GTP-binding protein 10 homolog

Overview
NameGTP-binding protein 10 homolog
Smed IDSMED30002997
Length (bp)1115
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GTP-binding protein 10 homolog (SMED30002997) t-SNE clustered cells

Violin plots show distribution of expression levels for GTP-binding protein 10 homolog (SMED30002997) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GTP-binding protein 10 homolog (SMED30002997) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GTP-binding protein 10 homolog (SMED30002997) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002997

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30002997SMESG000039624.1 SmedASXL_005786SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GTP-binding protein 10 homolog vs. Ensembl Human
Match: GTPBP10 (GTP binding protein 10 [Source:HGNC Symbol;Acc:HGNC:25106])

HSP 1 Score: 230.335 bits (586), Expect = 9.036e-72
Identity = 151/367 (41.14%), Postives = 230/367 (62.67%), Query Frame = 1
Query:   10 SKIIFQK--EFFDKIKLHLISXXXXXXXXXXXXXXXXXXSIFLMGDKKYKLANILKSYPGYSVKAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSGEMIGTVNNQQ-TMIVCRGGEGGGPSNNFMAKPCENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSALETILLLNQELEIFXXXXXXXXXXXXXXXTDKPEGDEIAKFIIDNINDGK-LADWKNDEVCPKSLIKFDKIIPISAKTGSGIDEVRSAIRESLDNAALKESESECDAD-LDQYFTETM 1095
            S ++F+K   F DK++L    G+GG G P+ GG+GG GG ++++   +  L  +   YP     A  G  S  + + GS G++  I VP G+ V+ ++G++IG +N +   ++V +GG GG    NF+    +   I + LKLIAD+GLVGFPNAGKSS L+ +S     +A+Y FTT+ P++  I Y D++ I++ADLPG+IEGAH+N G+GH FLKH+ERT+ LLFVVDI GF+L S    T YR+A ETI+LL +ELE++   L  KPAL  +NK D P+  +    ++  + + K         + P+  ++F  IIPISA TG GI+E+++ IR+SLD  A +E+++      L+ + ++TM
Sbjct:    5 SCVLFRKYGNFIDKLRLFTRGGSGGMGYPRLGGEGGKGGDVWVVAQNRMTLKQLKDRYPRKRFVAGVGANSKISALKGSKGKDCEIPVPVGISVTDENGKIIGELNKENDRILVAQGGLGGKLLTNFLPLKGQKRIIHLDLKLIADVGLVGFPNAGKSSLLSCVSHAKPAIADYAFTTLKPELGKIMYSDFKQISVADLPGLIEGAHMNKGMGHKFLKHIERTRQLLFVVDISGFQLSS---HTQYRTAFETIILLTKELELYKEELQTKPALLAVNKMDLPDAQDKFHELMSQLQNPKDFLHLFEKNMIPERTVEFQHIIPISAVTGEGIEELKNCIRKSLDEQANQENDALHKKQLLNLWISDTM 368          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Human
Match: GTPBP10 (GTP binding protein 10 [Source:HGNC Symbol;Acc:HGNC:25106])

HSP 1 Score: 174.096 bits (440), Expect = 5.629e-51
Identity = 97/212 (45.75%), Postives = 140/212 (66.04%), Query Frame = 1
Query:  424 KLIADIGLVG-FPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSALETILLLNQELEIFXXXXXXXXXXXXXXXTDKPEG-DEIAKFIIDNINDGKLADWKNDEVCPKSLIKFDKIIPISAKTGSGIDEVRSAIRESLDNAALKESES 1053
            + +A +G    FPNAGKSS L+ +S     +A+Y FTT+ P++  I Y D++ I++ADLPG+IEGAH+N G+GH FLKH+ERT+ LLFVVDI GF+L S    T YR+A ETI+LL +ELE++   L  KPAL  +NK D P+  D+  + +    N           + P+  ++F  IIPISA TG GI+E+++ IR+SLD  A +E+++
Sbjct:   66 RFVAGVGANSKFPNAGKSSLLSCVSHAKPAIADYAFTTLKPELGKIMYSDFKQISVADLPGLIEGAHMNKGMGHKFLKHIERTRQLLFVVDISGFQLSS---HTQYRTAFETIILLTKELELYKEELQTKPALLAVNKMDLPDAQDKFHELMSQLQNPKDFLHLFEKNMIPERTVEFQHIIPISAVTGEGIEELKNCIRKSLDEQANQENDA 274          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Human
Match: GTPBP10 (GTP binding protein 10 [Source:HGNC Symbol;Acc:HGNC:25106])

HSP 1 Score: 134.42 bits (337), Expect = 5.068e-37
Identity = 70/174 (40.23%), Postives = 109/174 (62.64%), Query Frame = 1
Query:  124 IFLMGDKKYKLANILKSYPGYSVKAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSGEMIGTVNNQQ-TMIVCRGGEGGGPSNNFMAKPCENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGH 642
            ++++   +  L  +   YP     A  G  S  + + GS G++  I VP G+ V+ ++G++IG +N +   ++V +GG GG    NF+    +   I + LKLIAD+GLVGFPNAGKSS L+ +S     +A+Y FTT+ P++  I Y D++ I++ADLPG+IEGAH+N G+GH
Sbjct:   36 VWVVAQNRMTLKQLKDRYPRKRFVAGVGANSKISALKGSKGKDCEIPVPVGISVTDENGKIIGELNKENDRILVAQGGLGGKLLTNFLPLKGQKRIIHLDLKLIADVGLVGFPNAGKSSLLSCVSHAKPAIADYAFTTLKPELGKIMYSDFKQISVADLPGLIEGAHMNKGMGH 209          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Human
Match: GTPBP10 (GTP binding protein 10 [Source:HGNC Symbol;Acc:HGNC:25106])

HSP 1 Score: 135.191 bits (339), Expect = 5.916e-37
Identity = 70/174 (40.23%), Postives = 109/174 (62.64%), Query Frame = 1
Query:  124 IFLMGDKKYKLANILKSYPGYSVKAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSGEMIGTVNNQQ-TMIVCRGGEGGGPSNNFMAKPCENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGH 642
            ++++   +  L  +   YP     A  G  S  + + GS G++  I VP G+ V+ ++G++IG +N +   ++V +GG GG    NF+    +   I + LKLIAD+GLVGFPNAGKSS L+ +S     +A+Y FTT+ P++  I Y D++ I++ADLPG+IEGAH+N G+GH
Sbjct:   62 VWVVAQNRMTLKQLKDRYPRKRFVAGVGANSKISALKGSKGKDCEIPVPVGISVTDENGKIIGELNKENDRILVAQGGLGGKLLTNFLPLKGQKRIIHLDLKLIADVGLVGFPNAGKSSLLSCVSHAKPAIADYAFTTLKPELGKIMYSDFKQISVADLPGLIEGAHMNKGMGH 235          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Human
Match: MTG2 (mitochondrial ribosome associated GTPase 2 [Source:HGNC Symbol;Acc:HGNC:16239])

HSP 1 Score: 128.257 bits (321), Expect = 8.391e-33
Identity = 76/215 (35.35%), Postives = 108/215 (50.23%), Query Frame = 1
Query:  124 IFLMGDKKYK-LANILKSYPGYSVKAPDGKESTKTQILGSNGENIYIKVPAG----------VDVSLKSGEMIGT-------------VNNQQTMIVCRGGEGGGPSNNFMAKPCENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDI 696
            + L  D++ K L+++L  Y G+S     G++       G +G  +YI+VP G           D+S    E I                NN +  + C  G+           P +   + + LK +A  G+VGFPNAGKSS L  IS     VA+YPFTT+ P V  + Y  +  I +AD+PGII GAH N G+G  FL+H+ER + LLFVVD+
Sbjct:  114 VILRVDQQVKSLSSVLSRYQGFS-----GEDGGSKNCFGRSGAVLYIRVPVGTLVKEGGRVVADLSCVGDEYIAALGGAGGKGNRFFLANNNRAPVTCTPGQ-----------PGQQRVLHLELKTVAHAGMVGFPNAGKSSLLRAISNARPAVASYPFTTLKPHVGIVHYEGHLQIAVADIPGIIRGAHQNRGLGSAFLRHIERCRFLLFVVDL 312          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Celegans
Match: C26E6.12 (pep chromosome:WBcel235:III:4930602:4932253:-1 gene:WBGene00016145.1 transcript:C26E6.12.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C26E6.12)

HSP 1 Score: 156.377 bits (394), Expect = 6.743e-44
Identity = 106/305 (34.75%), Postives = 181/305 (59.34%), Query Frame = 1
Query:  139 DKKYKLANILKSYPGYSVKAPDGKESTKTQILGSNGENIYIKVPAGVDV-SLKSGEMIGTVNNQ-QTMIVCRGGEGGGPSNNFMAKPCENVSISIILKLIADIGLVGFPNAGKSSFLNG-ISGMSVKVANYPFTTITPQVA--------TIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSALETILLLNQELEIFXXXXXXXXXXXXXXXTDKPEGDEIAKF--IIDNINDGKLADWKNDEVCPKSLIKFDKIIPISAKTGSGIDEVRSAIR 1014
            D K +L N +K      +++ +G+ +TK  ++G + ++ +  VP G++V   +  ++I   +      ++ RGGEGG     +     +   + I LKL  +IGL+GFPNAGKS+ L   +   SVK+A+Y FTT+ PQVA        +++ P +  ++IADLPGIIEGA +N G G+ FLKH+E   +++ VVD  GF+L++ +L   +R+ LE+I LLN+E+E++N  L  KP +C+LNK D  + +E      +  ++   K  D   +E+ PK  ++F+ ++ +SA++G  IDE  + ++
Sbjct:   68 DIKKRLKNKMK------IRSENGEAATKIMLIGQHAKHQFFDVPVGIEVVDREKNKLIARCSKPFHRYLIARGGEGGYSKIGYKGSKGDTFDVEIHLKLRPNIGLLGFPNAGKSTLLKALVPEKSVKIADYAFTTVNPQVAFFKNKEEFSVEDPSF-TLSIADLPGIIEGASMNRGKGYKFLKHLEYADIVVMVVDCQGFQLKN-ELDCPFRNPLESIALLNREVELYNQKLARKPVICVLNKIDALDENEKTNISSLAKSLQSQKWIDMVPEEMRPKIPMRFEHVVQLSARSGK-IDEFTNVLK 363          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Celegans
Match: M01E5.2 (pep chromosome:WBcel235:I:13277300:13280175:-1 gene:WBGene00010805.1 transcript:M01E5.2.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:M01E5.2)

HSP 1 Score: 119.398 bits (298), Expect = 2.443e-30
Identity = 90/293 (30.72%), Postives = 142/293 (48.46%), Query Frame = 1
Query:  190 VKAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSGEMIGTVNNQQTMIVCRGGEGGGPSNNF-----MAKPC--------ENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSALETILLLNQELEIFXXXXXXXXXXXXXXXTDKPEGDEIAKFIIDNIN-DGKLADWKNDEVCPKSLIKFDKIIPISAKTGSGIDEVRSAIRESLD 1026
            V+A +G+        G + ++  ++VP G  V    G  I  +NN+  M +   G  GG  N F     + KP         E +   + ++++A  GLVGFPNAGKSS L  IS    KVA+YPFTT+ P +  + Y D+  I +AD+PG+IE +H+N G+G  FLKH+ER + L +V+D       +  L+  Y+       +L  ELE +                 K  GD  +  +I+ I+  GK  + +   +   SL     + P+SA+   G++ +   +RE  D
Sbjct:   96 VRAQNGEFGRSKSCHGKSADHKEVEVPLGT-VFKADGNTIFELNNENDMFIAARGGVGGRGNQFYVSNEVRKPFKAEYGGEGEELIYDVEMRVMATAGLVGFPNAGKSSLLRAISRAKPKVASYPFTTLHPHIGVVFYEDFEQIAVADIPGLIEDSHLNKGLGISFLKHIERCESLWYVLD-----YSTGSLTDQYK-------MLRVELEGY----------------QKGLGDRASTIVINKIDLSGKSPEEEAHHL--SSLFPNLPVFPVSAQQRIGLEPLLEHLREQYD 357          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Celegans
Match: M01E5.2 (pep chromosome:WBcel235:I:13277061:13280175:-1 gene:WBGene00010805.1 transcript:M01E5.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:M01E5.2)

HSP 1 Score: 119.398 bits (298), Expect = 2.443e-30
Identity = 90/293 (30.72%), Postives = 142/293 (48.46%), Query Frame = 1
Query:  190 VKAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSGEMIGTVNNQQTMIVCRGGEGGGPSNNF-----MAKPC--------ENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSALETILLLNQELEIFXXXXXXXXXXXXXXXTDKPEGDEIAKFIIDNIN-DGKLADWKNDEVCPKSLIKFDKIIPISAKTGSGIDEVRSAIRESLD 1026
            V+A +G+        G + ++  ++VP G  V    G  I  +NN+  M +   G  GG  N F     + KP         E +   + ++++A  GLVGFPNAGKSS L  IS    KVA+YPFTT+ P +  + Y D+  I +AD+PG+IE +H+N G+G  FLKH+ER + L +V+D       +  L+  Y+       +L  ELE +                 K  GD  +  +I+ I+  GK  + +   +   SL     + P+SA+   G++ +   +RE  D
Sbjct:   96 VRAQNGEFGRSKSCHGKSADHKEVEVPLGT-VFKADGNTIFELNNENDMFIAARGGVGGRGNQFYVSNEVRKPFKAEYGGEGEELIYDVEMRVMATAGLVGFPNAGKSSLLRAISRAKPKVASYPFTTLHPHIGVVFYEDFEQIAVADIPGLIEDSHLNKGLGISFLKHIERCESLWYVLD-----YSTGSLTDQYK-------MLRVELEGY----------------QKGLGDRASTIVINKIDLSGKSPEEEAHHL--SSLFPNLPVFPVSAQQRIGLEPLLEHLREQYD 357          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Celegans
Match: T28D6.6 (pep chromosome:WBcel235:III:11326654:11343108:-1 gene:WBGene00012126.1 transcript:T28D6.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T28D6.6)

