SMED30003001

Overview
NameSMED30003001
Smed IDSMED30003001
Length (bp)1495
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30003001 (SMED30003001) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30003001 (SMED30003001) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30003001 (SMED30003001) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30003001 (SMED30003001) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30003001

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30003001h1SMcG0007325 dd_Smed_v4_7128_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30003001h1SMcG0007325 dd_Smed_v4_7128_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30003001 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000302:151038..155544 +7298
v31.025272:5548..6978 +5237
Homology
BLAST of SMED30003001 vs. Ensembl Human
Match: STAT5A (signal transducer and activator of transcription 5A [Source:HGNC Symbol;Acc:HGNC:11366])

HSP 1 Score: 71.633 bits (174), Expect = 1.885e-12
Identity = 91/375 (24.27%), Postives = 163/375 (43.47%), Query Frame = 1
Query:  151 DMSKSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVTNKN--------LXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDARERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGR--FDCSESVDVNQLISNISDYFLK--QTSRGLTPSNQVFLRAKLIKMS---------YNITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK-ESETLFTGSTSGSFFLRF--SERNPKIXXXXXXXXXXDAWS--PFSIDECRSRSLPERLMDYQELRFL 1194
            +++ ++ D I  L+  +F++   PP+++K      T T F A+   L+  K  +  + PQ    +++E   K  + N+N        + +   +              +NM  +  +K A +R+  + +T  K   LF  + +     L    ++KT   S  V+ +VH +Q+ +A  T+ WD+       +F   GR  F   + V   QL   ++  F    Q++RGLT  N VFL  KL   S          ++++  F R ++P    +F  W   ++++LK       W +  I GFV+K ++  L      G+F LRF  SE             + + W+  PF+  +   RSL +RL D   L ++
Sbjct:  315 EVNATITDIISALVTSTFIIEKQPPQVLK------TQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMSLKR-IKRA-DRRGAESVTEEKFTVLFESQFSVGSNEL--VFQVKT--LSLPVVVIVHGSQDHNATATVLWDN-------AFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNNSSSHLEDYSGLSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPH-WNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPERNLWNLKPFTTRDFSIRSLADRLGDLSYLIYV 669          
BLAST of SMED30003001 vs. Ensembl Human
Match: STAT5A (signal transducer and activator of transcription 5A [Source:HGNC Symbol;Acc:HGNC:11366])

HSP 1 Score: 71.633 bits (174), Expect = 1.885e-12
Identity = 91/375 (24.27%), Postives = 163/375 (43.47%), Query Frame = 1
Query:  151 DMSKSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVTNKN--------LXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDARERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGR--FDCSESVDVNQLISNISDYFLK--QTSRGLTPSNQVFLRAKLIKMS---------YNITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK-ESETLFTGSTSGSFFLRF--SERNPKIXXXXXXXXXXDAWS--PFSIDECRSRSLPERLMDYQELRFL 1194
            +++ ++ D I  L+  +F++   PP+++K      T T F A+   L+  K  +  + PQ    +++E   K  + N+N        + +   +              +NM  +  +K A +R+  + +T  K   LF  + +     L    ++KT   S  V+ +VH +Q+ +A  T+ WD+       +F   GR  F   + V   QL   ++  F    Q++RGLT  N VFL  KL   S          ++++  F R ++P    +F  W   ++++LK       W +  I GFV+K ++  L      G+F LRF  SE             + + W+  PF+  +   RSL +RL D   L ++
Sbjct:  315 EVNATITDIISALVTSTFIIEKQPPQVLK------TQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMSLKR-IKRA-DRRGAESVTEEKFTVLFESQFSVGSNEL--VFQVKT--LSLPVVVIVHGSQDHNATATVLWDN-------AFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNNSSSHLEDYSGLSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPH-WNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPERNLWNLKPFTTRDFSIRSLADRLGDLSYLIYV 669          
BLAST of SMED30003001 vs. Ensembl Human
Match: STAT5A (signal transducer and activator of transcription 5A [Source:HGNC Symbol;Acc:HGNC:11366])

HSP 1 Score: 71.2478 bits (173), Expect = 1.946e-12
Identity = 91/375 (24.27%), Postives = 163/375 (43.47%), Query Frame = 1
Query:  151 DMSKSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVTNKN--------LXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDARERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGR--FDCSESVDVNQLISNISDYFLK--QTSRGLTPSNQVFLRAKLIKMS---------YNITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK-ESETLFTGSTSGSFFLRF--SERNPKIXXXXXXXXXXDAWS--PFSIDECRSRSLPERLMDYQELRFL 1194
            +++ ++ D I  L+  +F++   PP+++K      T T F A+   L+  K  +  + PQ    +++E   K  + N+N        + +   +              +NM  +  +K A +R+  + +T  K   LF  + +     L    ++KT   S  V+ +VH +Q+ +A  T+ WD+       +F   GR  F   + V   QL   ++  F    Q++RGLT  N VFL  KL   S          ++++  F R ++P    +F  W   ++++LK       W +  I GFV+K ++  L      G+F LRF  SE             + + W+  PF+  +   RSL +RL D   L ++
Sbjct:  285 EVNATITDIISALVTSTFIIEKQPPQVLK------TQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMSLKR-IKRA-DRRGAESVTEEKFTVLFESQFSVGSNEL--VFQVKT--LSLPVVVIVHGSQDHNATATVLWDN-------AFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNNSSSHLEDYSGLSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPH-WNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPERNLWNLKPFTTRDFSIRSLADRLGDLSYLIYV 639          
BLAST of SMED30003001 vs. Ensembl Human
Match: STAT5B (signal transducer and activator of transcription 5B [Source:HGNC Symbol;Acc:HGNC:11367])

HSP 1 Score: 70.0922 bits (170), Expect = 5.582e-12
Identity = 78/327 (23.85%), Postives = 143/327 (43.73%), Query Frame = 1
Query:  151 DMSKSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVTNKN--------LXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDARERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGR--FDCSESVDVNQLISNISDYFLK--QTSRGLTPSNQVFLRAKLIKMS---------YNITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK-ESETLFTGSTSGSFFLRFSE 1062
            +++ ++ D I  L+  +F++   PP+++K      T T F A+   L+  K  +  + PQ    +++E   K  + N+N        + +   +              +NM  +   +   +R+  + +T  K   LF  + +     L    ++KT   S  V+ +VH +Q+ +A  T+ WD+       +F   GR  F   + V   QL   ++  F    Q++RGLT  N VFL  KL   S          ++++  F R ++P    +F  W   ++++LK       W +  I GFV+K ++  L      G+F LRFS+
Sbjct:  315 EVNATITDIISALVTSTFIIEKQPPQVLK------TQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMSLKRIKRS--DRRGAESVTEEKFTILFESQFSVGGNEL--VFQVKT--LSLPVVVIVHGSQDNNATATVLWDN-------AFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNNSSSHLEDYSGLSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPH-WNDGAILGFVNKQQAHDLLINKPDGTFLLRFSD 621          
BLAST of SMED30003001 vs. Ensembl Human
Match: STAT6 (signal transducer and activator of transcription 6 [Source:HGNC Symbol;Acc:HGNC:11368])

HSP 1 Score: 68.1662 bits (165), Expect = 1.805e-11
Identity = 93/416 (22.36%), Postives = 167/416 (40.14%), Query Frame = 1
Query:   40 DQRMATYRSLTEFTTELYSTLCEIVIEIHNNPRNDER-DMSKSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETKELFSSKPQAHVYLLNESDFKEFVTNKN----------LXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDAR-ERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYF-RLDRYSFKNSGRFDCSESVDVNQLISNISDYFLKQ--TSRGLTPSNQVFLRAKLIK---------MSYNITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSKESET-LFTGSTSGSFFLRFSERNPKIXXXXXXXXXXDA------WSPFSIDECRSRSLPERLMDYQELRFL 1194
            ++ +A  +   E   ++YS L + V           R  ++  L++ +  L+   F++   PP+++K +T  Q G  F      L       +  P     ++ E   +E    +           + + +    + I  N      KN++ +   K  R ERK  + +T  K   LF    T  P      L I+    S  ++ +VH NQ+ +A  T+ WD+ F  +DR  F        +E V   ++   ++  F+ +  T+RGL P + +FL  K+              ++++  F +  +     +F  W  + +  L    +   W + LI GF+SK+  T L      G+F LRFS+       +  V    D         PFS  +   RSL +R+ D  +L+ L
Sbjct:  218 EESLAPLQERCESLVDIYSQLQQEVGAAGGELEPKTRASLTGRLDEVLRTLVTSCFLVEKQPPQVLKTQTKFQAGVRFLLGLRFLGAP----AKPPLVRADMVTEKQARELSVPQGPGAGAESTGEIINNTVPLENSIPGNCCSALFKNLLLK---KIKRCERKGTESVTEEKCAVLFSASFTLGP----GKLPIQLQALSLPLVVIVHGNQDNNAKATILWDNAFSEMDRVPFV------VAERVPWEKMCETLNLKFMAEVGTNRGLLPEHFLFLAQKIFNDNSLSMEAFQHRSVSWSQFNKEILLGRGFTFWQWF-DGVLDLTKRCLRSYWSDRLIIGFISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIRSLGDRIRDLAQLKNL 615          
BLAST of SMED30003001 vs. Ensembl Fly
Match: Stat92E (gene:FBgn0016917 transcript:FBtr0089484)

HSP 1 Score: 61.2326 bits (147), Expect = 1.158e-9
Identity = 97/398 (24.37%), Postives = 174/398 (43.72%), Query Frame = 1
Query:  160 KSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVT------NKNLXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDAR-------ERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYF-RLDRYSFKNSGRFDCSESVDVNQLISNISDYFLKQTSRGLTPSNQVFLRAKLIK--MSYNITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK---ESETLFTGSTSGSFFLRF--SERNPKIXXXXXXXXXXDAWSPFSIDECRSRSLPERLMDYQELRFLK--DASGKFLDKVEALSQFIDK-TNPDDGYT 1278
            + ++++   L+  +F++   PP+++K      T T F AS   LI ++  + ++ P     +++E   + FVT      N +L+ +S  +I +       ++  N ++    ++ +       E+K  + +   K    F    T   F      +I+    S  V+ +VH NQE  +  T+ WD+ F  + R  F  + R      V   QL   ++  F   T R LT  N  FL  KL +   S  IT++ F +  MP+   +F  W    I  L  + ++GMWK   I GF++K   +++ L +    G+F LRF  SE        V     V   +P++  + +  +L +R+ D   L +L   D +   + +  A  +F  K  +P  GY 
Sbjct:  202 EQVQNAQKNLVCSAFIVDKQPPQVMK------TNTRFAASVRWLIGSQLGIHNNPPTVECIIMSEIQSQRFVTRNTQMDNSSLSGQSSGEIQNASSTME-YQQNNHVFSASFRNMQLKKIKRAEKKGTESVMDEKFALFFYTTTTVNDF------QIRVWTLSLPVVVIVHGNQEPQSWATITWDNAFAEIVRDPFMITDR------VTWAQLSVALNIKFGSCTGRSLTIDNLDFLYEKLQREERSEYITWNQFCKEPMPDRSFTFWEWFF-AIMKLTKDHMLGMWKAGCIMGFINKTKAQTDLLRSVYGIGTFLLRFSDSELGGVTIAYVNENGLVTMLAPWTARDFQVLNLADRIRDLDVLCWLHPSDRNASPVKRDVAFGEFYSKRQDPVTGYV 579          
BLAST of SMED30003001 vs. Ensembl Fly
Match: Stat92E (gene:FBgn0016917 transcript:FBtr0334581)

HSP 1 Score: 61.2326 bits (147), Expect = 1.437e-9
Identity = 81/321 (25.23%), Postives = 145/321 (45.17%), Query Frame = 1
Query:  160 KSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVT------NKNLXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDAR-------ERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYF-RLDRYSFKNSGRFDCSESVDVNQLISNISDYFLKQTSRGLTPSNQVFLRAKLIK--MSYNITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK---ESETLFTGSTSGSFFLRFSE 1062
            + ++++   L+  +F++   PP+++K      T T F AS   LI ++  + ++ P     +++E   + FVT      N +L+ +S  +I +       ++  N ++    ++ +       E+K  + +   K    F    T   F      +I+    S  V+ +VH NQE  +  T+ WD+ F  + R  F  + R      V   QL   ++  F   T R LT  N  FL  KL +   S  IT++ F +  MP+   +F  W    I  L  + ++GMWK   I GF++K   +++ L +    G+F LRFS+
Sbjct:  202 EQVQNAQKNLVCSAFIVDKQPPQVMK------TNTRFAASVRWLIGSQLGIHNNPPTVECIIMSEIQSQRFVTRNTQMDNSSLSGQSSGEIQNASSTME-YQQNNHVFSASFRNMQLKKIKRAEKKGTESVMDEKFALFFYTTTTVNDF------QIRVWTLSLPVVVIVHGNQEPQSWATITWDNAFAEIVRDPFMITDR------VTWAQLSVALNIKFGSCTGRSLTIDNLDFLYEKLQREERSEYITWNQFCKEPMPDRSFTFWEWFF-AIMKLTKDHMLGMWKAGCIMGFINKTKAQTDLLRSVYGIGTFLLRFSD 502          
BLAST of SMED30003001 vs. Ensembl Fly
Match: Stat92E (gene:FBgn0016917 transcript:FBtr0100457)

