SMED30002984

Overview
NameSMED30002984
Smed IDSMED30002984
Length (bp)491
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002984

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30002984SMESG000064314.1 SmedASXL_017252SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30002984SMESG000064314.1 Contig53784newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002984SMESG000064314.1 Contig53784uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002984SMESG000064303.1 SMESG000064314.1 Contig19558newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002984SMESG000064303.1 SMESG000064314.1 Contig19558uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
reproductive organSMED30002984SMESG000064314.1 Contig53784newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30002984SMESG000064314.1 Contig53784uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30002984 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000055:316069..318259 -2176
v31.000055:318247..318749 -1581
v31.000055:317263..318506 -1469
v31.000055:315946..316451 -1104
v31.000055:316194..317399 -865
Homology
BLAST of SMED30002984 vs. Planmine SMEST
Match: SMESG000064314.1 (SMESG000064314.1)

HSP 1 Score: 237.269 bits (604), Expect = 1.169e-72
Identity = 134/163 (82.21%), Postives = 144/163 (88.34%), Query Frame = 3
Query:    3 DHSANPNESEPFKSNINEVDDGELKQQELVSNVDKKVHSADPNENEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFV 491
            DHS + N+ E  K  I E+D+ E    + V+ VD+  HSA+ N++EPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDE ETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFV
Sbjct: 2096 DHSDDQNDGELAKQIIIEIDEVEKNILDQVNVVDETDHSANSNKSEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDERETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFV 2258          

HSP 2 Score: 179.104 bits (453), Expect = 2.251e-52
Identity = 108/163 (66.26%), Postives = 129/163 (79.14%), Query Frame = 3
Query:   15 NPNESEPFKSNINEVDDGELKQQEL----VSNVDKKVHSADPNENEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFV 491
            NPN SE    NI +V++   KQ+++    V+NVD++ +S D NE   +E  + EV   +  Q ++V+ +  SK+D+ D S++LNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNII VDVDKRNISEKVNLDEVSKVDEIDQFV
Sbjct: 1370 NPNRSELADHNIIKVEEETKKQEQINLEEVTNVDERDYSVDQNEITLTEPIMKEVYNVENIQIQRVNSEENSKLDETDHSVDLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIGVDVDKRNISEKVNLDEVSKVDEIDQFV 1532          

HSP 3 Score: 126.716 bits (317), Expect = 3.955e-34
Identity = 85/165 (51.52%), Postives = 114/165 (69.09%), Query Frame = 3
Query:    6 HSANPNESEPFKSNINEVDDGELKQQELV-----SNVDKKVHSADPNENEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQ 485
            HSA+ NE+EP + NINEVD+GE KQQE V     S V++K +S DPNE E ++  I E+D+ +      V++D VSKVD+K  S +  ESE +E NI+EVDEGE KQ EQ N EEV  V+  D+S +PN+ EL E +IIE+D  + NI++ VN+DEVSKV+E D 
Sbjct: 2988 HSADLNENEPSEYNINEVDEGEPKQQEQVNPEGVSKVNEKDNSYDPNECELAQHNITEIDQGENNIADSVNVDEVSKVDEKYHSADSKESEPSEDNINEVDEGEPKQQEQFNPEEVLKVNKKDNSDDPNQSELVESHIIEIDQGENNIADHVNVDEVSKVEETDH 3152          

HSP 4 Score: 124.405 bits (311), Expect = 2.988e-33
Identity = 88/167 (52.69%), Postives = 114/167 (68.26%), Query Frame = 3
Query:    6 HSANPNESEPFKSNINEVDDGELKQQEL-----VSNVDKKVHSADPNENEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFV 491
            HSA+  ESEP + NINEVD+GE KQQE      V  V+KK +S DPN++E  ES I E+D+ +      V++D VSKV++ D + NLNESE  ESNI EVDEGE KQ EQVN EEVS V+    SG+ NE E+ E NI  V   + +ISE+ N++E+SK+DEID+ V
Sbjct: 3070 HSADSKESEPSEDNINEVDEGEPKQQEQFNPEEVLKVNKKDNSDDPNQSELVESHIIEIDQGENNIADHVNVDEVSKVEETDHTGNLNESEPYESNIKEVDEGEPKQQEQVNPEEVSKVNEKGDSGDTNESEIVEPNIKNVYEGETDISEEPNVNELSKIDEIDRSV 3236          