HSP 1 Score: 69.707 bits (169), Expect = 6.109e-13
Identity = 42/98 (42.86%), Postives = 56/98 (57.14%), Query Frame = 1
Query:  433 ADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKL 726
            A IG VGFP+ GKS+ L  ++G+  +VA Y FTT+T     I+Y   + I + DLPGIIEGA    G G   +       L+L V+D+    LQ KKL
Sbjct:   63 ARIGFVGFPSVGKSTLLCNLAGVFSEVAAYEFTTLTTVPGVIRYKGAK-IQLLDLPGIIEGAKDGKGRGKQVIAVARTCSLILMVLDVMK-PLQHKKL 158          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Celegans
Match: C02F5.3 (Uncharacterized GTP-binding protein C02F5.3 [Source:UniProtKB/Swiss-Prot;Acc:P34280])

HSP 1 Score: 58.151 bits (139), Expect = 3.203e-9
Identity = 32/87 (36.78%), Postives = 48/87 (55.17%), Query Frame = 1
Query:  433 ADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVD 693
            A + +VGFP+ GKS+ L+ ++    + A Y FTT+T     I Y +   I + DLPGIIEGA    G G   +   +   L+L ++D
Sbjct:   63 ARVAMVGFPSVGKSTLLSSMTSTHSEAAGYEFTTLTCIPGVISY-NGANIQLLDLPGIIEGASQGKGRGRQVISVAKTADLILMMLD 148          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Fly
Match: CG10628 (gene:FBgn0032818 transcript:FBtr0081323)

HSP 1 Score: 228.024 bits (580), Expect = 2.822e-71
Identity = 139/322 (43.17%), Postives = 205/322 (63.66%), Query Frame = 1
Query:  124 IFLMGDKKYKLANILKSYPGYSVKAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSGEMIGTVNNQQ-TMIVCRGGEGGGPSNNFMAKPCENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSALETILLLNQELEIFXXXXXXXXXXXXXXXTDKPEGDEI---AKFIIDNINDGKLADWKNDEVCPKSLIKFDKIIPISAKTGSGIDEVRSAIRESLDNAALKESESECDADLDQ 1077
            ++L+  +   L  +++      V A  G++S+K  I G  G +  I+VP GV V     ++I  ++  + T IV  GG GG  + NF+ +P EN ++++ LKLIAD+GLVGFPNAGKS+ L  +S    K+A YPFTTI PQ+ TI+Y D R+IT+ADLPG+IEGAH N G+GH FLKH+ERT+LL+F+VDI+GF+L  K     +R  L  +  LN+ELE+++P LL KP++ LLNK DK    EI    K ++ ++  G   +   +E+ PK ++ FD I+PISA   S I +V+S +R +L    ++ +E +  AD DQ
Sbjct:   54 VYLVAKEGLTLRKVVQGLKDKRVAASSGEDSSKASIFGRRGADQRIEVPVGVQVYDDQQKLIADLDEHEATCIVAGGGTGGCTATNFLGRPGENRTVNLDLKLIADVGLVGFPNAGKSTLLKAVSNAKPKIAAYPFTTIRPQIGTIEYRDLRSITVADLPGLIEGAHANFGMGHKFLKHIERTRLLVFMVDIFGFQLSPKH---PHRDCLANVYALNKELELYDPSLLEKPSVLLLNKMDKEGAHEIFTKVKPLVSDLASG--LEQCPEELRPKQVLNFDSIVPISAMNSSKITQVKSQLRRTL----VRLAEKQFLADEDQ 366          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Fly
Match: CG13390 (gene:FBgn0032031 transcript:FBtr0079723)

HSP 1 Score: 128.257 bits (321), Expect = 2.413e-33
Identity = 71/184 (38.59%), Postives = 104/184 (56.52%), Query Frame = 1
Query:  181 GYSVKAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSGEMIGTVNNQQTMIVCRGGEGGGPSNNFMAKP-------------CENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVD 693
            G  +KA +G+  +     G N ++  IKVP G  +    G+++G +     M V   G  GG  N F                  E++S ++ L+ +AD+GL+G+PNAGKS+ LN ++    KVA Y FTT+ P + T++Y D+  +TIADLPG++  AH N G+G  FLKH ER  LLLFV+D
Sbjct:  109 GSVLKAEEGEPGSSKDCHGKNAKHSVIKVPIGTVIRNAQGQIVGDLGQADLMFVAARGGAGGKGNRFFTTDKETSPKVSEYGPRGEDLSYTLELRSMADVGLIGYPNAGKSTLLNALTRAKPKVAPYAFTTLRPHLGTVQYDDHVQLTIADLPGLVPDAHRNKGLGIQFLKHAERCTLLLFVLD 292          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Fly
Match: 128up (gene:FBgn0010339 transcript:FBtr0087976)

HSP 1 Score: 66.6254 bits (161), Expect = 7.401e-12
Identity = 39/86 (45.35%), Postives = 53/86 (61.63%), Query Frame = 1
Query:  433 ADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVV 690
            A +G VGFP+ GKS+ L+ ++G+  +VA Y FTT+T     IKY   + I + DLPGIIEGA    G G   +  V RT  L+F+V
Sbjct:   65 ARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLTTVPGCIKYKGAK-IQLLDLPGIIEGAKDGKGRGRQVIA-VARTCNLIFMV 148          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Fly
Match: CG6195 (gene:FBgn0038723 transcript:FBtr0083803)

HSP 1 Score: 61.2326 bits (147), Expect = 4.144e-10
Identity = 33/87 (37.93%), Postives = 48/87 (55.17%), Query Frame = 1
Query:  433 ADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVD 693
            A + L+GFP+ GKS+ L+ ++    + ANY FTT+T     I+Y     I + DLPGIIEGA    G G   +       L+L ++D
Sbjct:   62 ARVALIGFPSVGKSTMLSTLTKTESEAANYEFTTLTCIPGVIEYQGAN-IQLLDLPGIIEGAAQGKGRGRQVIAVARTADLVLMMLD 147          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Fly
Match: CG1354 (gene:FBgn0030151 transcript:FBtr0089385)

HSP 1 Score: 60.077 bits (144), Expect = 1.042e-9
Identity = 29/90 (32.22%), Postives = 46/90 (51.11%), Query Frame = 1
Query:  439 IGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYR----------------AITIADLPGIIEGAHVNVGVGHHFLKHV 660
            IG+VG PN GKS+F N ++  +    N+PF TI P  + +  PD R                 + + D+ G+++GA    G+G+ FL H+
Sbjct:   24 IGIVGVPNVGKSTFFNVLTQSAAPAENFPFCTIKPNESRVPVPDERFDYLVEYHKPASVVPAYLNVVDIAGLVKGAAEGQGLGNDFLSHI 113          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Zebrafish
Match: gtpbp10 (GTP-binding protein 10 (putative) [Source:NCBI gene;Acc:436727])

HSP 1 Score: 238.424 bits (607), Expect = 3.876e-75
Identity = 152/353 (43.06%), Postives = 229/353 (64.87%), Query Frame = 1
Query:   10 SKIIFQK--EFFDKIKLHLISXXXXXXXXXXXXXXXXXXSIFLMGDKKYKLANILKSYPGYSVKAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSGEMIGTVNNQ-QTMIVCRGGEGGGPSNNFMAKPCENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSALETILLLNQELEIFXXXXXXXXXXXXXXXTDKPEGDEIAKFIIDNI-NDGKLADWKNDEVCPKSLIKFDKIIPISAKTGSGIDEVRSAIRESLDNAALKESESE 1056
            S+I F+K   F D ++L++  G GG G P+ GG GG+GG ++++  K  +L  I   +P     A  G  S+   + G+ GE++ +  P G+ V+   G M+G +N +   ++V +GG GG P + F+    +  +I + LKLIAD GLVGFPNAGKSS L  +S    K+ANYPFTTI P++  + Y D++ +++ADLPG+IEGAHVN G+GH FLKHVERTK L+FVVD+ GF+L SK   T +RSA ET+LLL++ELE++   LL+KPA+ ++NK D PE     + +   + N G+     +++V PKSL+ F  I+P+SA TG G+  ++S IR+SL+     ++E++
Sbjct:    5 SRICFRKYGNFVDNVRLYVRGGTGGMGLPRLGGHGGDGGDVWVVAKKDTRLKQIKDKHPDKRFIAGVGSNSSIQALRGAKGEDVEVFAPTGISVTSDHGRMLGELNREGDKLLVAKGGRGGSPQSGFLPNKGQTRNIRLDLKLIADFGLVGFPNAGKSSLLTALSHAKPKIANYPFTTIKPEIGKVMYDDHKQVSVADLPGLIEGAHVNKGMGHKFLKHVERTKQLMFVVDVCGFQLASK---TPFRSAFETVLLLSKELELYKEELLSKPAILVINKMDLPEAQSHFQELEAQLENQGESIHLFSEDVIPKSLMHFTHIVPVSAMTGHGLPLLKSLIRQSLEEQDTIDTEAQ 354          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Zebrafish
Match: mtg2 (mitochondrial ribosome-associated GTPase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2209])

HSP 1 Score: 126.331 bits (316), Expect = 1.385e-32
Identity = 66/181 (36.46%), Postives = 99/181 (54.70%), Query Frame = 1
Query:  193 KAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSGEMIGTVNNQ-QTMIVCRGGEGGGPSNNFM------------AKPCENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDI 696
            +  DG+        G N    YI VP G  V  + G ++  ++ Q Q + V  GG GG  + +F+             +  +   I + L+ +A   LVGFPN GKSS L  IS     VA YPFTT+ P V  ++Y D+  + +AD+PG+I GAH+N G+G  FL+H+ER ++LL+V+D+
Sbjct:  103 RGRDGEAGGSKNCFGRNANPTYISVPVGTVVR-EQGVVLADLSQQDQQVTVAYGGAGGKGNRSFLTNENRAPMRATEGQQGQQREIQLELRTMAHAALVGFPNVGKSSLLRAISKARPAVAAYPFTTLNPHVGIVEYRDHTQVAVADIPGLIPGAHLNRGLGLSFLRHIERCRVLLYVLDM 282          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Zebrafish
Match: drg1 (developmentally regulated GTP binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-030131-8767])

HSP 1 Score: 68.1662 bits (165), Expect = 3.259e-12
Identity = 37/88 (42.05%), Postives = 52/88 (59.09%), Query Frame = 1
Query:  433 ADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDI 696
            A IG VGFP+ GKS+ L+ ++G+  +VA Y FTT+T     I+Y   + I + DLPGIIEGA    G G   +       L+L V+D+
Sbjct:   64 ARIGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLTTVPGVIRYKGAK-IQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLILIVLDV 150          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Zebrafish
Match: CABZ01035356.1 (obg-like ATPase 1 [Source:NCBI gene;Acc:110438478])

HSP 1 Score: 61.2326 bits (147), Expect = 7.364e-11
Identity = 34/122 (27.87%), Postives = 58/122 (47.54%), Query Frame = 1
Query:  439 IGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYR----------------AITIADLPGIIEGAHVNVGVGHHFLK---------HVERTKLLLFVVDI---YGFKLQSK 720
            IG+VG PN GKS+F N ++       N+PF TI P  + +  PD R                 + + D+ G+++GAH   G+G+ FL          H+ R  +++F  +    +G+ + +K
Sbjct:   25 IGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPIPDERFDFLCQYHKPASKVPAFLNVVDIAGLVKGAHAGQGLGNAFLSNIFACDAIFHMTREYIMIFRFEFSSNWGWAMSTK 146          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Zebrafish
Match: ola1 (Obg-like ATPase 1 [Source:NCBI gene;Acc:326864])

HSP 1 Score: 60.4622 bits (145), Expect = 4.970e-10
Identity = 29/90 (32.22%), Postives = 46/90 (51.11%), Query Frame = 1
Query:  439 IGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYR----------------AITIADLPGIIEGAHVNVGVGHHFLKHV 660
            IG+VG PN GKS+F N ++       N+PF TI P  + +  PD R                 + + D+ G+++GAH   G+G+ FL ++
Sbjct:   30 IGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPIPDERFDFLCQYHKPASKVPAFLNVVDIAGLVKGAHAGQGLGNAFLSNI 119          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Xenopus
Match: gtpbp10 (GTP-binding protein 10 (putative) [Source:NCBI gene;Acc:496681])