HSP 1 Score: 61.2326 bits (147), Expect = 1.437e-9
Identity = 81/321 (25.23%), Postives = 145/321 (45.17%), Query Frame = 1
Query:  160 KSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVT------NKNLXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDAR-------ERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYF-RLDRYSFKNSGRFDCSESVDVNQLISNISDYFLKQTSRGLTPSNQVFLRAKLIK--MSYNITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK---ESETLFTGSTSGSFFLRFSE 1062
            + ++++   L+  +F++   PP+++K      T T F AS   LI ++  + ++ P     +++E   + FVT      N +L+ +S  +I +       ++  N ++    ++ +       E+K  + +   K    F    T   F      +I+    S  V+ +VH NQE  +  T+ WD+ F  + R  F  + R      V   QL   ++  F   T R LT  N  FL  KL +   S  IT++ F +  MP+   +F  W    I  L  + ++GMWK   I GF++K   +++ L +    G+F LRFS+
Sbjct:  202 EQVQNAQKNLVCSAFIVDKQPPQVMK------TNTRFAASVRWLIGSQLGIHNNPPTVECIIMSEIQSQRFVTRNTQMDNSSLSGQSSGEIQNASSTME-YQQNNHVFSASFRNMQLKKIKRAEKKGTESVMDEKFALFFYTTTTVNDF------QIRVWTLSLPVVVIVHGNQEPQSWATITWDNAFAEIVRDPFMITDR------VTWAQLSVALNIKFGSCTGRSLTIDNLDFLYEKLQREERSEYITWNQFCKEPMPDRSFTFWEWFF-AIMKLTKDHMLGMWKAGCIMGFINKTKAQTDLLRSVYGIGTFLLRFSD 502          
BLAST of SMED30003001 vs. Ensembl Fly
Match: Stat92E (gene:FBgn0016917 transcript:FBtr0089485)

HSP 1 Score: 60.8474 bits (146), Expect = 1.649e-9
Identity = 81/321 (25.23%), Postives = 145/321 (45.17%), Query Frame = 1
Query:  160 KSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVT------NKNLXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDAR-------ERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYF-RLDRYSFKNSGRFDCSESVDVNQLISNISDYFLKQTSRGLTPSNQVFLRAKLIK--MSYNITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK---ESETLFTGSTSGSFFLRFSE 1062
            + ++++   L+  +F++   PP+++K      T T F AS   LI ++  + ++ P     +++E   + FVT      N +L+ +S  +I +       ++  N ++    ++ +       E+K  + +   K    F    T   F      +I+    S  V+ +VH NQE  +  T+ WD+ F  + R  F  + R      V   QL   ++  F   T R LT  N  FL  KL +   S  IT++ F +  MP+   +F  W    I  L  + ++GMWK   I GF++K   +++ L +    G+F LRFS+
Sbjct:  328 EQVQNAQKNLVCSAFIVDKQPPQVMK------TNTRFAASVRWLIGSQLGIHNNPPTVECIIMSEIQSQRFVTRNTQMDNSSLSGQSSGEIQNASSTME-YQQNNHVFSASFRNMQLKKIKRAEKKGTESVMDEKFALFFYTTTTVNDF------QIRVWTLSLPVVVIVHGNQEPQSWATITWDNAFAEIVRDPFMITDR------VTWAQLSVALNIKFGSCTGRSLTIDNLDFLYEKLQREERSEYITWNQFCKEPMPDRSFTFWEWFF-AIMKLTKDHMLGMWKAGCIMGFINKTKAQTDLLRSVYGIGTFLLRFSD 628          
BLAST of SMED30003001 vs. Ensembl Fly
Match: Stat92E (gene:FBgn0016917 transcript:FBtr0089487)

HSP 1 Score: 60.8474 bits (146), Expect = 1.649e-9
Identity = 81/321 (25.23%), Postives = 145/321 (45.17%), Query Frame = 1
Query:  160 KSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVT------NKNLXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDAR-------ERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYF-RLDRYSFKNSGRFDCSESVDVNQLISNISDYFLKQTSRGLTPSNQVFLRAKLIK--MSYNITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK---ESETLFTGSTSGSFFLRFSE 1062
            + ++++   L+  +F++   PP+++K      T T F AS   LI ++  + ++ P     +++E   + FVT      N +L+ +S  +I +       ++  N ++    ++ +       E+K  + +   K    F    T   F      +I+    S  V+ +VH NQE  +  T+ WD+ F  + R  F  + R      V   QL   ++  F   T R LT  N  FL  KL +   S  IT++ F +  MP+   +F  W    I  L  + ++GMWK   I GF++K   +++ L +    G+F LRFS+
Sbjct:  328 EQVQNAQKNLVCSAFIVDKQPPQVMK------TNTRFAASVRWLIGSQLGIHNNPPTVECIIMSEIQSQRFVTRNTQMDNSSLSGQSSGEIQNASSTME-YQQNNHVFSASFRNMQLKKIKRAEKKGTESVMDEKFALFFYTTTTVNDF------QIRVWTLSLPVVVIVHGNQEPQSWATITWDNAFAEIVRDPFMITDR------VTWAQLSVALNIKFGSCTGRSLTIDNLDFLYEKLQREERSEYITWNQFCKEPMPDRSFTFWEWFF-AIMKLTKDHMLGMWKAGCIMGFINKTKAQTDLLRSVYGIGTFLLRFSD 628          
BLAST of SMED30003001 vs. Ensembl Zebrafish
Match: stat5a (signal transducer and activator of transcription 5a [Source:ZFIN;Acc:ZDB-GENE-030820-2])

HSP 1 Score: 70.8626 bits (172), Expect = 1.926e-12
Identity = 88/381 (23.10%), Postives = 160/381 (41.99%), Query Frame = 1
Query:  151 DMSKSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVTNKN--------LXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDAR--ERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGR--FDCSESVDVNQLISNISDYFLK--QTSRGLTPSNQVFLRAKLIKMS---------YNITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK-ESETLFTGSTSGSFFLRFSERN------PKIXXXXXXXXXXDAWS--PFSIDECRSRSLPERLMDYQELRFL 1194
            D++ ++ D I  L+  +F++   PP+++K      T T F A+   L+  K  +  + PQ    +++E   K  + N+N        + + + +              +NM     +K  R  +R+  + +T  K   LF  + +     L    ++KT   S  V+ +VH +Q+ +A  T+ WD+       +F   GR  F   + V   QL   ++  +    Q++RGL   N VFL  K    S           +T+  F R  +P    +F  W   +++L K       W +  I GFV+K +++ +     +G+F LRFS+          +        +   W+  P++  +   RSL +R+ D   L FL
Sbjct:  315 DLNSTITDIISTLVTSTFIIEKQPPQVLK------TQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKALLKNENTRNDSSGEILNNNCVMEYHQTTGTLSAHFRNM----SLKRIRRSDRRGAESVTEEKFTILFESQFSVGGNEL--GFQVKT--LSLPVVVIVHGSQDNNATATVLWDN-------AFAEPGRVPFIVPDKVLWAQLCEALNMKYKAEVQSNRGLCEENLVFLAQKAFSSSSVNPDDYRNMTMTWSQFNRESLPGRNFTFWQWFDGVMELTKKHLKPH-WNDGAILGFVNKQQAQDMLMSKPNGTFLLRFSDSEIGGITIAWVAENPNKAGERMVWNLMPYTTKDFSIRSLADRISDLNHLLFL 673          
BLAST of SMED30003001 vs. Ensembl Zebrafish
Match: stat5a (signal transducer and activator of transcription 5a [Source:ZFIN;Acc:ZDB-GENE-030820-2])

HSP 1 Score: 70.8626 bits (172), Expect = 1.926e-12
Identity = 88/381 (23.10%), Postives = 160/381 (41.99%), Query Frame = 1
Query:  151 DMSKSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVTNKN--------LXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDAR--ERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGR--FDCSESVDVNQLISNISDYFLK--QTSRGLTPSNQVFLRAKLIKMS---------YNITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK-ESETLFTGSTSGSFFLRFSERN------PKIXXXXXXXXXXDAWS--PFSIDECRSRSLPERLMDYQELRFL 1194
            D++ ++ D I  L+  +F++   PP+++K      T T F A+   L+  K  +  + PQ    +++E   K  + N+N        + + + +              +NM     +K  R  +R+  + +T  K   LF  + +     L    ++KT   S  V+ +VH +Q+ +A  T+ WD+       +F   GR  F   + V   QL   ++  +    Q++RGL   N VFL  K    S           +T+  F R  +P    +F  W   +++L K       W +  I GFV+K +++ +     +G+F LRFS+          +        +   W+  P++  +   RSL +R+ D   L FL
Sbjct:  315 DLNSTITDIISTLVTSTFIIEKQPPQVLK------TQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKALLKNENTRNDSSGEILNNNCVMEYHQTTGTLSAHFRNM----SLKRIRRSDRRGAESVTEEKFTILFESQFSVGGNEL--GFQVKT--LSLPVVVIVHGSQDNNATATVLWDN-------AFAEPGRVPFIVPDKVLWAQLCEALNMKYKAEVQSNRGLCEENLVFLAQKAFSSSSVNPDDYRNMTMTWSQFNRESLPGRNFTFWQWFDGVMELTKKHLKPH-WNDGAILGFVNKQQAQDMLMSKPNGTFLLRFSDSEIGGITIAWVAENPNKAGERMVWNLMPYTTKDFSIRSLADRISDLNHLLFL 673          
BLAST of SMED30003001 vs. Ensembl Zebrafish
Match: stat5b (signal transducer and activator of transcription 5b [Source:ZFIN;Acc:ZDB-GENE-040818-1])

HSP 1 Score: 67.781 bits (164), Expect = 1.795e-11
Identity = 96/409 (23.47%), Postives = 165/409 (40.34%), Query Frame = 1
Query:  151 DMSKSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVTNKNLXXXXXXXXXXXXXXXXXWE--IKNMIYEPPVKDARERKKFDR-----ITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGR--FDCSESVDVNQLISNISDYFLK--QTSRGLTPSNQVFLRAKLIKMSYN---------ITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK-ESETLFTGSTSGSFFLRFSERN------PKIXXXXXXXXXXDAWS--PFSIDECRSRSLPERLMDYQELRFLKDASGKFLDKVEALSQFIDKTNP---DDGYT 1278
            +++  + D I  L+  +F++   PP+++K      T T F+A+   L+  K  +  + PQ    +++E   K  + N+N                  +     N+         +  K+ DR     +T  K   LF  + +     L     +KT   S  V+ +VH +Q+ +A  T+ WD+       +F   GR  F   + V   QL   ++  +    Q+ RGL+  N VFL  K    S N         IT+  F R  +P    +F  W   +I+L+K       W +  I GF++K +++ +     +G+F LRFS+          +        +   W+  PF+  +   RSL +R+ D   L FL  +      K E  S++    N     DGY 
Sbjct:  315 ELNAIVTDIISTLVTSTFIIEKQPPQVLK------TQTKFSATVRLLVGGKLNVHMNPPQVKATIISEQQAKAILKNENTRKSESSGDILNNNCVMEYHQTTGNLSAHFRTMSLKRIKRSDRRGAESVTEEKFTILFESQFSVGVNEL--VFHVKT--LSLPVVVIVHGSQDNNATATVLWDN-------AFSEPGRVPFVVPDKVVWPQLCEALNMKYKSEVQSDRGLSEDNLVFLAQKAFSSSSNNPEDYSSMTITWSQFNRESLPGRNFTFWQWFDGVIELMKKHLKSH-WNDGAILGFLNKQQAQDMLMSKPNGTFLLRFSDSEIGGITIAWVAENPNKAGERMVWNLMPFTTKDFSIRSLADRISDLNHLLFLYPSQ----PKEEVFSRYCTPPNSKAVGDGYV 701          
BLAST of SMED30003001 vs. Ensembl Zebrafish
Match: stat5b (signal transducer and activator of transcription 5b [Source:ZFIN;Acc:ZDB-GENE-040818-1])

HSP 1 Score: 66.6254 bits (161), Expect = 3.695e-11
Identity = 99/408 (24.26%), Postives = 170/408 (41.67%), Query Frame = 1
Query:  151 DMSKSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVTNKNLXXXXXXXXXXXXXXXXXWEI-KNMIYEPPVKDARERKKFDR-----ITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGR--FDCSESVDVNQLISNISDYFLK--QTSRGLTPSNQVFLRAKLIKMSYN---------ITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK-ESETLFTGSTSGSFFLRFSERN------PKIXXXXXXXXXXDAWS--PFSIDECRSRSLPERLMDYQELRFLKDASGKFLDKVEALSQFIDKTNP---DDGYT 1278
            +++  + D I  L+  +F++   PP+++K      T T F+A+   L+  K  +  + PQ    +++E   K  + N+N  +ES   I +        +   N+         +  K+ DR     +T  K   LF  + +     L     +KT   S  V+ +VH +Q+ +A  T+ WD+       +F   GR  F   + V   QL   ++  +    Q+ RGL+  N VFL  K    S N         IT+  F R  +P    +F  W   +I+L+K       W +  I GF++K +++ +     +G+F LRFS+          +        +   W+  PF+  +   RSL +R+ D   L FL  +      K E  S++    N     DGY 
Sbjct:  315 ELNAIVTDIISTLVTSTFIIEKQPPQVLK------TQTKFSATVRLLVGGKLNVHMNPPQVKATIISEQQAKAILKNENTRNESSGDILNNNCVMEYHQTTGNLSAHFRTMSLKRIKRSDRRGAESVTEEKFTILFESQFSVGVNEL--VFHVKT--LSLPVVVIVHGSQDNNATATVLWDN-------AFSEPGRVPFVVPDKVVWPQLCEALNMKYKSEVQSDRGLSEDNLVFLAQKAFSSSSNNPEDYSSMTITWSQFNRESLPGRNFTFWQWFDGVIELMKKHLKSH-WNDGAILGFLNKQQAQDMLMSKPNGTFLLRFSDSEIGGITIAWVAENPNKAGERMVWNLMPFTTKDFSIRSLADRISDLNHLLFLYPSQ----PKEEVFSRYCTPPNSKAVGDGYV 700          
BLAST of SMED30003001 vs. Ensembl Zebrafish
Match: stat5b (signal transducer and activator of transcription 5b [Source:ZFIN;Acc:ZDB-GENE-040818-1])