HSP 5 Score: 122.479 bits (306), Expect = 1.180e-32
Identity = 85/166 (51.20%), Postives = 111/166 (66.87%), Query Frame = 3
Query:    3 DHSANPNESEPFKSNINEVDDGELKQQEL-----VSNVDKKVHSADPNENEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQ 485
            DHS + NES+P +SNI EVDDGE  QQE      VSNVDK  HS D NE+E +   I ++D    K +K + LD V+ + K D S++ N+ +LAE NI+EVD GE KQ EQVNS+EVS VD+ D S + NE EL E N+IE+D  ++NISEK N+ E+  V+E D 
Sbjct: 1937 DHSVDTNESKPVESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELANQNIIKID----KGEKNI-LDQVNVLYKTDHSVDPNKIKLAEFNINEVDNGEPKQQEQVNSDEVSKVDVKDKSVDTNESELCEPNVIEIDEVEKNISEKSNVKELLNVNETDH 2097          

HSP 6 Score: 120.168 bits (300), Expect = 7.205e-32
Identity = 82/154 (53.25%), Postives = 111/154 (72.08%), Query Frame = 3
Query:    3 DHSANPNESEPFKSNINEVDDGELKQQEL----VSNVDKKVHSADPNENEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNL 452
            D S + NE+EP +SNIN+VD+ E  Q++L    VS V +K  S DPNE++  E  I +VDE + KQ K+++LD VSK+D+ D S++ NES+  ESNI EVD+GE  Q EQVNSEEVSNVD T HS + NE ELA QNII++D  ++NI ++VN+
Sbjct: 1857 DPSVDLNENEPTESNINKVDEEETTQEQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEDEKKQHKQINLD-VSKLDETDHSVDTNESKPVESNIIEVDDGEWTQQEQVNSEEVSNVDKTYHSVDQNESELANQNIIKIDKGEKNILDQVNV 2009          

HSP 7 Score: 115.931 bits (289), Expect = 2.436e-30
Identity = 87/207 (42.03%), Postives = 117/207 (56.52%), Query Frame = 3
Query:    3 DHSANPNESEPFKSNINEVDDGELKQQELV----------------------------------------------SNVDKKVHSADPNENEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQ 485
            D   +PNESE  +SNIN+VD+GE KQQE V                                              S VD+  HS  PN++EP+ES IN+VDE + KQQ++V+ D V  VD KD+S+N +ESEL E N  E+ E +    E+ N +E+  V  T+HS + NE EL EQNIIE+D  ++NIS++VN+DE+SKVDEID 
Sbjct: 2255 DQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVFELENSVILNENTLTEPIKKEVDNVENIQNVHANSEEESKVDETDHSIFPNQSEPAESNINKVDEEETKQQEQVNSDEVINVDVKDKSVNPDESELGEPNCIEIVEVDKNISEESNVKELLKVTETNHSVDQNEGELDEQNIIEIDKSEKNISDQVNVDELSKVDEIDH 2461          

HSP 8 Score: 114.775 bits (286), Expect = 6.534e-30
Identity = 79/166 (47.59%), Postives = 109/166 (65.66%), Query Frame = 3
Query:    3 DHSANPNESEPFKSNINEVDDGELKQQE-----LVSNVDKKVHSADPNENEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQ 485
            DHS +PNESEP  SNINE+  GE    +      VS  D+  HS DPN++EP +S INE++       KK++LD V KVD+ + S++ NE E+ ESNI  V+EG+T   E+ N  E S +D  D S +PN+ EL+E  IIE+D  ++NIS+ VN+DEVSKV+E D+
Sbjct: 2663 DHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSVDPNKSEPGKSYINEIEGE--ITHKKINLDEVPKVDENNDSVDPNEIEIVESNIENVEEGKTNLSEESNINESSTIDEPDLSVDPNKSELSEHYIIEIDQVEKNISDPVNVDEVSKVEETDR 2826          