HSP 1 Score: 201.06 bits (510), Expect = 1.031e-60
Identity = 134/323 (41.49%), Postives = 192/323 (59.44%), Query Frame = 1
Query:  130 LMGDKKYKLANILKSYPGYSVKAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSGEMIGTVNNQQTMI-VCRGGEGGGPSNNFMAKPCENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSALETILLLNQELEIFXXXXXXXXXXXXXXXTDKPEGDEIAKFIIDNI-NDGKLADWKNDEVCPKSLIKFDKIIPISAKTGSGIDEVRSAIRESLDNAALKESESECDADLDQYFTET 1092
            L+  K+  L  I   +P        G  S+   + G  GE   ++VP+G+ ++ + G  IG ++ +   I V RGG+GG    +F+    +   I + LKLI+D+GLVGFPNAGKSS L+ IS    +VA Y FTT+ P++  I YPDY+ I++ADLPG+IEGAH N G+GH FLKH+ERT+ LLFVVD+ GF+L +   ST YRSA ET+LLL  EL+++   LL+KPAL  +NK D P  +E  + ++  + N         DE+ P+  I+F  IIP+SA TG G++ +   IR+++D  A  E        L     ET
Sbjct:   39 LVAKKEVTLKKIKDKFPHKRFIGGVGGNSSVRALKGQPGEVCQVEVPSGIVITTEHGVKIGELDKEGDEIRVARGGQGGVFQTDFLPSKGQKRIIHLDLKLISDVGLVGFPNAGKSSLLSRISHAKPQVAEYAFTTVKPELGRIMYPDYKQISVADLPGLIEGAHYNRGMGHKFLKHIERTRQLLFVVDVAGFQLSA---STLYRSAFETVLLLTLELQLYKQELLDKPALLAVNKMDLPNANEKFEELLKQLENPAGNFHLLPDELVPERPIEFKHIIPVSAATGQGLENLIGCIRKTMDEQADMEIRELAQERLQSLQKET 358          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Xenopus
Match: gtpbp10 (GTP-binding protein 10 (putative) [Source:NCBI gene;Acc:496681])

HSP 1 Score: 201.445 bits (511), Expect = 1.053e-60
Identity = 134/324 (41.36%), Postives = 193/324 (59.57%), Query Frame = 1
Query:  130 LMGDKKYKLANILKSYPGYSVKAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSGEMIGTVNNQQ--TMIVCRGGEGGGPSNNFMAKPCENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSALETILLLNQELEIFXXXXXXXXXXXXXXXTDKPEGDEIAKFIIDNI-NDGKLADWKNDEVCPKSLIKFDKIIPISAKTGSGIDEVRSAIRESLDNAALKESESECDADLDQYFTET 1092
            L+  K+  L  I   +P        G  S+   + G  GE   ++VP+G+ ++ + G  IG + N++   + V RGG+GG    +F+    +   I + LKLI+D+GLVGFPNAGKSS L+ IS    +VA Y FTT+ P++  I YPDY+ I++ADLPG+IEGAH N G+GH FLKH+ERT+ LLFVVD+ GF+L +   ST YRSA ET+LLL  EL+++   LL+KPAL  +NK D P  +E  + ++  + N         DE+ P+  I+F  IIP+SA TG G++ +   IR+++D  A  E        L     ET
Sbjct:   47 LVAKKEVTLKKIKDKFPHKRFIGGVGGNSSVRALKGQPGEVCQVEVPSGIVITTEHGVKIGKLLNKEGDEIRVARGGQGGVFQTDFLPSKGQKRIIHLDLKLISDVGLVGFPNAGKSSLLSRISHAKPQVAEYAFTTVKPELGRIMYPDYKQISVADLPGLIEGAHYNRGMGHKFLKHIERTRQLLFVVDVAGFQLSA---STLYRSAFETVLLLTLELQLYKQELLDKPALLAVNKMDLPNANEKFEELLKQLENPAGNFHLLPDELVPERPIEFKHIIPVSAATGQGLENLIGCIRKTMDEQADMEIRELAQERLQSLQKET 367          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Xenopus
Match: gtpbp10 (GTP-binding protein 10 (putative) [Source:NCBI gene;Acc:496681])

HSP 1 Score: 201.445 bits (511), Expect = 1.535e-60
Identity = 134/323 (41.49%), Postives = 192/323 (59.44%), Query Frame = 1
Query:  130 LMGDKKYKLANILKSYPGYSVKAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSGEMIGTVNNQQTMI-VCRGGEGGGPSNNFMAKPCENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSALETILLLNQELEIFXXXXXXXXXXXXXXXTDKPEGDEIAKFIIDNI-NDGKLADWKNDEVCPKSLIKFDKIIPISAKTGSGIDEVRSAIRESLDNAALKESESECDADLDQYFTET 1092
            L+  K+  L  I   +P        G  S+   + G  GE   ++VP+G+ ++ + G  IG ++ +   I V RGG+GG    +F+    +   I + LKLI+D+GLVGFPNAGKSS L+ IS    +VA Y FTT+ P++  I YPDY+ I++ADLPG+IEGAH N G+GH FLKH+ERT+ LLFVVD+ GF+L +   ST YRSA ET+LLL  EL+++   LL+KPAL  +NK D P  +E  + ++  + N         DE+ P+  I+F  IIP+SA TG G++ +   IR+++D  A  E        L     ET
Sbjct:   56 LVAKKEVTLKKIKDKFPHKRFIGGVGGNSSVRALKGQPGEVCQVEVPSGIVITTEHGVKIGELDKEGDEIRVARGGQGGVFQTDFLPSKGQKRIIHLDLKLISDVGLVGFPNAGKSSLLSRISHAKPQVAEYAFTTVKPELGRIMYPDYKQISVADLPGLIEGAHYNRGMGHKFLKHIERTRQLLFVVDVAGFQLSA---STLYRSAFETVLLLTLELQLYKQELLDKPALLAVNKMDLPNANEKFEELLKQLENPAGNFHLLPDELVPERPIEFKHIIPVSAATGQGLENLIGCIRKTMDEQADMEIRELAQERLQSLQKET 375          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Xenopus
Match: gtpbp10 (GTP-binding protein 10 (putative) [Source:NCBI gene;Acc:496681])

HSP 1 Score: 200.675 bits (509), Expect = 1.899e-60
Identity = 134/323 (41.49%), Postives = 192/323 (59.44%), Query Frame = 1
Query:  130 LMGDKKYKLANILKSYPGYSVKAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSGEMIGTVNNQQTMI-VCRGGEGGGPSNNFMAKPCENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSALETILLLNQELEIFXXXXXXXXXXXXXXXTDKPEGDEIAKFIIDNI-NDGKLADWKNDEVCPKSLIKFDKIIPISAKTGSGIDEVRSAIRESLDNAALKESESECDADLDQYFTET 1092
            L+  K+  L  I   +P        G  S+   + G  GE   ++VP+G+ ++ + G  IG ++ +   I V RGG+GG    +F+    +   I + LKLI+D+GLVGFPNAGKSS L+ IS    +VA Y FTT+ P++  I YPDY+ I++ADLPG+IEGAH N G+GH FLKH+ERT+ LLFVVD+ GF+L +   ST YRSA ET+LLL  EL+++   LL+KPAL  +NK D P  +E  + ++  + N         DE+ P+  I+F  IIP+SA TG G++ +   IR+++D  A  E        L     ET
Sbjct:   44 LVAKKEVTLKKIKDKFPHKRFIGGVGGNSSVRALKGQPGEVCQVEVPSGIVITTEHGVKIGELDKEGDEIRVARGGQGGVFQTDFLPSKGQKRIIHLDLKLISDVGLVGFPNAGKSSLLSRISHAKPQVAEYAFTTVKPELGRIMYPDYKQISVADLPGLIEGAHYNRGMGHKFLKHIERTRQLLFVVDVAGFQLSA---STLYRSAFETVLLLTLELQLYKQELLDKPALLAVNKMDLPNANEKFEELLKQLENPAGNFHLLPDELVPERPIEFKHIIPVSAATGQGLENLIGCIRKTMDEQADMEIRELAQERLQSLQKET 363          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Xenopus
Match: gtpbp10 (GTP-binding protein 10 (putative) [Source:NCBI gene;Acc:496681])

HSP 1 Score: 201.06 bits (510), Expect = 2.266e-60
Identity = 134/323 (41.49%), Postives = 192/323 (59.44%), Query Frame = 1
Query:  130 LMGDKKYKLANILKSYPGYSVKAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSGEMIGTVNNQQTMI-VCRGGEGGGPSNNFMAKPCENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSALETILLLNQELEIFXXXXXXXXXXXXXXXTDKPEGDEIAKFIIDNI-NDGKLADWKNDEVCPKSLIKFDKIIPISAKTGSGIDEVRSAIRESLDNAALKESESECDADLDQYFTET 1092
            L+  K+  L  I   +P        G  S+   + G  GE   ++VP+G+ ++ + G  IG ++ +   I V RGG+GG    +F+    +   I + LKLI+D+GLVGFPNAGKSS L+ IS    +VA Y FTT+ P++  I YPDY+ I++ADLPG+IEGAH N G+GH FLKH+ERT+ LLFVVD+ GF+L +   ST YRSA ET+LLL  EL+++   LL+KPAL  +NK D P  +E  + ++  + N         DE+ P+  I+F  IIP+SA TG G++ +   IR+++D  A  E        L     ET
Sbjct:   60 LVAKKEVTLKKIKDKFPHKRFIGGVGGNSSVRALKGQPGEVCQVEVPSGIVITTEHGVKIGELDKEGDEIRVARGGQGGVFQTDFLPSKGQKRIIHLDLKLISDVGLVGFPNAGKSSLLSRISHAKPQVAEYAFTTVKPELGRIMYPDYKQISVADLPGLIEGAHYNRGMGHKFLKHIERTRQLLFVVDVAGFQLSA---STLYRSAFETVLLLTLELQLYKQELLDKPALLAVNKMDLPNANEKFEELLKQLENPAGNFHLLPDELVPERPIEFKHIIPVSAATGQGLENLIGCIRKTMDEQADMEIRELAQERLQSLQKET 379          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Mouse
Match: Gtpbp10 (GTP-binding protein 10 (putative) [Source:MGI Symbol;Acc:MGI:2385599])

HSP 1 Score: 221.861 bits (564), Expect = 6.535e-69
Identity = 125/318 (39.31%), Postives = 197/318 (61.95%), Query Frame = 1
Query:  124 IFLMGDKKYKLANILKSYPGYSVKAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSGEMIGTVNNQQ-TMIVCRGGEGGGPSNNFMAKPCENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSALETILLLNQELEIFXXXXXXXXXXXXXXXTDKPEGD-EIAKFIIDNINDGKLADWKNDEVCPKSLIKFDKIIPISAKTGSGIDEVRSAIRESLDNAALKESESECDADL 1071
            ++++  K   L  +   YP     A  G  S  + + GS G++  +  P G+ V+ ++G+++G +N ++  ++V +GG GG    NF+    +   + + LK+IAD+GLVGFPNAGKSS L+ +S  +  +A+Y FTT+ P++  I Y D++ I++ADLPG+IEGAH+N G+GH FLKH+ERT+ LLFVVDI GF+L S    T YR+A ETI+LL +ELE++   L  KPAL  +NK D P+   ++ + +   ++          ++ P+  ++F  I+PIS  TG GI E++S IR++LD    KES++     L
Sbjct:   45 VWVVAHKNMTLKQLKNKYPQKRFVAGGGANSRVSALQGSKGKDCEVPAPVGISVTDENGQVLGELNKEEDRVLVAKGGLGGKLHTNFLPLKGQKRIVHLDLKVIADVGLVGFPNAGKSSLLSRVSHATPVIADYAFTTLRPELGKIMYNDFKQISVADLPGLIEGAHMNKGMGHKFLKHLERTRQLLFVVDISGFQLSS---VTPYRTAFETIILLTKELELYKEELQTKPALLAINKMDLPDAQVKLQELMKQLLSPEDFLHLFETKMIPEKALEFQHIVPISTVTGEGIAELKSCIRKALDEQDGKESDAHRSKQL 359          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Mouse
Match: Gtpbp10 (GTP-binding protein 10 (putative) [Source:MGI Symbol;Acc:MGI:2385599])

HSP 1 Score: 166.777 bits (421), Expect = 1.308e-48
Identity = 93/207 (44.93%), Postives = 136/207 (65.70%), Query Frame = 1
Query:  454 FPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSALETILLLNQELEIFXXXXXXXXXXXXXXXTDKPEGD-EIAKFIIDNINDGKLADWKNDEVCPKSLIKFDKIIPISAKTGSGIDEVRSAIRESLDNAALKESESECDADL 1071
            FPNAGKSS L+ +S  +  +A+Y FTT+ P++  I Y D++ I++ADLPG+IEGAH+N G+GH FLKH+ERT+ LLFVVDI GF+L S    T YR+A ETI+LL +ELE++   L  KPAL  +NK D P+   ++ + +   ++          ++ P+  ++F  I+PIS  TG GI E++S IR++LD    KES++     L
Sbjct:   77 FPNAGKSSLLSRVSHATPVIADYAFTTLRPELGKIMYNDFKQISVADLPGLIEGAHMNKGMGHKFLKHLERTRQLLFVVDISGFQLSS---VTPYRTAFETIILLTKELELYKEELQTKPALLAINKMDLPDAQVKLQELMKQLLSPEDFLHLFETKMIPEKALEFQHIVPISTVTGEGIAELKSCIRKALDEQDGKESDAHRSKQL 280          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Mouse
Match: Mtg2 (mitochondrial ribosome associated GTPase 2 [Source:MGI Symbol;Acc:MGI:106565])