HSP 1 Score: 66.6254 bits (161), Expect = 3.695e-11
Identity = 99/408 (24.26%), Postives = 170/408 (41.67%), Query Frame = 1
Query:  151 DMSKSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVTNKNLXXXXXXXXXXXXXXXXXWEI-KNMIYEPPVKDARERKKFDR-----ITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGR--FDCSESVDVNQLISNISDYFLK--QTSRGLTPSNQVFLRAKLIKMSYN---------ITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK-ESETLFTGSTSGSFFLRFSERN------PKIXXXXXXXXXXDAWS--PFSIDECRSRSLPERLMDYQELRFLKDASGKFLDKVEALSQFIDKTNP---DDGYT 1278
            +++  + D I  L+  +F++   PP+++K      T T F+A+   L+  K  +  + PQ    +++E   K  + N+N  +ES   I +        +   N+         +  K+ DR     +T  K   LF  + +     L     +KT   S  V+ +VH +Q+ +A  T+ WD+       +F   GR  F   + V   QL   ++  +    Q+ RGL+  N VFL  K    S N         IT+  F R  +P    +F  W   +I+L+K       W +  I GF++K +++ +     +G+F LRFS+          +        +   W+  PF+  +   RSL +R+ D   L FL  +      K E  S++    N     DGY 
Sbjct:  315 ELNAIVTDIISTLVTSTFIIEKQPPQVLK------TQTKFSATVRLLVGGKLNVHMNPPQVKATIISEQQAKAILKNENTRNESSGDILNNNCVMEYHQTTGNLSAHFRTMSLKRIKRSDRRGAESVTEEKFTILFESQFSVGVNEL--VFHVKT--LSLPVVVIVHGSQDNNATATVLWDN-------AFSEPGRVPFVVPDKVVWPQLCEALNMKYKSEVQSDRGLSEDNLVFLAQKAFSSSSNNPEDYSSMTITWSQFNRESLPGRNFTFWQWFDGVIELMKKHLKSH-WNDGAILGFLNKQQAQDMLMSKPNGTFLLRFSDSEIGGITIAWVAENPNKAGERMVWNLMPFTTKDFSIRSLADRISDLNHLLFLYPSQ----PKEEVFSRYCTPPNSKAVGDGYV 700          
BLAST of SMED30003001 vs. Ensembl Xenopus
Match: map2 (microtubule associated protein 2 [Source:Xenbase;Acc:XB-GENE-5945202])

HSP 1 Score: 68.5514 bits (166), Expect = 1.374e-11
Identity = 98/431 (22.74%), Postives = 176/431 (40.84%), Query Frame = 1
Query:   43 QRMATYRSLTEFTTELYSTLCEIVIEIHNNPRNDER--------------------DMSKSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVTNKN--------LXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDARERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGR--FDCSESVDVNQLISNISDYFLK--QTSRGLTPSNQVFLRAKLIKMSYN---------ITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK-ESETLFTGSTSGSFFLRFSERNPKIXXXXXXXXXXD--AWS--PFSIDECRSRSLPERLMDYQELRFL 1194
            Q++A      E   +L  T CE + EI    R   R                    +++ ++ D I  L+  +F++   PP+++K      T T F A+   L+  K  +  + PQ    +++E   K  + N+N        + +   +              +NM  +   +   +R+  + +T  K   LF  + +     L    ++KT   S  V+ +VH +Q+ +A  T+ WD+       +F   GR  F   + V   QL   ++  F    Q++RGL+  N VFL  KL   + +         +++  F R ++P    +F  W   ++++LK       W +  I GFV+K ++  +      G+F LRFS+       +       D   W+  PF+  +   RSL +RL D   L F+
Sbjct:  259 QQLAGNGGPPEGGLDLLQTWCEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEELLSELNATITDIISALVTSTFIIEKQPPQVLK------TQTKFAATVRLLVGGKLNVHMNPPQVKATIISELQAKALLKNENTRNESSGEILNNCCVMEYHQATGTLSAHFRNMSLKRIKRS--DRRGAESVTEEKFTILFESQFSVGGNEL--VFQVKT--LSLPVVVIVHGSQDNNATATVLWDN-------AFAEPGRVPFVVPDKVVWPQLCDALNMKFKAEVQSNRGLSDENLVFLAQKLFNSNLSHKDDYSNMTVSWAQFNRENLPGWNYTFWQWFDGVMEVLKKHLKPH-WNDGAILGFVNKQQAHDMLVNKRDGTFLLRFSDSEIGGITIAWKFELPDRALWNLMPFTARDFSVRSLADRLGDLNYLIFV 669          
BLAST of SMED30003001 vs. Ensembl Xenopus
Match: map2 (microtubule associated protein 2 [Source:Xenbase;Acc:XB-GENE-5945202])

HSP 1 Score: 68.5514 bits (166), Expect = 1.530e-11
Identity = 98/431 (22.74%), Postives = 176/431 (40.84%), Query Frame = 1
Query:   43 QRMATYRSLTEFTTELYSTLCEIVIEIHNNPRNDER--------------------DMSKSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVTNKN--------LXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDARERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGR--FDCSESVDVNQLISNISDYFLK--QTSRGLTPSNQVFLRAKLIKMSYN---------ITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK-ESETLFTGSTSGSFFLRFSERNPKIXXXXXXXXXXD--AWS--PFSIDECRSRSLPERLMDYQELRFL 1194
            Q++A      E   +L  T CE + EI    R   R                    +++ ++ D I  L+  +F++   PP+++K      T T F A+   L+  K  +  + PQ    +++E   K  + N+N        + +   +              +NM  +   +   +R+  + +T  K   LF  + +     L    ++KT   S  V+ +VH +Q+ +A  T+ WD+       +F   GR  F   + V   QL   ++  F    Q++RGL+  N VFL  KL   + +         +++  F R ++P    +F  W   ++++LK       W +  I GFV+K ++  +      G+F LRFS+       +       D   W+  PF+  +   RSL +RL D   L F+
Sbjct:  259 QQLAGNGGPPEGGLDLLQTWCEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEELLSELNATITDIISALVTSTFIIEKQPPQVLK------TQTKFAATVRLLVGGKLNVHMNPPQVKATIISELQAKALLKNENTRNESSGEILNNCCVMEYHQATGTLSAHFRNMSLKRIKRS--DRRGAESVTEEKFTILFESQFSVGGNEL--VFQVKT--LSLPVVVIVHGSQDNNATATVLWDN-------AFAEPGRVPFVVPDKVVWPQLCDALNMKFKAEVQSNRGLSDENLVFLAQKLFNSNLSHKDDYSNMTVSWAQFNRENLPGWNYTFWQWFDGVMEVLKKHLKPH-WNDGAILGFVNKQQAHDMLVNKRDGTFLLRFSDSEIGGITIAWKFELPDRALWNLMPFTARDFSVRSLADRLGDLNYLIFV 669          
BLAST of SMED30003001 vs. Ensembl Xenopus
Match: map2 (microtubule associated protein 2 [Source:Xenbase;Acc:XB-GENE-5945202])

HSP 1 Score: 68.1662 bits (165), Expect = 1.790e-11
Identity = 99/431 (22.97%), Postives = 178/431 (41.30%), Query Frame = 1
Query:   43 QRMATYRSLTEFTTELYSTLCEIVIEIHNNPRNDER--------------------DMSKSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVTNKN--------LXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDARERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGR--FDCSESVDVNQLISNISDYFLK--QTSRGLTPSNQVFLRAKLIKMSYN---------ITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK-ESETLFTGSTSGSFFLRFSERNPKIXXXXXXXXXXD--AWS--PFSIDECRSRSLPERLMDYQELRFL 1194
            Q++A      E   +L  T CE + EI    R   R                    +++ ++ D I  L+  +F++   PP+++K      T T F A+   L+  K  +  + PQ    +++E   K  + N+N        + +   +              +NM  +  +K + +R+  + +T  K   LF  + +     L    ++KT   S  V+ +VH +Q+ +A  T+ WD+       +F   GR  F   + V   QL   ++  F    Q++RGL+  N VFL  KL   + +         +++  F R ++P    +F  W   ++++LK       W +  I GFV+K ++  +      G+F LRFS+       +       D   W+  PF+  +   RSL +RL D   L F+
Sbjct:  265 QQLAGNGGPPEGGLDLLQTWCEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEELLSELNATITDIISALVTSTFIIEKQPPQVLK------TQTKFAATVRLLVGGKLNVHMNPPQVKATIISELQAKALLKNENTRNESSGEILNNCCVMEYHQATGTLSAHFRNMSLKR-IKRS-DRRGAESVTEEKFTILFESQFSVGGNEL--VFQVKT--LSLPVVVIVHGSQDNNATATVLWDN-------AFAEPGRVPFVVPDKVVWPQLCDALNMKFKAEVQSNRGLSDENLVFLAQKLFNSNLSHKDDYSNMTVSWAQFNRENLPGWNYTFWQWFDGVMEVLKKHLKPH-WNDGAILGFVNKQQAHDMLVNKRDGTFLLRFSDSEIGGITIAWKFELPDRALWNLMPFTARDFSVRSLADRLGDLNYLIFV 675          
BLAST of SMED30003001 vs. Ensembl Xenopus
Match: map2 (microtubule associated protein 2 [Source:Xenbase;Acc:XB-GENE-5945202])

HSP 1 Score: 68.1662 bits (165), Expect = 1.790e-11
Identity = 99/431 (22.97%), Postives = 178/431 (41.30%), Query Frame = 1
Query:   43 QRMATYRSLTEFTTELYSTLCEIVIEIHNNPRNDER--------------------DMSKSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVTNKN--------LXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDARERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGR--FDCSESVDVNQLISNISDYFLK--QTSRGLTPSNQVFLRAKLIKMSYN---------ITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK-ESETLFTGSTSGSFFLRFSERNPKIXXXXXXXXXXD--AWS--PFSIDECRSRSLPERLMDYQELRFL 1194
            Q++A      E   +L  T CE + EI    R   R                    +++ ++ D I  L+  +F++   PP+++K      T T F A+   L+  K  +  + PQ    +++E   K  + N+N        + +   +              +NM  +  +K + +R+  + +T  K   LF  + +     L    ++KT   S  V+ +VH +Q+ +A  T+ WD+       +F   GR  F   + V   QL   ++  F    Q++RGL+  N VFL  KL   + +         +++  F R ++P    +F  W   ++++LK       W +  I GFV+K ++  +      G+F LRFS+       +       D   W+  PF+  +   RSL +RL D   L F+
Sbjct:  265 QQLAGNGGPPEGGLDLLQTWCEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEELLSELNATITDIISALVTSTFIIEKQPPQVLK------TQTKFAATVRLLVGGKLNVHMNPPQVKATIISELQAKALLKNENTRNESSGEILNNCCVMEYHQATGTLSAHFRNMSLKR-IKRS-DRRGAESVTEEKFTILFESQFSVGGNEL--VFQVKT--LSLPVVVIVHGSQDNNATATVLWDN-------AFAEPGRVPFVVPDKVVWPQLCDALNMKFKAEVQSNRGLSDENLVFLAQKLFNSNLSHKDDYSNMTVSWAQFNRENLPGWNYTFWQWFDGVMEVLKKHLKPH-WNDGAILGFVNKQQAHDMLVNKRDGTFLLRFSDSEIGGITIAWKFELPDRALWNLMPFTARDFSVRSLADRLGDLNYLIFV 675          
BLAST of SMED30003001 vs. Ensembl Xenopus
Match: map2 (microtubule associated protein 2 [Source:Xenbase;Acc:XB-GENE-5945202])

HSP 1 Score: 67.781 bits (164), Expect = 2.336e-11
Identity = 99/431 (22.97%), Postives = 178/431 (41.30%), Query Frame = 1
Query:   43 QRMATYRSLTEFTTELYSTLCEIVIEIHNNPRNDER--------------------DMSKSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVTNKN--------LXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDARERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGR--FDCSESVDVNQLISNISDYFLK--QTSRGLTPSNQVFLRAKLIKMSYN---------ITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK-ESETLFTGSTSGSFFLRFSERNPKIXXXXXXXXXXD--AWS--PFSIDECRSRSLPERLMDYQELRFL 1194
            Q++A      E   +L  T CE + EI    R   R                    +++ ++ D I  L+  +F++   PP+++K      T T F A+   L+  K  +  + PQ    +++E   K  + N+N        + +   +              +NM  +  +K + +R+  + +T  K   LF  + +     L    ++KT   S  V+ +VH +Q+ +A  T+ WD+       +F   GR  F   + V   QL   ++  F    Q++RGL+  N VFL  KL   + +         +++  F R ++P    +F  W   ++++LK       W +  I GFV+K ++  +      G+F LRFS+       +       D   W+  PF+  +   RSL +RL D   L F+
Sbjct:  259 QQLAGNGGPPEGGLDLLQTWCEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEELLSELNATITDIISALVTSTFIIEKQPPQVLK------TQTKFAATVRLLVGGKLNVHMNPPQVKATIISELQAKALLKNENTRNESSGEILNNCCVMEYHQATGTLSAHFRNMSLKR-IKRS-DRRGAESVTEEKFTILFESQFSVGGNEL--VFQVKT--LSLPVVVIVHGSQDNNATATVLWDN-------AFAEPGRVPFVVPDKVVWPQLCDALNMKFKAEVQSNRGLSDENLVFLAQKLFNSNLSHKDDYSNMTVSWAQFNRENLPGWNYTFWQWFDGVMEVLKKHLKPH-WNDGAILGFVNKQQAHDMLVNKRDGTFLLRFSDSEIGGITIAWKFELPDRALWNLMPFTARDFSVRSLADRLGDLNYLIFV 669          
BLAST of SMED30003001 vs. Ensembl Mouse
Match: Stat5a (signal transducer and activator of transcription 5A [Source:MGI Symbol;Acc:MGI:103036])

