFAMILYSSF50044SH3-domaincoord: 429..483