HSP 1 Score: 124.405 bits (311), Expect = 1.251e-31
Identity = 77/206 (37.38%), Postives = 111/206 (53.88%), Query Frame = 1
Query:  124 IFLMGDKKYK-LANILKSYPGYSVKAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSGE-MIGTVNNQQTMIVCRGGEGGGPSNNFM-------------AKPCENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDI 696
            I L  D++ K L+++L  Y G+S     G++       G  G  +YI+VP G  V  K G+ ++  ++N     V   G  GG  N F               +P +   + + LK +A  G+VGFPNAGKSS L  IS     VA+YPFTT+ P V  + Y  ++ + +AD+PGII GAH N G+G  FL+H+ER +  LFVVD+
Sbjct:  113 IILRVDQQVKSLSSVLSQYQGFS-----GEDGGSKNCSGRGGATLYIQVPVGTLV--KEGDKIVADLSNLGDEYVAALGGAGGKGNRFFLANDNRAPVTCTPGQPGQERVLYLELKTMAHAGMVGFPNAGKSSLLRAISNAKPAVASYPFTTLNPHVGIVHYEGHQQVAVADIPGIIRGAHQNKGLGLSFLRHIERCRFFLFVVDL 311          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Mouse
Match: Mtg2 (mitochondrial ribosome associated GTPase 2 [Source:MGI Symbol;Acc:MGI:106565])

HSP 1 Score: 124.405 bits (311), Expect = 1.251e-31
Identity = 77/206 (37.38%), Postives = 111/206 (53.88%), Query Frame = 1
Query:  124 IFLMGDKKYK-LANILKSYPGYSVKAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSGE-MIGTVNNQQTMIVCRGGEGGGPSNNFM-------------AKPCENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDI 696
            I L  D++ K L+++L  Y G+S     G++       G  G  +YI+VP G  V  K G+ ++  ++N     V   G  GG  N F               +P +   + + LK +A  G+VGFPNAGKSS L  IS     VA+YPFTT+ P V  + Y  ++ + +AD+PGII GAH N G+G  FL+H+ER +  LFVVD+
Sbjct:  113 IILRVDQQVKSLSSVLSQYQGFS-----GEDGGSKNCSGRGGATLYIQVPVGTLV--KEGDKIVADLSNLGDEYVAALGGAGGKGNRFFLANDNRAPVTCTPGQPGQERVLYLELKTMAHAGMVGFPNAGKSSLLRAISNAKPAVASYPFTTLNPHVGIVHYEGHQQVAVADIPGIIRGAHQNKGLGLSFLRHIERCRFFLFVVDL 311          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Mouse
Match: Gtpbp10 (GTP-binding protein 10 (putative) [Source:MGI Symbol;Acc:MGI:2385599])

HSP 1 Score: 111.694 bits (278), Expect = 3.253e-28
Identity = 51/87 (58.62%), Postives = 69/87 (79.31%), Query Frame = 1
Query:  529 TTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSALETILLLNQELEIF 789
            TT+ P++  I Y D++ I++ADLPG+IEGAH+N G+GH FLKH+ERT+ LLFVVDI GF+L S    T YR+A ETI+LL +ELE++
Sbjct:  108 TTLRPELGKIMYNDFKQISVADLPGLIEGAHMNKGMGHKFLKHLERTRQLLFVVDISGFQLSS---VTPYRTAFETIILLTKELELY 191          
BLAST of GTP-binding protein 10 homolog vs. UniProt/SwissProt
Match: sp|Q6DHF7|GTPBA_DANRE (GTP-binding protein 10 OS=Danio rerio OX=7955 GN=gtpbp10 PE=2 SV=1)

HSP 1 Score: 238.424 bits (607), Expect = 2.926e-74
Identity = 152/353 (43.06%), Postives = 229/353 (64.87%), Query Frame = 1
Query:   10 SKIIFQK--EFFDKIKLHLISXXXXXXXXXXXXXXXXXXSIFLMGDKKYKLANILKSYPGYSVKAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSGEMIGTVNNQ-QTMIVCRGGEGGGPSNNFMAKPCENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSALETILLLNQELEIFXXXXXXXXXXXXXXXTDKPEGDEIAKFIIDNI-NDGKLADWKNDEVCPKSLIKFDKIIPISAKTGSGIDEVRSAIRESLDNAALKESESE 1056
            S+I F+K   F D ++L++  G GG G P+ GG GG+GG ++++  K  +L  I   +P     A  G  S+   + G+ GE++ +  P G+ V+   G M+G +N +   ++V +GG GG P + F+    +  +I + LKLIAD GLVGFPNAGKSS L  +S    K+ANYPFTTI P++  + Y D++ +++ADLPG+IEGAHVN G+GH FLKHVERTK L+FVVD+ GF+L SK   T +RSA ET+LLL++ELE++   LL+KPA+ ++NK D PE     + +   + N G+     +++V PKSL+ F  I+P+SA TG G+  ++S IR+SL+     ++E++
Sbjct:    5 SRICFRKYGNFVDNVRLYVRGGTGGMGLPRLGGHGGDGGDVWVVAKKDTRLKQIKDKHPDKRFIAGVGSNSSIQALRGAKGEDVEVFAPTGISVTSDHGRMLGELNREGDKLLVAKGGRGGSPQSGFLPNKGQTRNIRLDLKLIADFGLVGFPNAGKSSLLTALSHAKPKIANYPFTTIKPEIGKVMYDDHKQVSVADLPGLIEGAHVNKGMGHKFLKHVERTKQLMFVVDVCGFQLASK---TPFRSAFETVLLLSKELELYKEELLSKPAILVINKMDLPEAQSHFQELEAQLENQGESIHLFSEDVIPKSLMHFTHIVPVSAMTGHGLPLLKSLIRQSLEEQDTIDTEAQ 354          
BLAST of GTP-binding protein 10 homolog vs. UniProt/SwissProt
Match: sp|Q3MHG6|GTPBA_BOVIN (GTP-binding protein 10 OS=Bos taurus OX=9913 GN=GTPBP10 PE=2 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 4.515e-73
Identity = 135/312 (43.27%), Postives = 199/312 (63.78%), Query Frame = 1
Query:  124 IFLMGDKKYKLANILKSYPGYSVKAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSGEMIGTVNNQQ-TMIVCRGGEGGGPSNNFMAKPCENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSALETILLLNQELEIFXXXXXXXXXXXXXXXTDKPEGDEIAKFIIDNINDGK-LADWKNDEVCPKSLIKFDKIIPISAKTGSGIDEVRSAIRESLDNAALKESES 1053
            ++++   +  L  +   YP     A +G  S  + + GS G++  I VP GV V+ ++G++IG +N ++  ++V  GG GG    NF+    +   I + LKLIADIGLVGFPNAGKSS L+ IS     +A+Y FTTI P++  I Y D++ I++ADLPG+IEGAH+N G+GH FLKH+ERTK LLFVVDI GF+L S+   T YR+A ETI+LL++ELE++   L  KPAL  +NK D P+       +++ + + K         + P+  ++F  IIPISA TG GIDE+++ IR+SLD    +E+++
Sbjct:   45 VWVVAHNRMTLKQLKDKYPQKRFVAGEGANSRVSALKGSKGKDCEIPVPVGVSVTDENGKIIGELNKEKDRLLVAEGGLGGKLLTNFLPLKGQKRVIHLDLKLIADIGLVGFPNAGKSSLLSKISHAKPAIADYAFTTIKPELGKIMYSDFKQISVADLPGLIEGAHMNKGMGHKFLKHIERTKQLLFVVDISGFQLSSQ---THYRTAFETIILLSKELELYKEELHTKPALLAVNKMDLPDAQGKFHVLMNQLQNPKEFFHLFEKNMIPERTVEFQHIIPISAITGEGIDELKNCIRKSLDEHTNQENDA 353          
BLAST of GTP-binding protein 10 homolog vs. UniProt/SwissProt
Match: sp|A4D1E9|GTPBA_HUMAN (GTP-binding protein 10 OS=Homo sapiens OX=9606 GN=GTPBP10 PE=1 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 4.339e-71
Identity = 151/367 (41.14%), Postives = 230/367 (62.67%), Query Frame = 1
Query:   10 SKIIFQK--EFFDKIKLHLISXXXXXXXXXXXXXXXXXXSIFLMGDKKYKLANILKSYPGYSVKAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSGEMIGTVNNQQ-TMIVCRGGEGGGPSNNFMAKPCENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSALETILLLNQELEIFXXXXXXXXXXXXXXXTDKPEGDEIAKFIIDNINDGK-LADWKNDEVCPKSLIKFDKIIPISAKTGSGIDEVRSAIRESLDNAALKESESECDAD-LDQYFTETM 1095
            S ++F+K   F DK++L    G+GG G P+ GG+GG GG ++++   +  L  +   YP     A  G  S  + + GS G++  I VP G+ V+ ++G++IG +N +   ++V +GG GG    NF+    +   I + LKLIAD+GLVGFPNAGKSS L+ +S     +A+Y FTT+ P++  I Y D++ I++ADLPG+IEGAH+N G+GH FLKH+ERT+ LLFVVDI GF+L S    T YR+A ETI+LL +ELE++   L  KPAL  +NK D P+  +    ++  + + K         + P+  ++F  IIPISA TG GI+E+++ IR+SLD  A +E+++      L+ + ++TM
Sbjct:    5 SCVLFRKYGNFIDKLRLFTRGGSGGMGYPRLGGEGGKGGDVWVVAQNRMTLKQLKDRYPRKRFVAGVGANSKISALKGSKGKDCEIPVPVGISVTDENGKIIGELNKENDRILVAQGGLGGKLLTNFLPLKGQKRIIHLDLKLIADVGLVGFPNAGKSSLLSCVSHAKPAIADYAFTTLKPELGKIMYSDFKQISVADLPGLIEGAHMNKGMGHKFLKHIERTRQLLFVVDISGFQLSS---HTQYRTAFETIILLTKELELYKEELQTKPALLAVNKMDLPDAQDKFHELMSQLQNPKDFLHLFEKNMIPERTVEFQHIIPISAVTGEGIEELKNCIRKSLDEQANQENDALHKKQLLNLWISDTM 368          
BLAST of GTP-binding protein 10 homolog vs. UniProt/SwissProt
Match: sp|Q29K06|GTPBA_DROPS (GTP-binding protein 10 homolog OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=GA10450 PE=3 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 1.378e-70
Identity = 159/349 (45.56%), Postives = 225/349 (64.47%), Query Frame = 1
Query:   22 FQKEFFDKIKLHLISXXXXXXXXXXXXXXXXXXSIFLMGDKKYKLANILKSYPGYSVKAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSGEMIGTVN-NQQTMIVCRGGEGGGPSNNFMAKPCENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSALETILLLNQELEIFXXXXXXXXXXXXXXXTDKPEGDEI---AKFIIDNINDGKLADWKNDEVCPKSLIKFDKIIPISAKTGSGIDEVRSAIRESLDNAALKESESE 1056
            F+  F D ++L +  G+GGNG PKYGG GG GG ++ +  +   L  + +      V A  G++S+K  I G  G +  I+VP GV V  +  +++  +N N    IV  GG GG   NNF+ +P EN  +++ LKLIAD+GLVGFPNAGKS+ L  +S    K+A YPFTTI PQ+ TI+Y D R+I++ADLPG+IEGAH N G+GH FLKH+ERT+LLLF+VDI+GF+L  +     +R  L  I  LN+ELE+++P LL KP + LLNK DK    +I    K IID+++ G LAD   +EV PK ++KF+ I+PISA   + + +V+S +R +L   A K+  S+
Sbjct:   20 FRPSFLDTLRLAVRGGHGGNGLPKYGGVGGQGGCVYFVAKEGLTLRKMAQGLKDRRVAASSGEDSSKVSIFGKRGVDTRIEVPVGVQVYDEQQKLLADLNENDAKCIVAGGGTGGCTGNNFLGRPGENRIVNLDLKLIADVGLVGFPNAGKSTLLKAVSNAKPKIAAYPFTTIRPQIGTIEYGDLRSISLADLPGLIEGAHANFGMGHKFLKHIERTRLLLFMVDIFGFQLSPRH---PHRDCLANIYSLNKELELYDPSLLEKPCVLLLNKMDKEGAHDILTKVKPIIDDLSSG-LADCP-EEVRPKRVLKFESIVPISAINSTRVTQVKSQLRRTLVRLAEKQFVSD 363          
BLAST of GTP-binding protein 10 homolog vs. UniProt/SwissProt
Match: sp|Q9I7M2|GTPBA_DROME (GTP-binding protein 10 homolog OS=Drosophila melanogaster OX=7227 GN=CG10628 PE=2 SV=2)