HSP 1 Score: 75.0998 bits (183), Expect = 9.820e-14
Identity = 92/375 (24.53%), Postives = 164/375 (43.73%), Query Frame = 1
Query:  151 DMSKSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVTNKN--------LXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDARERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGR--FDCSESVDVNQLISNISDYFLK--QTSRGLTPSNQVFLRAKLIKMSYN---------ITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK-ESETLFTGSTSGSFFLRFSERNPKIXXXXXXXXXXD--AWS--PFSIDECRSRSLPERLMDYQELRFL 1194
            +++ ++ D I  L+  +F++   PP+++K      T T F A+   L+  K  +  + PQ    +++E   K  + N+N        + +   +              +NM  +  +K A +R+  + +T  K   LF  + +     L    ++KT   S  V+ +VH +Q+ +A  T+ WD+       +F   GR  F   + V   QL   ++  F    Q++RGLT  N VFL  KL  +S N         +++  F R ++P    +F  W   ++++LK       W +  I GFV+K ++  L      G+F LRFS+       +       D   W+  PF+  +   RSL +RL D   L ++
Sbjct:  315 EVNATITDIISALVTSTFIIEKQPPQVLK------TQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMSLKR-IKRA-DRRGAESVTEEKFTVLFESQFSVGSNEL--VFQVKT--LSLPVVVIVHGSQDHNATATVLWDN-------AFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNISSNHLEDYNSMSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPH-WNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPDRNLWNLKPFTTRDFSIRSLADRLGDLNYLIYV 669          
BLAST of SMED30003001 vs. Ensembl Mouse
Match: Stat5a (signal transducer and activator of transcription 5A [Source:MGI Symbol;Acc:MGI:103036])

HSP 1 Score: 75.0998 bits (183), Expect = 9.820e-14
Identity = 92/375 (24.53%), Postives = 164/375 (43.73%), Query Frame = 1
Query:  151 DMSKSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVTNKN--------LXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDARERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGR--FDCSESVDVNQLISNISDYFLK--QTSRGLTPSNQVFLRAKLIKMSYN---------ITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK-ESETLFTGSTSGSFFLRFSERNPKIXXXXXXXXXXD--AWS--PFSIDECRSRSLPERLMDYQELRFL 1194
            +++ ++ D I  L+  +F++   PP+++K      T T F A+   L+  K  +  + PQ    +++E   K  + N+N        + +   +              +NM  +  +K A +R+  + +T  K   LF  + +     L    ++KT   S  V+ +VH +Q+ +A  T+ WD+       +F   GR  F   + V   QL   ++  F    Q++RGLT  N VFL  KL  +S N         +++  F R ++P    +F  W   ++++LK       W +  I GFV+K ++  L      G+F LRFS+       +       D   W+  PF+  +   RSL +RL D   L ++
Sbjct:  315 EVNATITDIISALVTSTFIIEKQPPQVLK------TQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMSLKR-IKRA-DRRGAESVTEEKFTVLFESQFSVGSNEL--VFQVKT--LSLPVVVIVHGSQDHNATATVLWDN-------AFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNISSNHLEDYNSMSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPH-WNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPDRNLWNLKPFTTRDFSIRSLADRLGDLNYLIYV 669          
BLAST of SMED30003001 vs. Ensembl Mouse
Match: Stat5a (signal transducer and activator of transcription 5A [Source:MGI Symbol;Acc:MGI:103036])

HSP 1 Score: 73.9442 bits (180), Expect = 2.000e-13
Identity = 92/375 (24.53%), Postives = 164/375 (43.73%), Query Frame = 1
Query:  151 DMSKSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVTNKN--------LXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDARERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGR--FDCSESVDVNQLISNISDYFLK--QTSRGLTPSNQVFLRAKLIKMSYN---------ITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK-ESETLFTGSTSGSFFLRFSERNPKIXXXXXXXXXXD--AWS--PFSIDECRSRSLPERLMDYQELRFL 1194
            +++ ++ D I  L+  +F++   PP+++K      T T F A+   L+  K  +  + PQ    +++E   K  + N+N        + +   +              +NM  +  +K A +R+  + +T  K   LF  + +     L    ++KT   S  V+ +VH +Q+ +A  T+ WD+       +F   GR  F   + V   QL   ++  F    Q++RGLT  N VFL  KL  +S N         +++  F R ++P    +F  W   ++++LK       W +  I GFV+K ++  L      G+F LRFS+       +       D   W+  PF+  +   RSL +RL D   L ++
Sbjct:  315 EVNATITDIISALVTSTFIIEKQPPQVLK------TQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMSLKR-IKRA-DRRGAESVTEEKFTVLFESQFSVGSNEL--VFQVKT--LSLPVVVIVHGSQDHNATATVLWDN-------AFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNISSNHLEDYNSMSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPH-WNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPDRNLWNLKPFTTRDFSIRSLADRLGDLNYLIYV 669          
BLAST of SMED30003001 vs. Ensembl Mouse
Match: Stat5b (signal transducer and activator of transcription 5B [Source:MGI Symbol;Acc:MGI:103035])

HSP 1 Score: 72.7886 bits (177), Expect = 5.145e-13
Identity = 80/327 (24.46%), Postives = 146/327 (44.65%), Query Frame = 1
Query:  151 DMSKSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVTNKN--------LXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDARERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGR--FDCSESVDVNQLISNISDYFLK--QTSRGLTPSNQVFLRAKLIKMSYN---------ITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK-ESETLFTGSTSGSFFLRFSE 1062
            +++ ++ D I  L+  +F++   PP+++K      T T F A+   L+  K  +  + PQ    +++E   K  + N+N        + +   +              +NM  +  +K + +R+  + +T  K   LF  + +     L    ++KT   S  V+ +VH +Q+ +A  T+ WD+       +F   GR  F   + V   QL   ++  F    Q++RGLT  N VFL  KL  +S N         +++  F R ++P    +F  W   ++++LK       W +  I GFV+K ++  L      G+F LRFS+
Sbjct:  315 EVNATITDIISALVTSTFIIEKQPPQVLK------TQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMSLKR-IKRS-DRRGAESVTEEKFTILFDSQFSVGGNEL--VFQVKT--LSLPVVVIVHGSQDNNATATVLWDN-------AFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNISSNHLEDYNSMSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPH-WNDGAILGFVNKQQAHDLLINKPDGTFLLRFSD 621          
BLAST of SMED30003001 vs. Ensembl Mouse
Match: Stat5b (signal transducer and activator of transcription 5B [Source:MGI Symbol;Acc:MGI:103035])

HSP 1 Score: 72.7886 bits (177), Expect = 5.145e-13
Identity = 80/327 (24.46%), Postives = 146/327 (44.65%), Query Frame = 1
Query:  151 DMSKSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVTNKN--------LXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDARERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGR--FDCSESVDVNQLISNISDYFLK--QTSRGLTPSNQVFLRAKLIKMSYN---------ITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK-ESETLFTGSTSGSFFLRFSE 1062
            +++ ++ D I  L+  +F++   PP+++K      T T F A+   L+  K  +  + PQ    +++E   K  + N+N        + +   +              +NM  +  +K + +R+  + +T  K   LF  + +     L    ++KT   S  V+ +VH +Q+ +A  T+ WD+       +F   GR  F   + V   QL   ++  F    Q++RGLT  N VFL  KL  +S N         +++  F R ++P    +F  W   ++++LK       W +  I GFV+K ++  L      G+F LRFS+
Sbjct:  315 EVNATITDIISALVTSTFIIEKQPPQVLK------TQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMSLKR-IKRS-DRRGAESVTEEKFTILFDSQFSVGGNEL--VFQVKT--LSLPVVVIVHGSQDNNATATVLWDN-------AFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNISSNHLEDYNSMSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPH-WNDGAILGFVNKQQAHDLLINKPDGTFLLRFSD 621          
BLAST of SMED30003001 vs. UniProt/SwissProt
Match: sp|P42230|STA5A_MOUSE (Signal transducer and activator of transcription 5A OS=Mus musculus OX=10090 GN=Stat5a PE=1 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 6.869e-13
Identity = 92/375 (24.53%), Postives = 164/375 (43.73%), Query Frame = 1
Query:  151 DMSKSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVTNKN--------LXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDARERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGR--FDCSESVDVNQLISNISDYFLK--QTSRGLTPSNQVFLRAKLIKMSYN---------ITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK-ESETLFTGSTSGSFFLRFSERNPKIXXXXXXXXXXD--AWS--PFSIDECRSRSLPERLMDYQELRFL 1194
            +++ ++ D I  L+  +F++   PP+++K      T T F A+   L+  K  +  + PQ    +++E   K  + N+N        + +   +              +NM  +  +K A +R+  + +T  K   LF  + +     L    ++KT   S  V+ +VH +Q+ +A  T+ WD+       +F   GR  F   + V   QL   ++  F    Q++RGLT  N VFL  KL  +S N         +++  F R ++P    +F  W   ++++LK       W +  I GFV+K ++  L      G+F LRFS+       +       D   W+  PF+  +   RSL +RL D   L ++
Sbjct:  315 EVNATITDIISALVTSTFIIEKQPPQVLK------TQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMSLKR-IKRA-DRRGAESVTEEKFTVLFESQFSVGSNEL--VFQVKT--LSLPVVVIVHGSQDHNATATVLWDN-------AFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNISSNHLEDYNSMSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPH-WNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPDRNLWNLKPFTTRDFSIRSLADRLGDLNYLIYV 669          
BLAST of SMED30003001 vs. UniProt/SwissProt
Match: sp|P42231|STA5A_SHEEP (Signal transducer and activator of transcription 5A OS=Ovis aries OX=9940 GN=STAT5A PE=1 SV=2)

HSP 1 Score: 73.1738 bits (178), Expect = 2.551e-12
Identity = 93/375 (24.80%), Postives = 165/375 (44.00%), Query Frame = 1
Query:  151 DMSKSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVTNKN--------LXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDARERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGR--FDCSESVDVNQLISNISDYFLK--QTSRGLTPSNQVFLRAKLIKMS------YN---ITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK-ESETLFTGSTSGSFFLRFSERNPKIXXXXXXXXXXD--AWS--PFSIDECRSRSLPERLMDYQELRFL 1194
            +++ ++ D I  L+  +F++   PP+++K      T T F A+   L+  K  +  + PQ    +++E   K  + N+N        + +   +     +        +NM  +  +K A +R+  + +T  K   LF  + +     L    ++KT   S  V+ +VH +Q+ +A  T+ WD+       +F   GR  F   + V   QL   ++  F    Q++RGLT  N +FL  KL   S      YN   +++  F R ++P    +F  W   ++++LK       W +  I GFV+K ++  L      G+F LRFS+       +       D   W+  PF+  E   RSL +RL D   L ++
Sbjct:  315 EVNATITDIISALVTSTFIIEKQPPQVLK------TQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQRTGTLSAHFRNMSLKR-IKRA-DRRGAESVTEEKFTVLFESQFSVGSNEL--VFQVKT--LSLPVVVIVHGSQDHNATATVLWDN-------AFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLLFLAQKLFNNSSSHLEDYNGMSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPH-WNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPDRNLWNLKPFTTREGSIRSLADRLGDLNYLIYV 669          
BLAST of SMED30003001 vs. UniProt/SwissProt
Match: sp|Q95115|STA5A_BOVIN (Signal transducer and activator of transcription 5A OS=Bos taurus OX=9913 GN=STAT5A PE=2 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 3.404e-12
Identity = 93/375 (24.80%), Postives = 164/375 (43.73%), Query Frame = 1
Query:  151 DMSKSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVTNKN--------LXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDARERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGR--FDCSESVDVNQLISNISDYFLK--QTSRGLTPSNQVFLRAKLIKMS------YN---ITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK-ESETLFTGSTSGSFFLRFSERNPKIXXXXXXXXXXD--AWS--PFSIDECRSRSLPERLMDYQELRFL 1194
            +++ ++ D I  L+  +F++   PP+++K      T T F A+   L+  K  +  + PQ    +++E   K  + N+N        + +   +              +NM  +  +K A +R+  + +T  K   LF  + +     L    ++KT   S  V+ +VH +Q+ +A  T+ WD+       +F   GR  F   + V   QL   ++  F    Q++RGLT  N VFL  KL   S      YN   +++  F R ++P    +F  W   ++++LK       W +  I GFV+K ++  L      G+F LRFS+       +       D   W+  PF+  +   RSL +RL D   L ++
Sbjct:  315 EVNATITDIISALVTSTFIIEKQPPQVLK------TQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMSLKR-IKRA-DRRGAESVTEEKFTVLFESQFSVGSNEL--VFQVKT--LSLPVVVIVHGSQDHNATATVLWDN-------AFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNSSSSHLEDYNGMSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPH-WNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPDRNLWNLKPFTTRDFSIRSLADRLGDLNYLIYV 669          
BLAST of SMED30003001 vs. UniProt/SwissProt
Match: sp|P42232|STA5B_MOUSE (Signal transducer and activator of transcription 5B OS=Mus musculus OX=10090 GN=Stat5b PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 3.599e-12
Identity = 80/327 (24.46%), Postives = 146/327 (44.65%), Query Frame = 1
Query:  151 DMSKSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVTNKN--------LXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDARERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGR--FDCSESVDVNQLISNISDYFLK--QTSRGLTPSNQVFLRAKLIKMSYN---------ITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK-ESETLFTGSTSGSFFLRFSE 1062
            +++ ++ D I  L+  +F++   PP+++K      T T F A+   L+  K  +  + PQ    +++E   K  + N+N        + +   +              +NM  +  +K + +R+  + +T  K   LF  + +     L    ++KT   S  V+ +VH +Q+ +A  T+ WD+       +F   GR  F   + V   QL   ++  F    Q++RGLT  N VFL  KL  +S N         +++  F R ++P    +F  W   ++++LK       W +  I GFV+K ++  L      G+F LRFS+
Sbjct:  315 EVNATITDIISALVTSTFIIEKQPPQVLK------TQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMSLKR-IKRS-DRRGAESVTEEKFTILFDSQFSVGGNEL--VFQVKT--LSLPVVVIVHGSQDNNATATVLWDN-------AFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNISSNHLEDYNSMSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPH-WNDGAILGFVNKQQAHDLLINKPDGTFLLRFSD 621          
BLAST of SMED30003001 vs. UniProt/SwissProt
Match: sp|Q62771|STA5A_RAT (Signal transducer and activator of transcription 5A OS=Rattus norvegicus OX=10116 GN=Stat5a PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 4.344e-12
Identity = 91/375 (24.27%), Postives = 163/375 (43.47%), Query Frame = 1
Query:  151 DMSKSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVTNKN--------LXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDARERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGR--FDCSESVDVNQLISNISDYFLK--QTSRGLTPSNQVFLRAKLIKM---------SYNITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK-ESETLFTGSTSGSFFLRFSERNPKIXXXXXXXXXXD--AWS--PFSIDECRSRSLPERLMDYQELRFL 1194
            +++ ++ D I  L+  +F++   PP+++K      T T F A+   L+  K  +  + PQ    +++E   K  + N+N        + +   +              +NM  +  +K A +R+  + +T  K   LF  + +     L    ++KT   S  V+ +VH +Q+ +A  T+ WD+       +F   GR  F   + V   QL   ++  F    Q++RGLT  N VFL  KL            S ++++  F R ++P    +F  W   ++++LK       W +  I GFV+K ++  L      G+F LRFS+       +       D   W+  PF+  +   RSL +RL D   L ++
Sbjct:  315 EVNATITDIISALVTSTFIIEKQPPQVLK------TQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMSLKR-IKRA-DRRGAESVTEEKFTVLFESQFSVGSNEL--VFQVKT--LSLPVVVIVHGSQDHNATATVLWDN-------AFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNRRSNHLEDYNSMSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPH-WNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPDRNLWNLKPFTTRDFSIRSLADRLGDLNYLIYV 669          
BLAST of SMED30003001 vs. TrEMBL
Match: R7V959 (Signal transducer and activator of transcription OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_114078 PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 2.774e-12
Identity = 95/369 (25.75%), Postives = 163/369 (44.17%), Query Frame = 1
Query:  160 KSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFK---------EFVTNKNLXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDARERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGRFDCSESVDVNQLISNISDYFLKQTSRGLTPSNQVFLRAKLIKMSYN-----ITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSKE-SETLFTGSTSGSFFLRFSERN--------PKIXXXXXXXXXXDAWSPFSIDECRSRSLPERLMDYQELRFL 1194
            K + + + +L+  SFVL   P +++KKK        F A+  CLI ++  L  + PQ    +++E   +         + +T+  + + +               ++ M+ +  ++ A E+K  + +T  K    F+ ++T      +++  + T   S  V+  VH NQ+ +A  T+ WD+ F     +  N   F   E V   +L   ++  F+   S GL+P N ++L  KL   + +     I++  F R  +P    +F  W  +I+KL K       WK+ LI GF+SK+ +E     S  GSF LRFS+           K       G  V   SPF+  + R R L +R+ D  EL  L
Sbjct:  317 KRIGEILERLVTSSFVLEKQPSQVLKKKAR------FTATVRCLIGSRLNLQMTLPQVTASIVSEDQARRIFNGEPGSKILTSGVILNNTGTMEYHQASCQLSATLRTMMLDS-IRRA-EKKGNETVTEEKFSIFFQTELTINS---QRTYSVWT--LSLPVVVTVHGNQDCNAQATVLWDNAF-----AESNRILFQVPEKVTWQKLSQTLNTQFVVHCSLGLSPDNLIYLAYKLFGAADDYHMQVISWAQFNREPLPGRSFTFWEWFHSILKLTKDWTQGP-WKDRLILGFISKQRAEDWLLKSQIGSFLLRFSDSELGGISISYVKEDRSQPGGRAVTHVSPFTDKDLRIRGLGDRVKDLDELVCL 666          
BLAST of SMED30003001 vs. TrEMBL
Match: A0A151LYL8 (Signal transducer and activator of transcription 6 OS=Alligator mississippiensis OX=8496 GN=STAT6 PE=4 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 9.227e-12
Identity = 89/371 (23.99%), Postives = 156/371 (42.05%), Query Frame = 1
Query:  166 LEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHF--------NASFSCLIETKELFSSKPQAHVYLLNESDFKEFVTNKNLXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDAR-ERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYF-RLDRYSFKNSGRFDCSESVDVNQLISNISDYFLK--QTSRGLTPSNQVFLRAKLIK---------MSYNITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSKESET-LFTGSTSGSFFLRFSERN-PKIXXXXXXXXXXDAW-----SPFSIDECRSRSLPERLMDYQELRFL 1194
            L D +  L+  SFV+   PP+++K +T  Q G            A   C +   ++ + K QA       S   E  +   +        ++          KN + +   K  R ERK  + +T  K   LF + +T +P  L   L++     S  ++ +VH NQ+ +A  T+ WD+ F   DR  F        +E V   ++   ++  F+   QT+RGL P +  FL  K+               +++  F +  +P    +F  W  + +  L    +   W + LI GF+SK+  + L + +  G+F LR+S+     + +     ++  +W      PFS  +   RSL +R+ D  +LR L
Sbjct:   39 LNDVLTSLVKSSFVVEKQPPQVLKTQTKFQAGVRLLLGPRLLATAPRPCTVRA-DVVTEK-QARDLAQGSSALSE--STGEIMHNMVSLETNPCAGSCCAIFKNALLK---KIKRCERKGSESVTEEKCAVLFSVTVTLSPGNLALPLQV----LSLPIVVIVHGNQDNNAKATVLWDNAFAEPDRVPFV------VAERVPWERMCETLNLKFMSEVQTTRGLQPEHFFFLAQKIFNDHSAGPEAFAGRPVSWAQFNKEILPGRGFTFWQWF-DGVLDLTKRCLKSYWSDRLIRGFISKQYVSRLLSTAPDGTFLLRYSDSEIGGVTIAYLARAEDGSWQVENIQPFSAKDLSIRSLGDRIRDLVQLRNL 391          
BLAST of SMED30003001 vs. TrEMBL
Match: A0A091LAB1 (Signal transducer and transcription activator 6 (Fragment) OS=Cathartes aura OX=43455 GN=N323_05447 PE=4 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.628e-11
Identity = 91/363 (25.07%), Postives = 154/363 (42.42%), Query Frame = 1
Query:  172 DSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETKELFSSKPQAHVYLLNESDFKEFVTNKNLXXXXXXXXXXXXXXXXXWEIKNMIYEPPV--KDAR-ERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYF-RLDRYSFKNSGRFDCSESVDVNQLISNISDYFLK--QTSRGLTPSNQVFLRAKLIK---------MSYNITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSKESET-LFTGSTSGSFFLRFSERNPKIXXXXXXXXXXDAWS------PFSIDECRSRSLPERLMDYQELRFL 1194
            D +  L+  SF++   PP+++K      T T F AS   L+         PQ    LL  S  K ++   ++ +E + +   +    N       +  P +  K  R ERK  + +T  K   LF   +  TP     +L +   + S  ++ +VH NQ+ +A  T+ WD+ F  +DR  F        +E V   ++   ++  F+   QT++GL   +  FL  K+            S ++++  F +  +P    +F  W  + +  L    +   W + LI GF+SK+    L +    G+F LRFS+       +  V    D  S      PFS  +   RSL +R+ D  +LR L
Sbjct:    1 DVLSSLVKSSFLVEKQPPQVLK------TQTKFQASVRFLL--------GPQ----LLKASSAKPYMVRADMVTEKQARELALSAYSNALRGDAQLSPPQLLKKIKRCERKGSESVTEEKCAVLFSTTVALTP----SNLSVHLQVLSLPIVVIVHGNQDNNAKATVLWDNAFSEIDRVPFV------VAERVPWEKMCDTLNLKFMAEVQTTKGLLKEHYFFLAQKIFNDHSASLEDFQSRSVSWAQFNKEILPGRGFTFWQWF-DGVLDLTKRCLKSYWSDRLIIGFISKQYVCKLLSTEPDGTFLLRFSDSEIGGVTIAHVIRGKDGSSQVENIQPFSAKDLSIRSLGDRIRDLGQLRNL 334          
BLAST of SMED30003001 vs. TrEMBL
Match: A0A091Q643 (Signal transducer and transcription activator 6 (Fragment) OS=Leptosomus discolor OX=188344 GN=N330_09186 PE=4 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 4.293e-11
Identity = 88/351 (25.07%), Postives = 149/351 (42.45%), Query Frame = 1
Query:  199 SFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETKELFSSKPQAHVYLLNESDFKEFVTNKNLXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDARERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYF-RLDRYSFKNSGRFDCSESVDVNQLISNISDYFLK--QTSRGLTPSNQVFLRAKLIK---------MSYNITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSKESET-LFTGSTSGSFFLRFSERNPKIXXXXXXXXXXDAWS------PFSIDECRSRSLPERLMDYQELRFL 1194
            SF++   PP+++K      T T F AS   L+  + L   K  A  Y++      + VT K     +    S+          KN++ +  +K   ERK  + +T  K   LF   +   P     +L +   + S  ++ +VH NQ+ +A  T+ WD+ F  +DR  F        +E V   ++   ++  F+   QT++GL   +  FL  K+            S ++++  F +  +P    +F  W  + +  L    +   W + LI GF+SK+    L +    G+F LRFS+       +  V    D  S      PFS  +   RSL +R+ D  +LR L
Sbjct:   49 SFLVEKQPPQVLK------TQTKFQASVRFLLGPQLL---KASAKPYVVR----ADMVTEKQARELALSAYSNALSGTCCANFKNVLLKK-IKRC-ERKGSESVTEEKCAVLFSTTVALAP----SNLSVHLQVLSLPIVVIVHGNQDNNAKATVLWDNAFSEIDRVPFV------VAERVPWEKMCDTLNLKFMAEVQTTKGLLKEHYFFLAQKIFNDHSASLEDFQSRSVSWAQFNKEILPGRGFTFWQWF-DGVLDLTKRCLKSYWSDRLIIGFISKQYVCKLLSTEPDGTFLLRFSDSEIGGVTIAHVIRGKDGSSQVENIQPFSAKDLSIRSLGDRIRDLVQLRNL 373          
BLAST of SMED30003001 vs. TrEMBL
Match: A0A091F206 (Signal transducer and transcription activator 6 (Fragment) OS=Corvus brachyrhynchos OX=85066 GN=N302_04737 PE=4 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 4.816e-11
Identity = 88/375 (23.47%), Postives = 158/375 (42.13%), Query Frame = 1
Query:  166 LEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETKELFSSKPQAHVY---LLNESDFKEFV----------TNKNLXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDARERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYF-RLDRYSFKNSGRFDCSESVDVNQLISNISDYFLK--QTSRGLTPSNQVFLRAKLIK---------MSYNITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSKESET-LFTGSTSGSFFLRFSERNPKIXXXXXXXXXXDAWS------PFSIDECRSRSLPERLMDYQELRFL 1194
            L + +  L+  SF++   PP+++K      T T F AS   L+   +L  + P+ +V    ++ E   +E            +   +        ++          KN++ +  +K   ERK  + +T  K   LF   +  TP     ++ I+  + S  ++ +VH NQ+ +A  T+ WD+ F  +DR  F        +E V   ++   ++  F+   QT++GL   +  FL  K+            S ++++  F +  +P    +F  W  + +  L    +   W + LI GF+SK+    L +    G+F LRFS+       +  V    D  S      PFS  +   RSL +R+ D  +LR L
Sbjct:   35 LNEVLSSLVKSSFLVEKQPPQVLK------TQTKFQASVRFLL-GPQLLKAAPKPYVVRADMVTEKQARELELSNYSNTLSESTGEIMHNMVSLETNPTSGTCCANFKNVLLKK-IKRC-ERKGSESVTEEKCAVLFSTNVALTP----SNISIQLQVLSLPIVVIVHGNQDNNAKATVLWDNAFSEIDRVPFV------VAERVPWEKMCDTLNLKFMAEVQTTKGLLKEHYFFLAQKIFNDHSARFEDFQSRHVSWAQFNKEILPGRGFTFWQWF-DGVLDLTKRCLKSYWSDRLIVGFISKQYVCKLLSAEPDGTFLLRFSDSEIGGVTIAYVIRGKDGSSQVENIQPFSAKDLSIRSLGDRIRDLGQLRNL 389          
BLAST of SMED30003001 vs. Ensembl Cavefish
Match: stat5b (signal transducer and activator of transcription 5B-like [Source:NCBI gene;Acc:103042656])