HSP 1 Score: 228.024 bits (580), Expect = 2.829e-70
Identity = 139/322 (43.17%), Postives = 205/322 (63.66%), Query Frame = 1
Query:  124 IFLMGDKKYKLANILKSYPGYSVKAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSGEMIGTVNNQQ-TMIVCRGGEGGGPSNNFMAKPCENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSALETILLLNQELEIFXXXXXXXXXXXXXXXTDKPEGDEI---AKFIIDNINDGKLADWKNDEVCPKSLIKFDKIIPISAKTGSGIDEVRSAIRESLDNAALKESESECDADLDQ 1077
            ++L+  +   L  +++      V A  G++S+K  I G  G +  I+VP GV V     ++I  ++  + T IV  GG GG  + NF+ +P EN ++++ LKLIAD+GLVGFPNAGKS+ L  +S    K+A YPFTTI PQ+ TI+Y D R+IT+ADLPG+IEGAH N G+GH FLKH+ERT+LL+F+VDI+GF+L  K     +R  L  +  LN+ELE+++P LL KP++ LLNK DK    EI    K ++ ++  G   +   +E+ PK ++ FD I+PISA   S I +V+S +R +L    ++ +E +  AD DQ
Sbjct:   54 VYLVAKEGLTLRKVVQGLKDKRVAASSGEDSSKASIFGRRGADQRIEVPVGVQVYDDQQKLIADLDEHEATCIVAGGGTGGCTATNFLGRPGENRTVNLDLKLIADVGLVGFPNAGKSTLLKAVSNAKPKIAAYPFTTIRPQIGTIEYRDLRSITVADLPGLIEGAHANFGMGHKFLKHIERTRLLVFMVDIFGFQLSPKH---PHRDCLANVYALNKELELYDPSLLEKPSVLLLNKMDKEGAHEIFTKVKPLVSDLASG--LEQCPEELRPKQVLNFDSIVPISAMNSSKITQVKSQLRRTL----VRLAEKQFLADEDQ 366          
BLAST of GTP-binding protein 10 homolog vs. TrEMBL
Match: R7TXN3 (OBG-type G domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_226536 PE=4 SV=1)

HSP 1 Score: 268.085 bits (684), Expect = 3.709e-83
Identity = 167/354 (47.18%), Postives = 237/354 (66.95%), Query Frame = 1
Query:   34 FFDKIKLHLISXXXXXXXXXXXXXXXXXXSIFLMGDKKYKLANILKSYPGYSVKAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSGEMIGTVNN-QQTMIVCRGGEGGGPSNNFMAKPCENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSALETILLLNQELEIFXXXXXXXXXXXXXXXTDKPEGDEIAKFIIDNINDGKLADWKNDEVCPKSL-----IKFDKIIPISAKTGSGIDEVRSAIRESLDNAALKESESECDADLDQ 1077
            F DK++L++  G+GGNG  KYGGKGG GG ++++G+K   L  +++  P   ++A  G +ST   +LG+ GEN+ + VPAGV V L SGE+IG VN     +++ RGGEGGGP N F+ +  +  SIS+ LKLIAD+GLVGFPNAGKS+FL  +S  S K+A+YPFTT+ PQ+  + Y D+R I++ADLPG+IEGAH N+G+GH FLKHVERT++LLFVVD+ GF+L    L+   RSA ET+LLLN+ELE++   L+ KP+L ++NK D    ++I + + D I    LA  ++    P  L     + FD II ISAK    +DEV+  +R  +D     E E+E   +L++
Sbjct:   38 FIDKVRLYVRGGHGGNGKVKYGGKGGQGGHVYVVGEKGATLRKLIRKNPSKRIQASAGCDSTLRALLGAPGENVELMVPAGVSVCLDSGEIIGEVNQFGDRVLIARGGEGGGPQNRFLPQQGDAHSISLDLKLIADVGLVGFPNAGKSTFLKAVSRASPKIASYPFTTLKPQLGIMNYNDHRKISVADLPGLIEGAHYNIGLGHSFLKHVERTRVLLFVVDVTGFRLS---LNHQERSAYETVLLLNKELELYKEELVTKPSLLVVNKMDLRGTEDIFRRLKDQI----LALKESASSIPHDLASEEYVNFDDIISISAKNQENVDEVKEKLRMIIDRYDSLEKEAELQDNLEK 384          
BLAST of GTP-binding protein 10 homolog vs. TrEMBL
Match: V3ZZC4 (OBG-type G domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_193870 PE=4 SV=1)

HSP 1 Score: 268.085 bits (684), Expect = 4.119e-83
Identity = 150/327 (45.87%), Postives = 205/327 (62.69%), Query Frame = 1
Query:  121 SIFLMGDKKYKLANILKSYPGYSVKAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSGEMIGTVNNQ-QTMIVCRGGEGGGPSNNFMAKPCENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSALETILLLNQELEIFXXXXXXXXXXXXXXXTDKPEGDEIAKFIIDNINDGK----LADWKN---------DEVCPKSLIKFDKIIPISAKTGSGIDEVRSAIRESLD-NAALKESESE 1056
            ++ +   K   L ++ + YP     AP GK S K ++LG  GEN+ I VP G+ V   SG +IG ++ + Q +++ RGG+GG P N F+ +  EN S+ + LKL+ADIGLVGFPNAGKS+FL+ +S  + K+A YPFTTI PQ+  ++YPD R I+IADLPG+IEGAH N G+GH FLKH+ERTKLLL +VDI GF L  K      R+A ETILLLN+ELE++           + + TD+P    + K   D+ ++ K    + D KN         +E+ PKSL+KFD I  ISAK   G++ V S IR  LD  A LK +ES+
Sbjct:   75 NVVIRASKNTSLKSVFRLYPTKRFSAPTGKNSQKYRLLGDPGENLKIDVPVGISVQTDSGRVIGELDTEGQELVLARGGKGGNPDNGFLGRKGENRSVKLDLKLLADIGLVGFPNAGKSTFLSAVSRANPKIAAYPFTTIQPQLGIVEYPDSRRISIADLPGLIEGAHDNFGMGHRFLKHIERTKLLLMLVDINGFSLGVK---YDLRTAFETILLLNKELELY-----------MTDLTDRPTILVLNKIDTDSTSESKADKIIQDVKNLPETLKNVDNELHPKSLLKFDDIFTISAKEKLGLECVLSCIRNRLDYYAELKRTESD 387          
BLAST of GTP-binding protein 10 homolog vs. TrEMBL
Match: H9J000 (OBG-type G domain-containing protein OS=Bombyx mori OX=7091 GN=101746927 PE=4 SV=1)

HSP 1 Score: 260.381 bits (664), Expect = 2.873e-80
Identity = 163/348 (46.84%), Postives = 231/348 (66.38%), Query Frame = 1
Query:    1 MKISKIIFQKEFFDKIKLHLISXXXXXXXXXXXXXXXXXXSIFLMGDKKYKLANILKSYPGYSVKAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSGEMIGTVNNQ-QTMIVCRGGEGGGPSNNFMAKPCENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSALETILLLNQELEIFXXXXXXXXXXXXXXXTDKPEGDEIAKFIIDNIND-GKLADWKNDEVCPKSLIKFDKIIPISA-KTGSGIDEVRSAIRESLDNAA 1035
            +K  +   + +F D ++LH+  G GG G PK GG GG GG ++ +G +   L  I+ ++ G ++ A  G++S KT+I+G+ GE+I ++VP GV V  + G ++G+++ + QT+I+ RGG GG P NNF+    +   I + LKLIADIGLVGFPNAGKSS L  IS    ++ANYPFTTI P    + Y D R I+IADLPG+IEGAHVN+G+GH FLKHVERTKLLLF+ D+ GF+L  K  +   RS LET+LLLN+ELE++N   LNKPA+  +NK D P  +E    I ++ ND   + +   +E+ P+ LI+FD II ISA + G  I++++  +R  LD  A
Sbjct:   13 LKKPRNYLRSKFIDSVRLHVKGGTGGTGLPKLGGLGGQGGCVYCVGTETANLRRIMSNFRGKTITAGHGEDSRKTKIIGTPGEDIKLEVPLGVTVYREDGTVLGSIDKEDQTVIIARGGPGGTPQNNFLGHFGQTHHIRLDLKLIADIGLVGFPNAGKSSLLKAISRAKPRIANYPFTTIKPNKGVMVYADKRQISIADLPGLIEGAHVNIGLGHTFLKHVERTKLLLFIADVKGFQLSPKHPN---RSCLETVLLLNKELELYNKEFLNKPAILAINKMDLPGSEETLHRIKESYNDKDNILNSIPEEIRPERLIEFDDIIGISALERGESIEQLKQLLRRRLDQFA 357          
BLAST of GTP-binding protein 10 homolog vs. TrEMBL
Match: A0A2H1VXB9 (SFRICE_001850 OS=Spodoptera frugiperda OX=7108 GN=SFRICE_001850 PE=4 SV=1)

HSP 1 Score: 255.758 bits (652), Expect = 1.519e-78
Identity = 167/350 (47.71%), Postives = 231/350 (66.00%), Query Frame = 1
Query:    1 MKISKIIFQKEFFDKIKLHLISXXXXXXXXXXXXXXXXXXSIFLMGDKKYKLANILKSYPGYSVKAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSGEMIGTVNNQ-QTMIVCRGGEGGGPSNNFMAKPCENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSALETILLLNQELEIFXXXXXXXXXXXXXXXTDKPEGDEIAKFIID---NINDGKLADWKNDEVCPKSLIKFDKIIPISA-KTGSGIDEVRSAIRESLDNAA 1035
            +K  +   + +F D ++LH+  G GG G PK+GG GG GG ++ +G +   L +++  + G +V A  G++S KT+I+G+ G +I ++VP GV V  + G+++G+++ + +T+I+ RGG GG P +NF+    +   I + LKLIADIGLVGFPNAGKSS L  IS    K+ANYPFTTI P    I YPD R I+IADLPG+IEGAH+NVG+GH FLKHVERTK+LLF+ D  GF+L  K      RS LET+LLLN+ELE++N  LL KPA+  +NK D P  +EI   I D   NIN   + D   ++V P++ I FD II ISA + G GI E++  +R  LD  A
Sbjct:   14 LKKPRGYLRSKFLDSVRLHVKGGTGGTGLPKFGGLGGQGGCVYCIGKENANLKSVMNKHRGKTVSAGHGEDSRKTKIVGNPGSDIKLEVPLGVTVYREDGKVLGSIDKEGETVILARGGPGGTPESNFLGHHGQVHHIRLDLKLIADIGLVGFPNAGKSSLLKAISKAQPKIANYPFTTIKPNKGIIGYPDLRQISIADLPGLIEGAHINVGLGHSFLKHVERTKILLFIADAQGFQLSPKH---PKRSCLETVLLLNKELELYNSELLQKPAILAVNKMDLPGTNEILTNIKDAYKNIN--LVLDTLPEDVRPENAISFDDIIGISALRGGPGILELKELLRRRLDELA 358          
BLAST of GTP-binding protein 10 homolog vs. TrEMBL
Match: A0A2A4J3Y8 (OBG-type G domain-containing protein OS=Heliothis virescens OX=7102 GN=B5V51_7527 PE=4 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 1.069e-77
Identity = 159/348 (45.69%), Postives = 233/348 (66.95%), Query Frame = 1
Query:    1 MKISKIIFQKEFFDKIKLHLISXXXXXXXXXXXXXXXXXXSIFLMGDKKYKLANILKSYPGYSVKAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSGEMIGTVNNQ-QTMIVCRGGEGGGPSNNFMAKPCENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSALETILLLNQELEIFXXXXXXXXXXXXXXXTDKPEGDEIAKFIIDNIND-GKLADWKNDEVCPKSLIKFDKIIPISA-KTGSGIDEVRSAIRESLDNAA 1035
            +K  +   + +F D ++LH+  G GG G PK+GG GG GG ++ +G +   L +++  + G ++ A  G++S KT+I+G+ G ++ ++VP GV V  + G+++G+++ + +T+I+ RGG GG P  NF+    +   I + LKLIADIGLVGFPNAGKSS L  IS    K+ANYPFTTI P    I Y D R I+IADLPG+IEGAH+NVG+GH FLKHVERTK+LLF+ D+ GF+L  K      RS LET+LLLN+ELE+++P LL KPA+  +NK D P  D I K I +   D   + +   +++ P+++I FD II ISA + G  I+E+++ +R+ LD+ A
Sbjct:   14 LKKPRNYLRTKFIDSVRLHVKGGTGGTGLPKFGGLGGQGGCVYCVGKEDANLRSVMSKHRGKTLTAGHGEDSRKTKIVGNPGSDVKLEVPLGVTVYREDGKVLGSIDKEGETVIIARGGPGGTPETNFLGHFGQAHHIRLDLKLIADIGLVGFPNAGKSSLLKAISRAQPKIANYPFTTIKPNKGIIAYKDLRQISIADLPGLIEGAHINVGLGHSFLKHVERTKILLFIADVQGFQLSHKH---PMRSCLETVLLLNKELELYDPELLQKPAILAVNKMDLPGTDAILKSIKEAYRDINSVVETLPEDIRPENVIAFDDIIGISALRRGPSIEELKNLLRKRLDDLA 358          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Cavefish
Match: gtpbp10 (GTP-binding protein 10 (putative) [Source:NCBI gene;Acc:436727])