HSP 1 Score: 72.0182 bits (175), Expect = 5.948e-13
Identity = 91/377 (24.14%), Postives = 165/377 (43.77%), Query Frame = 1
Query:  148 RDMSKSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVTNKN--------LXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDARERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGR--FDCSESVDVNQLISNISDYFLK--QTSRGLTPSNQVFLRAKLIKMSYN---------ITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK-ESETLFTGSTSGSFFLRFSER---NPKIXXXXXXXXXXDAWS--PFSIDECRSRSLPERLMDYQELRFL 1194
            ++++ ++ D I  L+  +F++   PP+++K      T T F  +   L+  K  +  + PQ    ++NE   K  + N+N        + + + +              +NM  +  +K + +R+  + +T  K   LF  + +     L     +KT   S  V+ +VH +Q+ +A  T+ WD+       +F   GR  F   + V   QL   ++  +    Q+ RGL+  N VFL  K    S N         +T+  F R  +P    +F  W   +I+L+K       W +  I GF++K +++ +     +G+F LRFS+       I  V +  +K   W+  PF+  +   RSL +R+ D   L FL
Sbjct:  314 KELNATVTDIISALVTSTFIIEKQPPQVLK------TQTKFATTVRLLVGGKLNVHMNPPQVKATIINEQQAKALLKNENTRNDSSGEILNNNCVMEYHQTTGTLSAHFRNMSLKR-IKRS-DRRGAESVTEEKFTVLFESQFSVGGNELM--FHVKT--LSLPVVVIVHGSQDNNATATVLWDN-------AFSEPGRVPFAVPDKVTWPQLCEALNMKYKSEVQSDRGLSEENLVFLAQKAFSSSSNNPEDYRNMTMTWSQFNRESLPGRNFTFWQWFDGVIELMKKHLKSH-WNDGAILGFLNKQQAQDMLLSKPNGTFLLRFSDSEIGGITIAWVAENPNKRMVWNLMPFTTKDFSIRSLADRISDLNHLLFL 670          
BLAST of SMED30003001 vs. Ensembl Cavefish
Match: stat5b (signal transducer and activator of transcription 5B-like [Source:NCBI gene;Acc:103042656])

HSP 1 Score: 70.8626 bits (172), Expect = 1.721e-12
Identity = 88/380 (23.16%), Postives = 162/380 (42.63%), Query Frame = 1
Query:  148 RDMSKSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVTNKN--------LXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDARERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGR--FDCSESVDVNQLISNISDYFLK--QTSRGLTPSNQVFLRAKLIKMSYN---------ITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK-ESETLFTGSTSGSFFLRFSERN------PKIXXXXXXXXXXDAWS--PFSIDECRSRSLPERLMDYQELRFL 1194
            ++++ ++ D I  L+  +F++   PP+++K      T T F  +   L+  K  +  + PQ    ++NE   K  + N+N        + + + +              +NM  +  +K + +R+  + +T  K   LF  + +     L     +KT   S  V+ +VH +Q+ +A  T+ WD+       +F   GR  F   + V   QL   ++  +    Q+ RGL+  N VFL  K    S N         +T+  F R  +P    +F  W   +I+L+K       W +  I GF++K +++ +     +G+F LRFS+          +        +   W+  PF+  +   RSL +R+ D   L FL
Sbjct:  314 KELNATVTDIISALVTSTFIIEKQPPQVLK------TQTKFATTVRLLVGGKLNVHMNPPQVKATIINEQQAKALLKNENTRNDSSGEILNNNCVMEYHQTTGTLSAHFRNMSLKR-IKRS-DRRGAESVTEEKFTVLFESQFSVGGNELM--FHVKT--LSLPVVVIVHGSQDNNATATVLWDN-------AFSEPGRVPFAVPDKVTWPQLCEALNMKYKSEVQSDRGLSEENLVFLAQKAFSSSSNNPEDYRNMTMTWSQFNRESLPGRNFTFWQWFDGVIELMKKHLKSH-WNDGAILGFLNKQQAQDMLLSKPNGTFLLRFSDSEIGGITIAWVAENPNKAGERMVWNLMPFTTKDFSIRSLADRISDLNHLLFL 673          
BLAST of SMED30003001 vs. Ensembl Cavefish
Match: stat5a (signal transducer and activator of transcription 5B [Source:NCBI gene;Acc:103033010])

HSP 1 Score: 70.4774 bits (171), Expect = 2.022e-12
Identity = 87/379 (22.96%), Postives = 162/379 (42.74%), Query Frame = 1
Query:  151 DMSKSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVTNKN--------LXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDARERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGR--FDCSESVDVNQLISNISDYFLK--QTSRGLTPSNQVFLRAKLIK---------MSYNITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK-ESETLFTGSTSGSFFLRFSERN------PKIXXXXXXXXXXDAWS--PFSIDECRSRSLPERLMDYQELRFL 1194
            D++ ++ D I  L+  +F++   PP+++K      T T F A+   L+  K  +  + PQ    +++E   K  + N+N        + + + +              +NM  +  +K + +R+  + +T  K   LF  + +     L    ++KT   S  V+ +VH +Q+ +A  T+ WD+       +F   GR  F   + V   QL   ++  +    Q++RGL+  N VFL  K             S  +T+  F R  +P    +F  W   +++L K       W +  I GFV+K +++ +     +G+F LRFS+          +        +   W+  P++  +   RSL +R+ D   L FL
Sbjct:  315 DLNSTITDIISALVTSTFIIEKQPPQVLK------TQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKALLKNENTRNDSSGEILNNNCVMEYHQTTGTLSAHFRNMSLKR-IKRS-DRRGAESVTEEKFTILFESQFSVGGNEL--VFQVKT--LSLPVVVIVHGSQDNNATATVLWDN-------AFAEPGRVPFIVPDKVLWPQLCDALNMKYRAEVQSNRGLSEENLVFLAQKAFSSSSCNPEDYRSMTMTWSQFNRESLPGRNFTFWQWFDGVMELTKKHLKPH-WNDGAILGFVNKQQAQDMLMSKPNGTFLLRFSDSEIGGITIAWVAENPNKTGERMVWNLMPYTTKDFSIRSLADRISDLNHLLFL 673          
BLAST of SMED30003001 vs. Ensembl Cavefish
Match: stat5a (signal transducer and activator of transcription 5B [Source:NCBI gene;Acc:103033010])

HSP 1 Score: 70.0922 bits (170), Expect = 2.447e-12
Identity = 87/379 (22.96%), Postives = 162/379 (42.74%), Query Frame = 1
Query:  151 DMSKSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVTNKN--------LXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDARERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGR--FDCSESVDVNQLISNISDYFLK--QTSRGLTPSNQVFLRAKLIK---------MSYNITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK-ESETLFTGSTSGSFFLRFSERN------PKIXXXXXXXXXXDAWS--PFSIDECRSRSLPERLMDYQELRFL 1194
            D++ ++ D I  L+  +F++   PP+++K      T T F A+   L+  K  +  + PQ    +++E   K  + N+N        + + + +              +NM  +  +K + +R+  + +T  K   LF  + +     L    ++KT   S  V+ +VH +Q+ +A  T+ WD+       +F   GR  F   + V   QL   ++  +    Q++RGL+  N VFL  K             S  +T+  F R  +P    +F  W   +++L K       W +  I GFV+K +++ +     +G+F LRFS+          +        +   W+  P++  +   RSL +R+ D   L FL
Sbjct:  323 DLNSTITDIISALVTSTFIIEKQPPQVLK------TQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKALLKNENTRNDSSGEILNNNCVMEYHQTTGTLSAHFRNMSLKR-IKRS-DRRGAESVTEEKFTILFESQFSVGGNEL--VFQVKT--LSLPVVVIVHGSQDNNATATVLWDN-------AFAEPGRVPFIVPDKVLWPQLCDALNMKYRAEVQSNRGLSEENLVFLAQKAFSSSSCNPEDYRSMTMTWSQFNRESLPGRNFTFWQWFDGVMELTKKHLKPH-WNDGAILGFVNKQQAQDMLMSKPNGTFLLRFSDSEIGGITIAWVAENPNKTGERMVWNLMPYTTKDFSIRSLADRISDLNHLLFL 681          
BLAST of SMED30003001 vs. Ensembl Cavefish
Match: stat5a (signal transducer and activator of transcription 5B [Source:NCBI gene;Acc:103033010])

HSP 1 Score: 70.0922 bits (170), Expect = 2.497e-12
Identity = 87/379 (22.96%), Postives = 162/379 (42.74%), Query Frame = 1
Query:  151 DMSKSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVTNKN--------LXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDARERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGR--FDCSESVDVNQLISNISDYFLK--QTSRGLTPSNQVFLRAKLIK---------MSYNITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK-ESETLFTGSTSGSFFLRFSERN------PKIXXXXXXXXXXDAWS--PFSIDECRSRSLPERLMDYQELRFL 1194
            D++ ++ D I  L+  +F++   PP+++K      T T F A+   L+  K  +  + PQ    +++E   K  + N+N        + + + +              +NM  +  +K + +R+  + +T  K   LF  + +     L    ++KT   S  V+ +VH +Q+ +A  T+ WD+       +F   GR  F   + V   QL   ++  +    Q++RGL+  N VFL  K             S  +T+  F R  +P    +F  W   +++L K       W +  I GFV+K +++ +     +G+F LRFS+          +        +   W+  P++  +   RSL +R+ D   L FL
Sbjct:  315 DLNSTITDIISALVTSTFIIEKQPPQVLK------TQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKALLKNENTRNDSSGEILNNNCVMEYHQTTGTLSAHFRNMSLKR-IKRS-DRRGAESVTEEKFTILFESQFSVGGNEL--VFQVKT--LSLPVVVIVHGSQDNNATATVLWDN-------AFAEPGRVPFIVPDKVLWPQLCDALNMKYRAEVQSNRGLSEENLVFLAQKAFSSSSCNPEDYRSMTMTWSQFNRESLPGRNFTFWQWFDGVMELTKKHLKPH-WNDGAILGFVNKQQAQDMLMSKPNGTFLLRFSDSEIGGITIAWVAENPNKTGERMVWNLMPYTTKDFSIRSLADRISDLNHLLFL 673          
BLAST of SMED30003001 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009999.1 (pep scaffold:Pmarinus_7.0:GL477207:64842:82317:1 gene:ENSPMAG00000009008.1 transcript:ENSPMAT00000009999.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.6102 bits (135), Expect = 9.976e-9
Identity = 79/368 (21.47%), Postives = 153/368 (41.58%), Query Frame = 1
Query:  187 LIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVTNKN--------LXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDARERKKFDRITSVKSIFLFRIKITATPFALKKS-LEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGR--FDCSESVDVNQLIS--NISDYFLKQTSRGLTPSNQVFLRAKLIK---------MSYNITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK-ESETLFTGSTSGSFFLRFSERN------PKIXXXXXXXXXXDAWS--PFSIDECRSRSLPERLMDYQELRFL 1194
            L+  +F++   PP+++K      T T F A+   L+  K  +  + PQ    +++E   K  + N+N        + +   +              +NM  +  +K + +R+  + +T  K   LF+     + F++  + L  +    S  V+ +VH +Q+ +A  T+ WD+       +F   GR  F   + V   QL+   N+      ++ RGL+  N VFL  K             +  I++  F R  +     +F  W   +++L K       W +  I GF +K +++ +     +G+F LR+S+          +        +   W+  P++  +   RSL +R+ D   L+FL
Sbjct:  331 LVTSTFIIEKQPPQVLK------TQTKFAATVRLLVGGKLNVHMNPPQVVATIISEQQAKALLKNENTRNESSGDILNNCSVMEFQQATGTLTANFRNMSLKK-IKRS-DRRGAESVTEEKFTILFQ-----SHFSIGGNELVFQVRTLSLPVVVIVHGSQDNNATATVLWDN-------AFAEPGRVPFQVPDKVAWPQLVDALNMKLKASVESQRGLSEENIVFLAQKAFNSTSTHADDYCNLTISWAQFNRESLQGRNFTFWQWFDGVMELTKKHLKQH-WNDGAILGFANKQQAQDMLLSKPNGTFLLRYSDSEIGGITIAWVADNPTNRGERLVWNLMPYTAKDFSIRSLADRISDLSHLQFL 677          
BLAST of SMED30003001 vs. Ensembl Sea Lamprey
Match: stat3 (signal transducer and activator of transcription 3 (acute-phase response factor) [Source:ZFIN;Acc:ZDB-GENE-980526-68])

HSP 1 Score: 55.8398 bits (133), Expect = 1.427e-8
Identity = 49/169 (28.99%), Postives = 83/169 (49.11%), Query Frame = 1
Query:  574 KSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGRFDCSESVDVNQLISNISDYFLKQTSRGLTPSNQVFLRAKLIKMSYN-----ITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSKESE-TLFTGSTSGSFFLRFSE 1062
            +SL++  +  S  VI + + +Q  +   ++ W +    ++   KN   F    +   + L   +S  F   TSRGL P   V L  KL+ ++ N     + +  F + +MP  + SF  W+ + I  L  + ++ +W    I GFVSK++E +L     SG+F LRFSE
Sbjct:  450 QSLKMDLETTSLPVIVISNVSQLPNGWASILWYNMLTNEQ---KNLSLFLNPPAASWSLLSDVLSWQFSCVTSRGLNPQQLVTLAEKLLGLTTNYKECQVPWAKFCKENMPEKQFSFWLWL-DGIIELIKKHLLPIWNEGYIMGFVSKDTEKSLLKDQLSGTFLLRFSE 614          
BLAST of SMED30003001 vs. Ensembl Sea Lamprey
Match: stat1a (signal transducer and activator of transcription 1a [Source:ZFIN;Acc:ZDB-GENE-980526-499])

HSP 1 Score: 47.7506 bits (112), Expect = 5.287e-6
Identity = 46/169 (27.22%), Postives = 75/169 (44.38%), Query Frame = 1
Query:  574 KSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGRFDCSESVDVNQLISNISDYFLKQTSRGLTPSNQVFLRAKLIKMSYN-----ITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSKESE-TLFTGSTSGSFFLRFSE 1062
            + L+I+ +  S  V+ + + +Q      ++ W +    D    KN   F        +QL   +S  F   T RGL       L  KL+    N     I +  F + ++P+   SF  W+ + I  L  + +I +W +  I GF+SK+ E  L    + G+F LRFSE
Sbjct:  443 QGLKIELETCSLPVVVISNVSQLPSGWASVLWYNMLTNDP---KNVSFFTSPPPAMWSQLSEVLSWQFSSCTKRGLNAEQLTTLAEKLLGPRVNYCECHIPWAKFCKENLPDKPFSFWLWL-DGILELVKKHLITLWNDGCIMGFISKDRERQLLKQKSPGTFLLRFSE 607          
BLAST of SMED30003001 vs. Ensembl Nematostella
Match: EDO42973 (Signal transducer and activator of transcription [Source:UniProtKB/TrEMBL;Acc:A7S084])

HSP 1 Score: 58.151 bits (139), Expect = 4.951e-9
Identity = 64/253 (25.30%), Postives = 108/253 (42.69%), Query Frame = 1
Query:  613 VISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGR--FDCSESVDVNQLISNISDYFLKQTSRGLTPSNQVFLRAKLI------KMS-YNITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK-ESETLFTGSTSGSFFLRFSERNPKIXXXXXXXXXXDA----W--SPFSIDECRSRSLPERLMDYQELRFLKDASGKFLDKVEALSQFIDKTN-PDDG--YTPRGRLSKLLNGD 1314
             +  VH NQ  DA  T+ WD+       +F   GR  F   +S+   ++ + I+  ++    RGL+     ++ +KL       +MS   ++ +   + +M N   +F  W   I+  +K       WK+ LI GF+SK +++ +   S  G+F LRFS+       V       +     W  +P++    + R L +RL D + L  L     K  D        +DKT  P D   Y P    +K++  D
Sbjct:  489 CVVTVHGNQSPDAEATILWDN-------AFAEKGRVPFVVPDSMPWPEVANAINHRWMLSNERGLSDEQLAYIGSKLFPDKSRSEMSNCVVSRYMLNKGNMTNKNFTFWKWFYEIMSAVKKTMHEE-WKHGLIQGFLSKQQAQDMLINSEFGTFLLRFSDNELGGVSVAYTAQAENGEKQVWNLAPWTTHHLQVRHLSDRLKDLESLLILYPNEPK--DTAFGRHYTVDKTQVPSDPLEYRPTQLATKVIGAD 731          
BLAST of SMED30003001 vs. Ensembl Medaka
Match: ENSORLT00000017980.2 (signal transducer and activator of transcription 5B [Source:NCBI gene;Acc:101168657])

HSP 1 Score: 71.633 bits (174), Expect = 7.931e-13
Identity = 86/378 (22.75%), Postives = 160/378 (42.33%), Query Frame = 1
Query:  148 RDMSKSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVTNKN------LXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDARERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGR--FDCSESVDVNQLISNISDYFLKQ--TSRGLTPSNQVFLRAKLIKMSYN---------ITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK-ESETLFTGSTSGSFFLRFSERN------PKIXXXXXXXXXXDAWS--PFSIDECRSRSLPERLMDYQELRFL 1194
            R ++  + D I  L+  +F++   PP+++K      T T F A+   L+  K  +  S PQ    +++E   K  V N++      + + + +              +NM  +   +   +R+  + +T  K   LF  + +     L     +KT   S  V+ +VH +Q+ +A  T+ WD+       +F   GR  F   + V   Q+   +   +  +  T+RGLT  N VFL  K    S N         +++  F R ++P    +F  W   +++L+K       W +  I GFV+K +++ +     +G+F LRFS+          +        +   W+  P++  +   RSL +R+ D   L +L
Sbjct:  294 RKLNADITDVISALVTSTFIIEKQPPQVLK------TQTKFAATVRLLVGGKLNVHMSPPQVKAAIVSEQQAKALVKNESTNSSGEILNNNCVMEYHQATGTLSAHFRNMSLKRIKRS--DRRGAESVTEEKFTILFESQFSVGGNEL--GFHVKT--MSLPVVVIVHGSQDNNATATVLWDN-------AFAEPGRVPFVVPDKVKWPQICEALDMKYKAEMHTTRGLTEENLVFLAQKAFTSSSNNPEDYHNMTVSWAQFNRENLPGRSFTFWQWFDGVVELMKKHLKPH-WNDGAILGFVNKQQAQDMLMSKPNGTFLLRFSDSEIGGITIAWVAENPNKQGERLVWNLLPYTTKDFSIRSLADRISDLNHLVYL 651          
BLAST of SMED30003001 vs. Ensembl Medaka
Match: stat5a (signal transducer and activator of transcription 5B [Source:NCBI gene;Acc:101163082])

HSP 1 Score: 71.2478 bits (173), Expect = 1.186e-12
Identity = 88/379 (23.22%), Postives = 163/379 (43.01%), Query Frame = 1
Query:  151 DMSKSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVTNKN--------LXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDARERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGR--FDCSESVDVNQLISNISDYFLK--QTSRGLTPSNQVFLRAKLIKMSYN---------ITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK-ESETLFTGSTSGSFFLRFSERN------PKIXXXXXXXXXXDAWS--PFSIDECRSRSLPERLMDYQELRFL 1194
            +++ ++ D I  L+  +F++   PP+++K      T T F A+   L+  K  +  + PQ    +++E   K  + N+N        + + + +              +NM  +  +K + +R+  + +T  K   LF  + +     L    ++KT   S  V+ +VH +Q+ +A  T+ WD+       +F   GR  F   + V   QL   I+  +    Q++RGL+  N VFL  K    S N         +T+  F R  +P    +F  W   +++L K       W +  I GFV+K +++ +     +G+F LRFS+          +        +   W+  P++  +   RSL +R+ D   L FL
Sbjct:  315 ELNSTITDIISALVTSTFIIEKQPPQVLK------TQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKALLKNENTRNDSSGEILNNNCVMEYHQTTGTLSAHFRNMSLKR-IKRS-DRRGAESVTEEKFTILFESQFSVGSNEL--VFQVKT--LSLPVVVIVHGSQDNNATATVLWDN-------AFAEPGRVPFLVPDKVLWPQLCDAINMKYKAEVQSNRGLSEENLVFLAQKAFSSSSNNPDDYRSMTMTWSQFNRESLPGRNFTFWQWFDGVMELTKKHLKPH-WNDGAILGFVNKQQAQDMLMSKPNGTFLLRFSDSEIGGITIAWVAENPNKAGERMVWNLMPYTTKDFSIRSLADRISDLNHLLFL 673          
BLAST of SMED30003001 vs. Ensembl Medaka
Match: ENSORLT00000046559.1 (signal transducer and activator of transcription 5B [Source:NCBI gene;Acc:101168657])

HSP 1 Score: 70.8626 bits (172), Expect = 1.339e-12
Identity = 87/380 (22.89%), Postives = 162/380 (42.63%), Query Frame = 1
Query:  148 RDMSKSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETK-ELFSSKPQAHVYLLNESDFKEFVTNKN--------LXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDARERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGR--FDCSESVDVNQLISNISDYFLKQ--TSRGLTPSNQVFLRAKLIKMSYN---------ITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSK-ESETLFTGSTSGSFFLRFSERN------PKIXXXXXXXXXXDAWS--PFSIDECRSRSLPERLMDYQELRFL 1194
            R ++  + D I  L+  +F++   PP+++K      T T F A+   L+  K  +  S PQ    +++E   K  V N++        + + + +              +NM  +  +K + +R+  + +T  K   LF  + +     L     +KT   S  V+ +VH +Q+ +A  T+ WD+       +F   GR  F   + V   Q+   +   +  +  T+RGLT  N VFL  K    S N         +++  F R ++P    +F  W   +++L+K       W +  I GFV+K +++ +     +G+F LRFS+          +        +   W+  P++  +   RSL +R+ D   L +L
Sbjct:  315 RKLNADITDVISALVTSTFIIEKQPPQVLK------TQTKFAATVRLLVGGKLNVHMSPPQVKAAIVSEQQAKALVKNESTNSESSGEILNNNCVMEYHQATGTLSAHFRNMSLKR-IKRS-DRRGAESVTEEKFTILFESQFSVGGNEL--GFHVKT--MSLPVVVIVHGSQDNNATATVLWDN-------AFAEPGRVPFVVPDKVKWPQICEALDMKYKAEMHTTRGLTEENLVFLAQKAFTSSSNNPEDYHNMTVSWAQFNRENLPGRSFTFWQWFDGVVELMKKHLKPH-WNDGAILGFVNKQQAQDMLMSKPNGTFLLRFSDSEIGGITIAWVAENPNKQGERLVWNLLPYTTKDFSIRSLADRISDLNHLVYL 674          
BLAST of SMED30003001 vs. Ensembl Medaka
Match: stat6 (signal transducer and activator of transcription 5B-like [Source:NCBI gene;Acc:101162184])

HSP 1 Score: 66.6254 bits (161), Expect = 3.199e-11
Identity = 101/404 (25.00%), Postives = 160/404 (39.60%), Query Frame = 1
Query:  163 SLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETKELFSSKPQAHVYLLNESDFK-----------EFVTNKNLXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDARERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYF-RLDRYSFKNSGRFDCSESVDVNQLISNISDYFLKQ--TSRGLTPSNQVFLRAKLI-KMSYN-------ITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSKES-ETLFTGSTSGSFFLRFSERN------PKIXXXXXXXXXXDAWSPFSIDECRSRSLPERLMDYQELRFLKDASGKFLDKVEALSQFIDK--TNPDDGYTP 1281
             LE  +  LI  S V+   PP++IK      T + F+ +  CL+  K +          ++NE   K           E + N+++  +     +           +NM     +K A +RK  + +T  K   LF  +IT        S +I+  + S  V+  VH +Q+ +A  T+ WD  F R DR  F         +SV   ++   ++  F  +  T   L   NQ FL  K+  K  +N       +++  F +  +P    +F  W   + +L K       W   LI GF+ K     +     +G+F LRFS+          +      G KV    PFS  +   RSL +R+ D  E+ +L    G    K EA  +F       P DGY P
Sbjct:  284 QLETLLHSLIDSSLVVEKQPPQVIK------TQSKFSTTVRCLLGEKVMPGKPVVIKAQIVNELQAKNLGNLHSDTVAELINNQSILEKHPGNKTTCAT------FRNMSVRK-IKRA-DRKGSESVTEEKFAILFSTEITYV--GCDTSYQIQ--MISLPVVITVHGSQDSNALATILWDCAFARPDRVPFA------VPDSVSWREMCQTLNCKFTSEVNTQHNLDKFNQHFLAQKIFDKPDFNGDFSEMMVSWAQFNKEVLPGRSFTFWQWFEGVTELSKKHLRP-YWSEGLIFGFIGKHHLHMILADRPNGTFLLRFSDSEIGGITIAYVSACETGGQKVQNIQPFSKKDLEIRSLADRIRDINEILYLYPNVG----KDEAFGKFYTGPLVPPSDGYLP 658          
BLAST of SMED30003001 vs. Ensembl Medaka
Match: stat3 (signal transducer and activator of transcription 3 [Source:NCBI gene;Acc:100049477])

HSP 1 Score: 50.447 bits (119), Expect = 3.960e-6
Identity = 52/169 (30.77%), Postives = 77/169 (45.56%), Query Frame = 1
Query:  574 KSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGRFDCSESVDVNQLISNISDYFLKQTSRGLTPSNQVFLRAKLIKMSYN-----ITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSKESE-TLFTGSTSGSFFLRFSE 1062
            + L+I  +  S  V+ + +  Q  +A  ++ W  Y  L  +  KN   F        +Q+   +S  F   T RGLT      L  KL+  S N     IT+  F + +M     SF  W+ NII L+K   +  +W    I GF+SKE E  + +    G+F LRFSE
Sbjct:  449 QGLKIDLETHSLPVVVISNICQMPNAWASILW--YNMLTNHP-KNVNFFTKPPVGTWDQVAEVLSWQFSSTTKRGLTIEQLTTLAEKLLGPSVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILA-LWNEGYIMGFISKERERAILSPKPPGTFLLRFSE 613          
BLAST of SMED30003001 vs. Planmine SMEST
Match: SMESG000014122.1 (SMESG000014122.1)