HSP 1 Score: 219.164 bits (557), Expect = 1.776e-67
Identity = 124/324 (38.27%), Postives = 202/324 (62.35%), Query Frame = 1
Query:  124 IFLMGDKKYKLANILKSYPGYSVKAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSGEMIGTVNNQ-QTMIVCRGGEGGGPSNNFMAKPCENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSALETILLLNQELEIFXXXXXXXXXXXXXXXTDKPEGDEIAKFIIDNI-NDGKLADWKNDEVCPKSLIKFDKIIPISAKTGSGIDEVRSAIRESLDNAALKESESECDADLDQYFTE 1089
            ++++  K   L  I   YP     A  G  S+   + G+ G ++ I  P G+ ++  +G+++G +N +   ++V RGG+GG   + F+    +   I + L+LIAD+GLVGFPNAGKSS L  +S  + ++A+YPFTT+ P++  + Y D++ +++ADLPG+IEGAH+N G+GH FLKHVERT+ L+FVVD+ GF+L S   +T +RSA E + LL +ELE++   LL KPA+ ++NK D PE +E  + +   + N  +L+    +E+ P S + F   +P+SA+TG G+  ++S +R+SL+     E+E +    L +   E
Sbjct:   64 VWVVAKKDLTLKRIKDRYPLKRFVAGVGSNSSIRALKGARGNDVEIPAPVGISITTDNGKILGELNCEGDRILVARGGQGGALHSGFLPSKGQFRQICLDLRLIADLGLVGFPNAGKSSLLTALSHATPQIASYPFTTLRPEIGKVMYEDHKQVSVADLPGLIEGAHMNRGMGHKFLKHVERTRQLMFVVDVRGFQLAS---NTPFRSAFEAVQLLTKELELYKEELLGKPAILVVNKMDLPEAEEKLQELETQLENQEELSQLLPEEMIPSSFVSFKHTVPVSAQTGLGLSRLKSLLRQSLEEQDAVETEEQRTEKLKELRRE 384          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Cavefish
Match: mtg2 (mitochondrial ribosome associated GTPase 2 [Source:NCBI gene;Acc:103039230])

HSP 1 Score: 135.576 bits (340), Expect = 7.278e-36
Identity = 92/290 (31.72%), Postives = 138/290 (47.59%), Query Frame = 1
Query:  193 KAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSGEMIGTVNNQQTMIVCRGGEGGGPSNNFMA------------KPCENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSALETILLLNQELEIFXXXXXXXXXXXXXXXTDKPEGDEIAKFIIDNINDGKLADWKNDEVCPKSLIKFDKIIPISAKTGSGIDEVRSAIRESLD 1026
            +  +G+        G N    YI VP G  V  +   +     + Q  +   GG GG  +  F++            +P E+  + + L+ +A  GLVGFPNAGKSS L  IS     VA+YPFTT++P V  I Y D+  + +AD+PG+I GAH+N G+G  FL+H+ER + LLFV+D+            S  S  E +  L  EL+ + P L  +P + + NK D     E  + +I  +                      ++IP+SA TG G +E+   +RE  D
Sbjct:  130 RGENGESGRSKNCYGRNANPTYIPVPVGTVVKEQGQTVADMALHGQEYVAVHGGAGGKGNRFFLSNENRAPMTATPGEPGEDRVLQLELRTMAHAGLVGFPNAGKSSLLRAISNARPAVASYPFTTLSPHVGIINYRDHEQLAVADIPGLIRGAHLNRGLGVSFLRHIERCRFLLFVLDM------------SSPSPWEQLHHLEYELDQYQPGLSRRPNVIVANKMDLGGARENLEALIGRVG--------------------HRVIPVSALTGHGTEELVLYLRELYD 387          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Cavefish
Match: ola1 (Obg like ATPase 1 [Source:NCBI gene;Acc:103043206])

HSP 1 Score: 63.929 bits (154), Expect = 6.618e-11
Identity = 30/90 (33.33%), Postives = 46/90 (51.11%), Query Frame = 1
Query:  439 IGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYR----------------AITIADLPGIIEGAHVNVGVGHHFLKHV 660
            IG+VG PN GKS+F N ++       N+PF TI P  + +  PD R                 + + D+ G+++GAH   G+G+ FL H+
Sbjct:   25 IGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPIPDERFDFLCQYHKPASKVPAFLNVVDIAGLVKGAHAGQGLGNAFLSHI 114          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Cavefish
Match: drg2 (developmentally regulated GTP binding protein 2 [Source:NCBI gene;Acc:103036155])

HSP 1 Score: 59.3066 bits (142), Expect = 1.956e-9
Identity = 34/104 (32.69%), Postives = 55/104 (52.88%), Query Frame = 1
Query:  433 ADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRS 744
            A + L+GFP+ GKS+FL+ ++    + A+Y FTT+T     I+Y     I + DLPGIIEGA    G G   +       +++ ++D    ++Q + L     S
Sbjct:   63 ARVALIGFPSVGKSTFLSLMTSTESEAASYEFTTLTCIPGVIEYKGAN-IQLLDLPGIIEGAAQGKGRGRQVIAVARTADVVIMMLDATKGEVQRELLEKELES 165          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Cavefish
Match: drg2 (developmentally regulated GTP binding protein 2 [Source:NCBI gene;Acc:103036155])

HSP 1 Score: 58.9214 bits (141), Expect = 2.333e-9
Identity = 34/104 (32.69%), Postives = 55/104 (52.88%), Query Frame = 1
Query:  433 ADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRS 744
            A + L+GFP+ GKS+FL+ ++    + A+Y FTT+T     I+Y     I + DLPGIIEGA    G G   +       +++ ++D    ++Q + L     S
Sbjct:   63 ARVALIGFPSVGKSTFLSLMTSTESEAASYEFTTLTCIPGVIEYKGAN-IQLLDLPGIIEGAAQGKGRGRQVIAVARTADVVIMMLDATKGEVQRELLEKELES 165          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004440.1 (pep scaffold:Pmarinus_7.0:GL476640:93137:105923:-1 gene:ENSPMAG00000004034.1 transcript:ENSPMAT00000004440.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 202.986 bits (515), Expect = 3.399e-62
Identity = 136/346 (39.31%), Postives = 208/346 (60.12%), Query Frame = 1
Query:   37 FDKIKLHLISXXXXXXXXXXXXXXXXXXSIFLMGDKKYKLANILKSYPGYSVKAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSGEMIGTVNNQQTMI-VCRGGEGGGPSNNFMAKPCENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSALETILLLNQELEIFXXXXXXXXXXXXXXXTDKPEGDEIAKFIIDNI-NDGKLADWKNDEVCPKSLIKFDKIIPISAKTGSGIDEVRSAIRESLD----NAALKESESE 1056
            +D ++LH+  G GG G P+ GG+GG GG ++++      L  +    P   + A  G  S+   + G+ G++  I+VP G+ V    G +IG VN+ +  + V  GG GGG + ++   P +   I + LKLIAD+GL+GFPNAGKS+ L  +S    K+A+YPFTT+ PQ+ T+ + D+R I++ADLPG+IEGAH N G+GHHFLKHV+R K+LLFVVD++GF+L  K   T +R A +T+ LL +ELE+++P LL K A+  +NK D P   E  K +   + +           + P     F+ ++P+ A  G G+DE++  +R+ LD     A +K  E +
Sbjct:   16 WDSLRLHVRGGTGGMGLPRLGGEGGPGGDVWVLARPGSSLRQVTDRQPSKRLAAGVGGNSSVRCLKGAKGKDFQIEVPLGISVHTDDGTLIGEVNSPEDRVRVAVGGLGGGLTTDYQPSPGQRRMIRLDLKLIADVGLIGFPNAGKSTLLEKLSSAKPKIADYPFTTLCPQIGTMMFQDHRQISVADLPGLIEGAHANKGMGHHFLKHVQRNKILLFVVDVFGFRLSPK---THFRDAFQTVQLLVKELELYDPDLLGKAAVLAVNKMDLPGAQEKYKQLCHQLMHPQDFLSLLPAGMVPVERFPFEHVLPVVAVQGKGVDELKIGVRKVLDEQQVEAVMKAREEK 358          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005122.1 (pep scaffold:Pmarinus_7.0:GL483372:649:9649:-1 gene:ENSPMAG00000004654.1 transcript:ENSPMAT00000005122.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 1.055e-9
Identity = 31/87 (35.63%), Postives = 51/87 (58.62%), Query Frame = 1
Query:  433 ADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVD 693
            A + L+GFP+ GKS+FL+ ++  + + A+Y FTT+T     I+Y +   I + DLPGIIEGA    G G   +       +++ ++D
Sbjct:   63 ARVALIGFPSVGKSTFLSLVTATASECASYEFTTLTCIPGVIEY-NGANIQLLDLPGIIEGA-ARKGRGRQVIAVARTADVVIMMLD 147          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005006.1 (pep scaffold:Pmarinus_7.0:GL484587:200353:203019:1 gene:ENSPMAG00000004552.1 transcript:ENSPMAT00000005006.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.595 bits (109), Expect = 2.527e-7
Identity = 20/46 (43.48%), Postives = 27/46 (58.70%), Query Frame = 1
Query:  439 IGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYR 576
            IG+VG PN GKS+F N ++       N+PF TI P  + +  PD R
Sbjct:   23 IGIVGLPNVGKSTFFNVLTKSQASAENFPFCTIDPNESRVPIPDPR 68          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Sea Lamprey
Match: gtpbp4 (GTP binding protein 4 [Source:ZFIN;Acc:ZDB-GENE-030131-5982])

HSP 1 Score: 47.7506 bits (112), Expect = 3.083e-6
Identity = 24/56 (42.86%), Postives = 33/56 (58.93%), Query Frame = 1
Query:  445 LVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIE 612
            L G+PN GKSSF+N I+   V+V  Y FTT +  V  + Y  Y    + D PGI++
Sbjct:  173 LCGYPNVGKSSFINKITRADVEVQPYAFTTKSLFVGHMDY-KYLRWQVVDTPGILD 227          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Yeast
Match: MTG2 (Putative GTPase; member of the Obg family; peripheral protein of the mitochondrial inner membrane that associates with the large ribosomal subunit; required for mitochondrial translation, possibly via a role in ribosome assembly [Source:SGD;Acc:S000001211])

HSP 1 Score: 93.2041 bits (230), Expect = 2.950e-21
Identity = 43/93 (46.24%), Postives = 65/93 (69.89%), Query Frame = 1
Query:  421 LKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYP-DYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDI 696
            LK IAD+GL+G PNAGKS+ LN IS    K+ ++ FTT++P + T+         T+AD+PGII+GA ++ G+G  FL+H+ER+   +FV+D+
Sbjct:  336 LKSIADLGLIGLPNAGKSTILNKISNAKPKIGHWQFTTLSPTIGTVSLGFGQDVFTVADIPGIIQGASLDKGMGLEFLRHIERSNGWVFVLDL 428          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Yeast
Match: RBG1 (Member of the DRG family of GTP-binding proteins; associates with translating ribosomes; interacts with Tma46p, Ygr250cp, Gir2p and Yap1p via two-hybrid [Source:SGD;Acc:S000000034])

HSP 1 Score: 63.5438 bits (153), Expect = 1.039e-11
Identity = 35/87 (40.23%), Postives = 51/87 (58.62%), Query Frame = 1
Query:  430 IADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVV 690
            +A +G VGFP+ GKS+ L+ ++G   + A Y FTT+      I+Y   + I + DLPGII+GA    G G   +  V RT  LLF++
Sbjct:   65 VASVGFVGFPSVGKSTLLSKLTGTESEAAEYEFTTLVTVPGVIRYKGAK-IQMLDLPGIIDGAKDGRGRGKQVIA-VARTCNLLFII 149          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Yeast
Match: RBG2 (Protein with a role in translation; forms a complex with Gir2p; has similarity to mammalian developmentally regulated GTP-binding protein [Source:SGD;Acc:S000003405])

HSP 1 Score: 61.6178 bits (148), Expect = 4.820e-11
Identity = 41/116 (35.34%), Postives = 59/116 (50.86%), Query Frame = 1
Query:  433 ADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSALETI-LLLNQE 777
            A + L+G+P+ GKSS L  I+    ++A+Y FTT+T     +KY     I I DLPGII GA    G G   +       L+L V+D      +S+    S    LE + + LN+E
Sbjct:   64 ARVVLIGYPSVGKSSLLGKITTTKSEIAHYAFTTLTSVPGVLKYQGAE-IQIVDLPGIIYGASQGKGRGRQVVATARTADLVLMVLD----ATKSEHQRASLEKELENVGIRLNKE 174          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Yeast
Match: YGR210C_mRNA (Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm [Source:SGD;Acc:S000003442])

HSP 1 Score: 60.8474 bits (146), Expect = 1.006e-10
Identity = 44/142 (30.99%), Postives = 65/142 (45.77%), Query Frame = 1
Query:  439 IGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVAT----------------IKYPDY-------RAITIA--DLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSALETILLLNQELEIF 789
            IG+VG P++GKS+ LN ++     V  +PFTTI P  AT                +  P+Y       R I I   D+ G++ GAH   G+G+ FL  +     L+ VVD+ G      K +  Y   L  I  L  E+ ++
Sbjct:    7 IGIVGKPSSGKSTTLNSLTDAGAAVGAFPFTTIEPNQATGYLQVECACSRFGKEDLCKPNYGWCSKGKRHIPIKLLDVAGLVPGAHSGRGLGNKFLDDLRHADALIHVVDVSGTTDAEGKNTRGY-DPLNDIEWLQDEIRLW 147          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Yeast
Match: OLA1 (P-loop ATPase with similarity to human OLA1 and bacterial YchF; identified as specifically interacting with the proteasome; null mutant displays increased translation rate and increased readthrough of premature stop codons; protein abundance increases in response to hydrogen peroxide and to DNA replication stress [Source:SGD;Acc:S000000229])

HSP 1 Score: 54.6842 bits (130), Expect = 9.003e-9
Identity = 32/104 (30.77%), Postives = 48/104 (46.15%), Query Frame = 1
Query:  442 GLVGFPNAGKSSFLNGISGMSV-KVANYPFTTITPQVATIKYPDYR-----------------AITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIY 699
            G+VG  N GKS+F   I+   +   ANYPF TI P+ A +  P  R                  +T+ D+ G+ +GA    G+G+ FL H+     +  VV  +
Sbjct:   24 GIVGLANVGKSTFFQAITRCPLGNPANYPFATIDPEEARVIVPSPRFDKLCEIYKKTASEVPAHLTVYDIAGLTKGASAGEGLGNAFLSHIRSVDSIYQVVRCF 127          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Nematostella
Match: EDO45794 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRP0])

HSP 1 Score: 146.362 bits (368), Expect = 2.663e-41
Identity = 85/204 (41.67%), Postives = 117/204 (57.35%), Query Frame = 1
Query:  151 KLANILKSYPGYSVKAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSGEMIGTVNNQQT-MIVCRGGEGGGPSNNFMAKPCENVSI-SIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSALET 756
            KL + L   P + + +     S K +  G  G ++ + VP G  V+   G  IG +    T ++V RGG GG PS         N  I  I LKL AD+GLVGFPNAGKS+ L  ++     VA+YPFTT+ P +  +   D   I++ADLPG++EGAH+N G+ H FLKHVE T+LL  VVD+ GF+L S   +   R+A E+
Sbjct:   42 KLPDALNELPHFKLYS-----SLKRRKRGIRGLDLVVPVPPGTTVTTDDGRFIGKLEELGTRLLVARGGRGGNPSTEDWGGEKGNACIIRIDLKLAADVGLVGFPNAGKSTLLGMLTQADPTVADYPFTTLRPVIGMLGQHDDSQISVADLPGLVEGAHLNRGMVHKFLKHVEGTRLLALVVDVNGFQLSS---AHPRRTAFES 237          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Nematostella
Match: EDO46414 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ12])

HSP 1 Score: 138.658 bits (348), Expect = 9.911e-38
Identity = 83/237 (35.02%), Postives = 128/237 (54.01%), Query Frame = 1
Query:  121 SIFLMGDKKYK-LANILKSYPGYSVKAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSGEMIGTVNNQ-QTMIVCRGGEGG------------GPSNNFMAKPCENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSALETILLLNQELEIF 789
            S+ L  D   + LA++ K      +KA +G         G N  ++ +KVP G  ++  + E+I  ++ + ++ ++ +GGEGG             P  +    P +   I + LK IAD+GLVGFPNAGKS+ L  IS  +  VA YPFTT+ P V  ++Y D+  I +AD+PG+I  AH+N G+GH FL+H+ER   LL+V+DI      S+ +S            L +ELE++
Sbjct:   78 SVILSADSSLQELAHVKKH-----LKAENGGSGGIDNRHGKNASDLIVKVPLGT-IATHNKEVIADISEEGESCVIAQGGEGGLGNATFKTATDQAPEKSSQGTPGQERVIELELKTIADVGLVGFPNAGKSTLLRAISRATPTVAAYPFTTLNPSVGMVEYDDFSQIAVADIPGLIPDAHLNKGLGHTFLRHIERCCSLLYVLDISQKDFHSQFIS------------LQRELELY 296          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Nematostella
Match: EDO29246 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T467])

HSP 1 Score: 128.257 bits (321), Expect = 2.457e-34
Identity = 63/184 (34.24%), Postives = 109/184 (59.24%), Query Frame = 1
Query:  196 APDGKESTKTQILGSNGENIYIKVPAGVDVS-LKSGEMI-GTVNNQQTMIVCRGGEGG------------GPSNNFMAKPCENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGF 705
            A  G+    + + G+ G +I +++P G  +S  ++GE++   +   + + + +GG+GG             P       P E  ++ + LK++AD+GL+G PNAGKS+F+  +S    K+A+YPFTT+ P +  ++    ++  +AD+PG+IEGA    G+GH FL+H++RT+LLL VVD+  F
Sbjct:   43 ATRGEHGKGSDMFGAAGNDITLRMPVGTIISDAETGEVLYELLTAGEVVTIAKGGDGGYGNLRFKSAINRAPRQKTPGWPGERKNLKLELKVLADVGLLGMPNAGKSTFIAAVSNARPKIADYPFTTLHPNLGVVRVAAEQSFVVADIPGLIEGASEGAGLGHQFLRHLQRTRLLLHVVDLAPF 226          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Nematostella
Match: EDO39890 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8U7])

HSP 1 Score: 67.781 bits (164), Expect = 1.357e-12
Identity = 39/86 (45.35%), Postives = 52/86 (60.47%), Query Frame = 1
Query:  433 ADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVV 690
            A IG VGFP+ GKS+ L  ++G+  +VA Y FTT+T     I+Y   + I + DLPGIIEGA    G G   +  V RT  L+F+V
Sbjct:   63 ARIGFVGFPSVGKSTLLTNLAGVYSEVAAYEFTTLTTVPGVIRYKGAK-IQLLDLPGIIEGAKDGKGRGRQVIA-VARTCSLIFIV 146          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Nematostella
Match: EDO47586 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLD7])

HSP 1 Score: 60.077 bits (144), Expect = 4.270e-10
Identity = 36/105 (34.29%), Postives = 52/105 (49.52%), Query Frame = 1
Query:  433 ADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSA 747
            A + L+GFP+ GKS+ L  ++      A+Y FTT+T     I Y +   I + DLPGIIEGA    G G   +       L+L ++D    ++Q K L     S 
Sbjct:   64 ARVALIGFPSVGKSTLLTKLTQTQSACASYEFTTLTCIPGVINY-NGANIQLLDLPGIIEGAAQGKGRGRQVIAVARTADLVLMMLDASKGEIQKKLLEKELESC 167          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Medaka
Match: gtpbp10 (GTP binding protein 10 [Source:NCBI gene;Acc:101172104])

HSP 1 Score: 229.18 bits (583), Expect = 4.456e-71
Identity = 148/353 (41.93%), Postives = 221/353 (62.61%), Query Frame = 1
Query:    7 ISKIIFQK--EFFDKIKLHLISXXXXXXXXXXXXXXXXXXSIFLMGDKKYKLANILKSYPGYSVKAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSGEMIGTVNNQ-QTMIVCRGGEGGGPSNNFMAKPCENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSALETILLLNQELEIFXXXXXXXXXXXXXXXTDKPEG-DEIAKFIIDNINDGKLADWKNDEVCPKSLIKFDKIIPISAKTGSGIDEVRSAIRESLD-NAALKESE 1050
            IS+I  +K   F D ++L++  G GG G P+ GG+GGNGG ++++      L  I   YP        G  S+   + G  G ++ +  P G+ V+   G ++G +N +   ++V +GG GG   + F     +   I + LKLIAD+GLVGFPNAGKSS L  +S  + ++A+Y FTT+ P++  + YPDY+ I+IADLPG+IEGA++N G+GH FLKHVERTK LLFVVD+ GF+L SK   T +RSA E + LL +ELE++   + +KPAL ++NK D P+  D++A+      N  + +D    ++ PK+ + F  ++P+SA TG GID ++S IR+SLD  A LK S+
Sbjct:   72 ISRICLRKYGNFVDNLRLYVRGGGGGMGLPRLGGQGGNGGDVWVVAKNNMTLKRIKDKYPLKRFVGGSGGNSSVRALKGEKGTDVEVPAPVGIAVTTDDGRIVGDLNEEGDRVLVAKGGSGGSLYSAFEPTKGQAKHIRLDLKLIADLGLVGFPNAGKSSLLAALSNATPQIASYAFTTLRPEIGKVMYPDYKQISIADLPGLIEGAYMNKGMGHKFLKHVERTKQLLFVVDVCGFQLASK---TPFRSAFEAVQLLIKELELYKEEVASKPALLVVNKMDLPDAEDKLAELKEQLKNPEEFSDLLPGDMIPKNYMTFRHVVPVSAMTGLGIDHLKSCIRQSLDEEATLKSSD 421          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Medaka
Match: mtg2 (mitochondrial ribosome associated GTPase 2 [Source:NCBI gene;Acc:101155109])

HSP 1 Score: 132.109 bits (331), Expect = 1.644e-34
Identity = 96/314 (30.57%), Postives = 147/314 (46.82%), Query Frame = 1
Query:  124 IFLMGDKKYK-LANILKSYPGYSVKAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSGEMIGTVNNQQTMIVCRGGEGGGPSNNFM---------AKPC---ENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSALETILLLNQELEIFXXXXXXXXXXXXXXXTDKPEGDEIAKFIIDNINDGKLADWKNDEVCPKSLIKFDKIIPISAKTGSGIDEVRSAIRESLD 1026
            I +  D+  K LA ++  Y     K  +G+        G NG+  YI VP G  V      +     + Q  +   GG GG  +  F+         A P    +   + + L+ +A  GL+GFPNAGKSS L  IS     VA YPFTT+ P V  ++Y D+  + +AD+PGII GAH+N G+G  FL+H+ER + LLFV+D+   +  ++     Y            EL+ ++P L  +P   + NK D PE  E  + + +++                      ++IP+SA TG   +E+   +RE  D
Sbjct:  130 IIIKADRFVKSLAQVVPVY-----KGDNGEAGGSKNCYGRNGKTTYISVPLGTVVKELGNTVADLAEHGQEFLAAFGGTGGKGNRFFLTNENRAPMTATPGMDGQERVLQLELRTMAHAGLIGFPNAGKSSLLRAISNARPAVAAYPFTTLNPHVGIVQYRDHEQVAVADIPGIIRGAHLNRGLGISFLRHIERCRFLLFVLDLSAPEPWTQLQHLCY------------ELDKYDPGLSQRPQAVVANKMDLPEAREKLEILKNSVT--------------------QRVIPVSALTGENTEELILHLRELYD 406          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Medaka
Match: drg1 (developmentally regulated GTP binding protein 1 [Source:NCBI gene;Acc:101174442])

HSP 1 Score: 67.3958 bits (163), Expect = 4.333e-12
Identity = 36/88 (40.91%), Postives = 52/88 (59.09%), Query Frame = 1
Query:  433 ADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDI 696
            A +G VGFP+ GKS+ L+ ++G+  +VA Y FTT+T     I+Y   + I + DLPGIIEGA    G G   +       L+L V+D+
Sbjct:   64 ARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLTTVPGVIRYKGAK-IQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLILIVLDV 150          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Medaka
Match: OLA1 (Obg like ATPase 1 [Source:NCBI gene;Acc:101161102])

HSP 1 Score: 65.855 bits (159), Expect = 1.552e-11
Identity = 31/90 (34.44%), Postives = 47/90 (52.22%), Query Frame = 1
Query:  439 IGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRA----------------ITIADLPGIIEGAHVNVGVGHHFLKHV 660
            IG+VG PN GKS+F N ++       N+PF TI P  + +  PD R                 + + D+ G+++GAHV  G+G+ FL H+
Sbjct:   23 IGIVGLPNVGKSTFFNVLTKSEAAAENFPFCTIDPNESRVPIPDERYDFLCQFHKPASKVPAFLNVVDIAGLVKGAHVGQGLGNAFLSHI 112          
BLAST of GTP-binding protein 10 homolog vs. Ensembl Medaka
Match: OLA1 (Obg like ATPase 1 [Source:NCBI gene;Acc:101161102])

HSP 1 Score: 65.4698 bits (158), Expect = 2.433e-11
Identity = 31/90 (34.44%), Postives = 47/90 (52.22%), Query Frame = 1
Query:  439 IGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRA----------------ITIADLPGIIEGAHVNVGVGHHFLKHV 660
            IG+VG PN GKS+F N ++       N+PF TI P  + +  PD R                 + + D+ G+++GAHV  G+G+ FL H+
Sbjct:   25 IGIVGLPNVGKSTFFNVLTKSEAAAENFPFCTIDPNESRVPIPDERYDFLCQFHKPASKVPAFLNVVDIAGLVKGAHVGQGLGNAFLSHI 114          
BLAST of GTP-binding protein 10 homolog vs. Planmine SMEST
Match: SMESG000039624.1 (SMESG000039624.1)

HSP 1 Score: 664.455 bits (1713), Expect = 0.000e+0
Identity = 368/369 (99.73%), Postives = 368/369 (99.73%), Query Frame = 1
Query:    1 MKISKIIFQKEFFDKIKLHLISXXXXXXXXXXXXXXXXXXSIFLMGDKKYKLANILKSYPGYSVKAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSGEMIGTVNNQQTMIVCRGGEGGGPSNNFMAKPCENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSALETILLLNQELEIFXXXXXXXXXXXXXXXTDKPEGDEIAKFIIDNINDGKLADWKNDEVCPKSLIKFDKIIPISAKTGSGIDEVRSAIRESLDNAALKESESECDADLDQYFTETMQPFV 1107
            MKISKIIFQKEFFDKIKLHLISGNGGNGNPKYGGKGGNGGSIFLMGDKKYKLANILKSYPGYSVKAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSGEMIGTVNNQQTMIVCRGGEGGGPSNNFMAKPCENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSALETILLLNQELEIFNPLLLNKPALCLLNKTDKPEGDEIAKFIIDNINDGKL DWKNDEVCPKSLIKFDKIIPISAKTGSGIDEVRSAIRESLDNAALKESESECDADLDQYFTETMQPFV
Sbjct:    1 MKISKIIFQKEFFDKIKLHLISGNGGNGNPKYGGKGGNGGSIFLMGDKKYKLANILKSYPGYSVKAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSGEMIGTVNNQQTMIVCRGGEGGGPSNNFMAKPCENVSISIILKLIADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSALETILLLNQELEIFNPLLLNKPALCLLNKTDKPEGDEIAKFIIDNINDGKLVDWKNDEVCPKSLIKFDKIIPISAKTGSGIDEVRSAIRESLDNAALKESESECDADLDQYFTETMQPFV 369          
BLAST of GTP-binding protein 10 homolog vs. Planmine SMEST
Match: SMESG000000525.1 (SMESG000000525.1)