HSP 1 Score: 865.529 bits (2235), Expect = 0.000e+0
Identity = 467/469 (99.57%), Postives = 467/469 (99.57%), Query Frame = 1
Query:   13 AIQNYNLYSDQRMATYRSLTEFTTELYSTLCEIVIEIHNNPRNDERDMSKSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETKELFSSKPQAHVYLLNESDFKEFVTNKNLXXXXXXXXXXXXXXXXXWEIKNMIYEPPVKDARERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLFWDDYFRLDRYSFKNSGRFDCSESVDVNQLISNISDYFLKQTSRGLTPSNQVFLRAKLIKMSYNITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSKESETLFTGSTSGSFFLRFSERNPKIXXXXXXXXXXDAWSPFSIDECRSRSLPERLMDYQELRFLKDASGKFLDKVEALSQFIDKTNPDDGYTPRGRLSKLLNGDIYGDEYESFMTEDVEFDEIYNDDHINLNLFLESGN 1419
            AIQNYNLYSDQRMATYRSLTEFTTELYSTLCEIVIEIHNNPRND RDMSKSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETKELFSSKPQAHVYLLNESDFKEFVTNKNLNSESKIKISDIKKNGNIWEIKNMIYEPPVKDARERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTL WDDYFRLDRYSFKNSGRFDCSESVDVNQLISNISDYFLKQTSRGLTPSNQVFLRAKLIKMSYNITFHSFTRVHMPNSELSFGHWISNIIKLLKLEGIIGMWKNNLIDGFVSKESETLFTGSTSGSFFLRFSERNPKIGVVVKVGSKVDAWSPFSIDECRSRSLPERLMDYQELRFLKDASGKFLDKVEALSQFIDKTNPDDGYTPRGRLSKLLNGDIYGDEYESFMTEDVEFDEIYNDDHINLNLFLESGN
Sbjct:  132 AIQNYNLYSDQRMATYRSLTEFTTELYSTLCEIVIEIHNNPRNDVRDMSKSLEDSIVKLIGLSFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETKELFSSKPQAHVYLLNESDFKEFVTNKNLNSESKIKISDIKKNGNIWEIKNMIYEPPVKDARERKKFDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVDANLTLLWDDYFRLDRYSFKNSGRFDCSESVDVNQLISNISDYFLKQTSRGLTPSNQVFLRAKLIKMSYNITFHSFTRVHMPNSELSFGHWISNIIKLLKLEGIIGMWKNNLIDGFVSKESETLFTGSTSGSFFLRFSERNPKIGVVVKVGSKVDAWSPFSIDECRSRSLPERLMDYQELRFLKDASGKFLDKVEALSQFIDKTNPDDGYTPRGRLSKLLNGDIYGDEYESFMTEDVEFDEIYNDDHINLNLFLESGN 600          
BLAST of SMED30003001 vs. Planmine SMEST
Match: SMESG000014147.1 (SMESG000014147.1)

HSP 1 Score: 78.5666 bits (192), Expect = 2.145e-16
Identity = 55/147 (37.41%), Postives = 86/147 (58.50%), Query Frame = 1
Query:  847 SYNITFHSFTRVHMPNSELSFGHWISNXXXXXXXXXXXXMWKNNLIDGFVSKESETLFTGSTSGSFFLRFSERNPKIXXXXXXXXXXDAWSPFSIDECRSRSLPERLMDYQELRFLKDASGKFLDKVEALSQFIDKTNPDDGYTPRG 1287
            S  IT   F +  MPN + SFG WI +I+K+LK+  +  +W +NLI+GF++K+   +      GSF LRFSER   IG+V+K   K + W+P++    R  +L   L D+ +L  L+ ++G+      AL Q++ +   D+GYT RG
Sbjct:    5 SSCITKDQFMKSPMPNLKSSFGQWIMSIVKMLKIPTLEKLWIDNLIEGFIAKDVNNILL--KPGSFLLRFSERQAAIGIVLKTEDKTEPWAPYTEAHLRLNNLANLLSDFSQLTHLRLSNGRLYSLDAALQQYMAQIPIDEGYTKRG 149          
The following BLAST results are available for this feature:
BLAST of SMED30003001 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
STAT5A1.885e-1224.27signal transducer and activator of transcription 5... [more]
STAT5A1.885e-1224.27signal transducer and activator of transcription 5... [more]
STAT5A1.946e-1224.27signal transducer and activator of transcription 5... [more]
STAT5B5.582e-1223.85signal transducer and activator of transcription 5... [more]
STAT61.805e-1122.36signal transducer and activator of transcription 6... [more]
back to top
BLAST of SMED30003001 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003001 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Stat92E1.158e-924.37gene:FBgn0016917 transcript:FBtr0089484[more]
Stat92E1.437e-925.23gene:FBgn0016917 transcript:FBtr0334581[more]
Stat92E1.437e-925.23gene:FBgn0016917 transcript:FBtr0100457[more]
Stat92E1.649e-925.23gene:FBgn0016917 transcript:FBtr0089485[more]
Stat92E1.649e-925.23gene:FBgn0016917 transcript:FBtr0089487[more]
back to top
BLAST of SMED30003001 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stat5a1.926e-1223.10signal transducer and activator of transcription 5... [more]
stat5a1.926e-1223.10signal transducer and activator of transcription 5... [more]
stat5b1.795e-1123.47signal transducer and activator of transcription 5... [more]
stat5b3.695e-1124.26signal transducer and activator of transcription 5... [more]
stat5b3.695e-1124.26signal transducer and activator of transcription 5... [more]
back to top
BLAST of SMED30003001 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map21.374e-1122.74microtubule associated protein 2 [Source:Xenbase;A... [more]
map21.530e-1122.74microtubule associated protein 2 [Source:Xenbase;A... [more]
map21.790e-1122.97microtubule associated protein 2 [Source:Xenbase;A... [more]
map21.790e-1122.97microtubule associated protein 2 [Source:Xenbase;A... [more]
map22.336e-1122.97microtubule associated protein 2 [Source:Xenbase;A... [more]
back to top
BLAST of SMED30003001 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Stat5a9.820e-1424.53signal transducer and activator of transcription 5... [more]
Stat5a9.820e-1424.53signal transducer and activator of transcription 5... [more]
Stat5a2.000e-1324.53signal transducer and activator of transcription 5... [more]
Stat5b5.145e-1324.46signal transducer and activator of transcription 5... [more]
Stat5b5.145e-1324.46signal transducer and activator of transcription 5... [more]
back to top
BLAST of SMED30003001 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P42230|STA5A_MOUSE6.869e-1324.53Signal transducer and activator of transcription 5... [more]
sp|P42231|STA5A_SHEEP2.551e-1224.80Signal transducer and activator of transcription 5... [more]
sp|Q95115|STA5A_BOVIN3.404e-1224.80Signal transducer and activator of transcription 5... [more]
sp|P42232|STA5B_MOUSE3.599e-1224.46Signal transducer and activator of transcription 5... [more]
sp|Q62771|STA5A_RAT4.344e-1224.27Signal transducer and activator of transcription 5... [more]
back to top
BLAST of SMED30003001 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7V9592.774e-1225.75Signal transducer and activator of transcription O... [more]
A0A151LYL89.227e-1223.99Signal transducer and activator of transcription 6... [more]
A0A091LAB11.628e-1125.07Signal transducer and transcription activator 6 (F... [more]
A0A091Q6434.293e-1125.07Signal transducer and transcription activator 6 (F... [more]
A0A091F2064.816e-1123.47Signal transducer and transcription activator 6 (F... [more]
back to top
BLAST of SMED30003001 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stat5b5.948e-1324.14signal transducer and activator of transcription 5... [more]
stat5b1.721e-1223.16signal transducer and activator of transcription 5... [more]
stat5a2.022e-1222.96signal transducer and activator of transcription 5... [more]
stat5a2.447e-1222.96signal transducer and activator of transcription 5... [more]
stat5a2.497e-1222.96signal transducer and activator of transcription 5... [more]
back to top
BLAST of SMED30003001 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000009999.19.976e-921.47pep scaffold:Pmarinus_7.0:GL477207:64842:82317:1 g... [more]
stat31.427e-828.99signal transducer and activator of transcription 3... [more]
stat1a5.287e-627.22signal transducer and activator of transcription 1... [more]
back to top
BLAST of SMED30003001 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30003001 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO429734.951e-925.30Signal transducer and activator of transcription ... [more]
back to top
BLAST of SMED30003001 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000017980.27.931e-1322.75signal transducer and activator of transcription 5... [more]
stat5a1.186e-1223.22signal transducer and activator of transcription 5... [more]
ENSORLT00000046559.11.339e-1222.89signal transducer and activator of transcription 5... [more]
stat63.199e-1125.00signal transducer and activator of transcription 5... [more]
stat33.960e-630.77signal transducer and activator of transcription 3... [more]
back to top
BLAST of SMED30003001 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000014122.10.000e+099.57SMESG000014122.1[more]
SMESG000014147.12.145e-1637.41SMESG000014147.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30003001 ID=SMED30003001|Name=SMED30003001|organism=Schmidtea mediterranea sexual|type=transcript|length=1495bp
CTTCCGATCTAAGCAATTCAAAATTATAATTTGTACTCGGATCAACGTAT
GGCTACATATCGATCTTTAACAGAATTTACAACTGAATTATATTCAACTT
TATGTGAAATAGTAATAGAAATTCATAATAATCCAAGAAATGATGAAAGA
GACATGAGTAAAAGTTTGGAAGATAGCATAGTGAAACTAATTGGTTTGAG
TTTCGTATTGTCGATTCCTCCACCAAGGATAATTAAAAAAAAAACTAACA
ACCAAACCGGTACTCATTTCAATGCTTCTTTCAGCTGCTTAATTGAAACT
AAAGAACTATTTTCGTCAAAACCACAAGCTCATGTTTACTTATTAAATGA
AAGCGATTTCAAAGAATTTGTTACCAATAAAAATTTAAATTCTGAAAGTA
AAATCAAAATCAGTGATATTAAAAAAAATGGCAATATTTGGGAAATTAAA
AATATGATATATGAACCACCAGTAAAAGACGCAAGAGAACGTAAGAAATT
TGACAGGATAACAAGCGTAAAATCCATTTTTCTTTTCCGGATAAAGATTA
CTGCCACCCCTTTCGCATTGAAAAAATCCCTTGAAATCAAAACCGATCTC
TTTTCAGATACGGTTATCAGTGTCGTCCACACAAATCAAGAAGTCGACGC
AAATTTGACTTTGTTTTGGGATGATTATTTTCGACTCGATAGGTATTCAT
TTAAAAACAGCGGTAGATTCGACTGTTCGGAATCCGTTGACGTAAACCAA
CTTATATCAAATATATCTGATTACTTTCTCAAACAAACATCTCGTGGATT
GACCCCTTCAAATCAGGTTTTTCTTAGAGCTAAGCTTATTAAAATGTCAT
ACAATATCACATTCCACAGTTTCACCAGGGTTCACATGCCTAATTCTGAG
TTATCATTCGGACATTGGATATCCAACATTATCAAACTGCTGAAACTCGA
AGGCATCATCGGCATGTGGAAAAATAATCTAATTGACGGTTTTGTCTCTA
AGGAATCAGAAACGCTTTTTACTGGTTCTACAAGCGGATCGTTTTTTCTC
AGATTCTCTGAGAGAAATCCAAAAATCGGAGTAGTGGTTAAAGTTGGATC
CAAAGTCGATGCCTGGTCACCGTTTAGTATTGATGAATGTCGTTCTAGAA
GCCTCCCAGAAAGATTGATGGATTACCAAGAACTTCGGTTTTTAAAGGAT
GCTTCGGGGAAATTTTTGGATAAAGTCGAAGCGTTATCTCAGTTTATTGA
TAAAACGAATCCAGACGACGGATATACGCCGCGGGGACGTTTGTCGAAAC
TGTTGAATGGAGATATTTACGGAGACGAGTACGAGAGTTTTATGACGGAA
GATGTCGAATTTGACGAGATATATAATGATGATCATATAAATTTGAATTT
ATTTCTTGAAAGTGGAAATTAAAATTTGCACTATTATTTATCGATGTGTT
ATTTTATTTTGTTCAAATATAGTAAATATTGTTATTTAAAAAAAA
back to top

protein sequence of SMED30003001-orf-1

>SMED30003001-orf-1 ID=SMED30003001-orf-1|Name=SMED30003001-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=458bp
MATYRSLTEFTTELYSTLCEIVIEIHNNPRNDERDMSKSLEDSIVKLIGL
SFVLSIPPPRIIKKKTNNQTGTHFNASFSCLIETKELFSSKPQAHVYLLN
ESDFKEFVTNKNLNSESKIKISDIKKNGNIWEIKNMIYEPPVKDARERKK
FDRITSVKSIFLFRIKITATPFALKKSLEIKTDLFSDTVISVVHTNQEVD
ANLTLFWDDYFRLDRYSFKNSGRFDCSESVDVNQLISNISDYFLKQTSRG
LTPSNQVFLRAKLIKMSYNITFHSFTRVHMPNSELSFGHWISNIIKLLKL
EGIIGMWKNNLIDGFVSKESETLFTGSTSGSFFLRFSERNPKIGVVVKVG
SKVDAWSPFSIDECRSRSLPERLMDYQELRFLKDASGKFLDKVEALSQFI
DKTNPDDGYTPRGRLSKLLNGDIYGDEYESFMTEDVEFDEIYNDDHINLN
LFLESGN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR036860SH2_dom_sf
IPR001217STAT
IPR000980SH2
IPR013801STAT_TF_DNA-bd
IPR011992EF-hand-dom_pair
IPR008967p53-like_TF_DNA-bd
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0004871signal transducer activity
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0007165signal transduction
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036860SH2 domain superfamilyGENE3DG3DSA:3.30.505.10coord: 326..400
e-value: 3.4E-7
score: 32.2
IPR036860SH2 domain superfamilySUPERFAMILYSSF55550SH2 domaincoord: 315..394
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 207..325
e-value: 1.5E-13
score: 53.1
NoneNo IPR availableCDDcd14801STAT_DBDcoord: 64..223
e-value: 1.21601E-11
score: 60.7928
IPR001217Transcription factor STATPANTHERPTHR11801SIGNAL TRANSDUCER AND ACTIVATOR OF TRANSCRIPTIONcoord: 49..410
IPR008967p53-like transcription factor, DNA-bindingSUPERFAMILYSSF49417p53-like transcription factorscoord: 60..311