HSP 1 Score: 67.781 bits (164), Expect = 2.202e-12
Identity = 37/87 (42.53%), Postives = 52/87 (59.77%), Query Frame = 1
Query:  433 ADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVD 693
            A IG VGFP+ GKS+ L+ ++G+  +VA+Y FTT+T     IKY   + I + DLPGIIEGA    G G   +       ++L V+D
Sbjct:   63 ARIGFVGFPSVGKSTLLSNLAGVYSEVADYEFTTLTTVPGVIKYNGAK-IQLLDLPGIIEGAKDGKGRGKQVIAVARTCTMILMVLD 148          
BLAST of GTP-binding protein 10 homolog vs. Planmine SMEST
Match: SMESG000061866.1 (SMESG000061866.1)

HSP 1 Score: 63.929 bits (154), Expect = 5.301e-11
Identity = 29/103 (28.16%), Postives = 52/103 (50.49%), Query Frame = 1
Query:  439 IGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYR----------------AITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIY 699
            +G+VG PN GKS+F N ++       N+PF TI P  + +  PD R                 +++ D+ G+++GAH   G+G+ FL H+     +  ++ ++
Sbjct:   24 VGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVF 126          
BLAST of GTP-binding protein 10 homolog vs. Planmine SMEST
Match: SMESG000025280.1 (SMESG000025280.1)

HSP 1 Score: 59.3066 bits (142), Expect = 1.580e-9
Identity = 32/87 (36.78%), Postives = 48/87 (55.17%), Query Frame = 1
Query:  433 ADIGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVD 693
            A + L+GFP+ GKS+ L+ ++    + A+Y FTT+T     I+Y     I + DLPGIIEGA    G G   +       L+L ++D
Sbjct:   63 ARVALIGFPSVGKSTLLSMLTKTESETASYEFTTLTCIPGVIEYKGAN-IQLLDLPGIIEGASQGKGRGRQVIAVARTADLILMMLD 148          
The following BLAST results are available for this feature:
BLAST of GTP-binding protein 10 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GTPBP109.036e-7241.14GTP binding protein 10 [Source:HGNC Symbol;Acc:HGN... [more]
GTPBP105.629e-5145.75GTP binding protein 10 [Source:HGNC Symbol;Acc:HGN... [more]
GTPBP105.068e-3740.23GTP binding protein 10 [Source:HGNC Symbol;Acc:HGN... [more]
GTPBP105.916e-3740.23GTP binding protein 10 [Source:HGNC Symbol;Acc:HGN... [more]
MTG28.391e-3335.35mitochondrial ribosome associated GTPase 2 [Source... [more]
back to top
BLAST of GTP-binding protein 10 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C26E6.126.743e-4434.75pep chromosome:WBcel235:III:4930602:4932253:-1 gen... [more]
M01E5.22.443e-3030.72pep chromosome:WBcel235:I:13277300:13280175:-1 gen... [more]
M01E5.22.443e-3030.72pep chromosome:WBcel235:I:13277061:13280175:-1 gen... [more]
T28D6.66.109e-1342.86pep chromosome:WBcel235:III:11326654:11343108:-1 g... [more]
C02F5.33.203e-936.78Uncharacterized GTP-binding protein C02F5.3 [Sour... [more]
back to top
BLAST of GTP-binding protein 10 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG106282.822e-7143.17gene:FBgn0032818 transcript:FBtr0081323[more]
CG133902.413e-3338.59gene:FBgn0032031 transcript:FBtr0079723[more]
128up7.401e-1245.35gene:FBgn0010339 transcript:FBtr0087976[more]
CG61954.144e-1037.93gene:FBgn0038723 transcript:FBtr0083803[more]
CG13541.042e-932.22gene:FBgn0030151 transcript:FBtr0089385[more]
back to top
BLAST of GTP-binding protein 10 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gtpbp103.876e-7543.06GTP-binding protein 10 (putative) [Source:NCBI gen... [more]
mtg21.385e-3236.46mitochondrial ribosome-associated GTPase 2 [Source... [more]
drg13.259e-1242.05developmentally regulated GTP binding protein 1 [S... [more]
CABZ01035356.17.364e-1127.87obg-like ATPase 1 [Source:NCBI gene;Acc:110438478][more]
ola14.970e-1032.22Obg-like ATPase 1 [Source:NCBI gene;Acc:326864][more]
back to top
BLAST of GTP-binding protein 10 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gtpbp101.031e-6041.49GTP-binding protein 10 (putative) [Source:NCBI gen... [more]
gtpbp101.053e-6041.36GTP-binding protein 10 (putative) [Source:NCBI gen... [more]
gtpbp101.535e-6041.49GTP-binding protein 10 (putative) [Source:NCBI gen... [more]
gtpbp101.899e-6041.49GTP-binding protein 10 (putative) [Source:NCBI gen... [more]
gtpbp102.266e-6041.49GTP-binding protein 10 (putative) [Source:NCBI gen... [more]
back to top
BLAST of GTP-binding protein 10 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gtpbp106.535e-6939.31GTP-binding protein 10 (putative) [Source:MGI Symb... [more]
Gtpbp101.308e-4844.93GTP-binding protein 10 (putative) [Source:MGI Symb... [more]
Mtg21.251e-3137.38mitochondrial ribosome associated GTPase 2 [Source... [more]
Mtg21.251e-3137.38mitochondrial ribosome associated GTPase 2 [Source... [more]
Gtpbp103.253e-2858.62GTP-binding protein 10 (putative) [Source:MGI Symb... [more]
back to top
BLAST of GTP-binding protein 10 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DHF7|GTPBA_DANRE2.926e-7443.06GTP-binding protein 10 OS=Danio rerio OX=7955 GN=g... [more]
sp|Q3MHG6|GTPBA_BOVIN4.515e-7343.27GTP-binding protein 10 OS=Bos taurus OX=9913 GN=GT... [more]
sp|A4D1E9|GTPBA_HUMAN4.339e-7141.14GTP-binding protein 10 OS=Homo sapiens OX=9606 GN=... [more]
sp|Q29K06|GTPBA_DROPS1.378e-7045.56GTP-binding protein 10 homolog OS=Drosophila pseud... [more]
sp|Q9I7M2|GTPBA_DROME2.829e-7043.17GTP-binding protein 10 homolog OS=Drosophila melan... [more]
back to top
BLAST of GTP-binding protein 10 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7TXN33.709e-8347.18OBG-type G domain-containing protein OS=Capitella ... [more]
V3ZZC44.119e-8345.87OBG-type G domain-containing protein OS=Lottia gig... [more]
H9J0002.873e-8046.84OBG-type G domain-containing protein OS=Bombyx mor... [more]
A0A2H1VXB91.519e-7847.71SFRICE_001850 OS=Spodoptera frugiperda OX=7108 GN=... [more]
A0A2A4J3Y81.069e-7745.69OBG-type G domain-containing protein OS=Heliothis ... [more]
back to top
BLAST of GTP-binding protein 10 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gtpbp101.776e-6738.27GTP-binding protein 10 (putative) [Source:NCBI gen... [more]
mtg27.278e-3631.72mitochondrial ribosome associated GTPase 2 [Source... [more]
ola16.618e-1133.33Obg like ATPase 1 [Source:NCBI gene;Acc:103043206][more]
drg21.956e-932.69developmentally regulated GTP binding protein 2 [S... [more]
drg22.333e-932.69developmentally regulated GTP binding protein 2 [S... [more]
back to top
BLAST of GTP-binding protein 10 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000004440.13.399e-6239.31pep scaffold:Pmarinus_7.0:GL476640:93137:105923:-1... [more]
ENSPMAT00000005122.11.055e-935.63pep scaffold:Pmarinus_7.0:GL483372:649:9649:-1 gen... [more]
ENSPMAT00000005006.12.527e-743.48pep scaffold:Pmarinus_7.0:GL484587:200353:203019:1... [more]
gtpbp43.083e-642.86GTP binding protein 4 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
back to top
BLAST of GTP-binding protein 10 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MTG22.950e-2146.24Putative GTPase; member of the Obg family; periphe... [more]
RBG11.039e-1140.23Member of the DRG family of GTP-binding proteins; ... [more]
RBG24.820e-1135.34Protein with a role in translation; forms a comple... [more]
YGR210C_mRNA1.006e-1030.99Putative protein of unknown function; green fluore... [more]
OLA19.003e-930.77P-loop ATPase with similarity to human OLA1 and ba... [more]
back to top
BLAST of GTP-binding protein 10 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO457942.663e-4141.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO464149.911e-3835.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO292462.457e-3434.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398901.357e-1245.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO475864.270e-1034.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GTP-binding protein 10 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gtpbp104.456e-7141.93GTP binding protein 10 [Source:NCBI gene;Acc:10117... [more]
mtg21.644e-3430.57mitochondrial ribosome associated GTPase 2 [Source... [more]
drg14.333e-1240.91developmentally regulated GTP binding protein 1 [S... [more]
OLA11.552e-1134.44Obg like ATPase 1 [Source:NCBI gene;Acc:101161102][more]
OLA12.433e-1134.44Obg like ATPase 1 [Source:NCBI gene;Acc:101161102][more]
back to top
BLAST of GTP-binding protein 10 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000039624.10.000e+099.73SMESG000039624.1[more]
SMESG000000525.12.202e-1242.53SMESG000000525.1[more]
SMESG000061866.15.301e-1128.16SMESG000061866.1[more]
SMESG000025280.11.580e-936.78SMESG000025280.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002997 ID=SMED30002997|Name=GTP-binding protein 10 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=1115bp
ATGAAAATATCAAAAATTATTTTTCAAAAGGAGTTTTTTGACAAAATTAA
ATTACATCTAATTAGTGGAAATGGAGGAAATGGCAATCCTAAATATGGTG
GGAAAGGTGGTAATGGTGGTAGTATATTTTTGATGGGTGATAAAAAGTAT
AAGTTGGCAAATATTTTGAAGAGTTATCCTGGATACAGTGTTAAGGCTCC
TGATGGAAAAGAGTCGACGAAAACTCAAATATTAGGTTCTAACGGAGAAA
ATATATATATAAAAGTACCTGCTGGTGTAGATGTTTCACTCAAATCAGGT
GAAATGATTGGAACAGTAAATAACCAACAAACCATGATAGTTTGTAGAGG
TGGTGAAGGCGGTGGACCATCAAACAATTTTATGGCAAAACCATGTGAAA
ATGTTTCTATTTCTATAATTTTAAAATTGATTGCTGACATTGGGCTCGTT
GGATTTCCCAATGCAGGAAAGTCATCCTTTCTTAATGGAATATCTGGAAT
GTCAGTGAAAGTAGCAAATTATCCATTTACAACAATCACGCCTCAAGTTG
CTACTATTAAGTATCCTGATTATAGAGCAATAACTATAGCTGATTTACCA
GGTATAATCGAAGGTGCCCATGTTAATGTAGGTGTTGGACACCATTTTTT
AAAGCACGTTGAAAGAACGAAATTGTTGTTATTTGTAGTAGACATATACG
GATTCAAACTGCAATCCAAGAAATTAAGTACATCATATCGTTCTGCACTT
GAAACTATTCTATTACTCAATCAAGAACTGGAAATATTCAACCCACTTTT
ACTAAATAAACCAGCTTTATGCTTACTGAACAAAACAGACAAACCCGAAG
GCGATGAAATAGCAAAATTCATCATAGACAACATCAACGACGGGAAATTA
GCGGATTGGAAAAATGACGAAGTCTGTCCGAAATCATTAATCAAATTCGA
TAAAATTATTCCGATTAGTGCAAAAACAGGCTCAGGAATCGATGAAGTTC
GCTCTGCTATCAGGGAGTCATTGGATAATGCTGCTTTGAAGGAGTCGGAA
AGCGAATGTGATGCTGATCTAGATCAGTATTTCACCGAAACAATGCAACC
ATTTGTTTAAAAAAA
back to top

protein sequence of SMED30002997-orf-1

>SMED30002997-orf-1 ID=SMED30002997-orf-1|Name=SMED30002997-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=370bp
MKISKIIFQKEFFDKIKLHLISGNGGNGNPKYGGKGGNGGSIFLMGDKKY
KLANILKSYPGYSVKAPDGKESTKTQILGSNGENIYIKVPAGVDVSLKSG
EMIGTVNNQQTMIVCRGGEGGGPSNNFMAKPCENVSISIILKLIADIGLV
GFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYRAITIADLP
GIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIYGFKLQSKKLSTSYRSAL
ETILLLNQELEIFNPLLLNKPALCLLNKTDKPEGDEIAKFIIDNINDGKL
ADWKNDEVCPKSLIKFDKIIPISAKTGSGIDEVRSAIRESLDNAALKESE
SECDADLDQYFTETMQPFV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
GO:0005525GTP binding
GO:0000287magnesium ion binding
GO:0003924GTPase activity
GO:0000166nucleotide binding
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
GO:0005634nucleus
GO:0005730nucleolus
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
GO:0042254ribosome biogenesis
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR006073GTP_binding_domain
IPR027417P-loop_NTPase
IPR014100GTP-bd_Obg/CgtA
IPR006169GTP1_OBG_dom
IPR031167G_OBG