HSP 9 Score: 114.005 bits (284), Expect = 1.213e-29
Identity = 86/167 (51.50%), Postives = 113/167 (67.66%), Query Frame = 3
Query:    6 HSANPNESEPFKSNINEVDDGELKQQ-----ELVSNVDKKVHSADPNENEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFV 491
            +SA+PNESEP +SNINEVD  E KQQ     E VSNVDK  HSAD NE++ +E  I EVD  +    ++ +L+ VS V + D S++LNE+E  ESNI++VDE ET Q EQ+ SEEVS V   D S +PNE +  E NI +VD D++   +++NLD VSK+DE D  V
Sbjct: 1776 YSADPNESEPAESNINEVDKAERKQQKKIDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEEVSNVFETDPSVDLNENEPTESNINKVDEEETTQ-EQLISEEVSKVGEKDVSVDPNESDFVEHNIKKVDEDEKKQHKQINLD-VSKLDETDHSV 1940          

HSP 10 Score: 113.62 bits (283), Expect = 1.530e-29
Identity = 81/163 (49.69%), Postives = 107/163 (65.64%), Query Frame = 3
Query:    3 DHSANPNESEPFKSNINEVDDGELKQQELV-----SNVDKKVHSADPNENEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDE 476
            D+S +PNE E  + NI E+D GE    + V     S VD+K HSAD  E+EPSE  INEVDE + KQQ++ + + V KV+KKD S + N+SEL ES+I E+D+GE    + VN +EVS V+ TDH+G  NE E  E NI EVD  +    E+VN +EVSKV+E
Sbjct: 3028 DNSYDPNECELAQHNITEIDQGENNIADSVNVDEVSKVDEKYHSADSKESEPSEDNINEVDEGEPKQQEQFNPEEVLKVNKKDNSDDPNQSELVESHIIEIDQGENNIADHVNVDEVSKVEETDHTGNLNESEPYESNIKEVDEGEPKQQEQVNPEEVSKVNE 3190          

HSP 11 Score: 112.464 bits (280), Expect = 4.520e-29
Identity = 85/165 (51.52%), Postives = 107/165 (64.85%), Query Frame = 3
Query:    3 DHSANPNESEPFKSNINEVDDGELKQQELV-----SNVDKKVHSADPNENEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEID 482
            DHS N NE    +    E+D  E  Q + V     S +D+K +SADPNE+EP+ES INEVD+A+ KQQKK+DL+ VS VDK D S + NES+LAE NI EVD GE    EQ N EEVSNV  TD S + NE+E  E NI +VD ++    E++  +EVSKV E D
Sbjct: 1734 DHSVNLNEKTLTEPITKEIDKNEQTQTDHVISEEKSKLDEKYYSADPNESEPAESNINEVDKAERKQQKKIDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEEVSNVFETDPSVDLNENEPTESNINKVD-EEETTQEQLISEEVSKVGEKD 1897          

HSP 12 Score: 110.923 bits (276), Expect = 1.514e-28
Identity = 77/163 (47.24%), Postives = 107/163 (65.64%), Query Frame = 3
Query:    3 DHSANPNESEPFKSNINEVDDGELKQQEL-----VSNVDKKVHSADPNENEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDE 476
            D S +PNE E  + NI  +D+GE    E      +S +D+   S  PNE++ +E  I E+D++       V+L+ +SKVD+K  S +LNE+E +E NI+EVDEGE KQ EQVN E VS V+  D+S +PNE ELA+ NI E+D  + NI++ VN+DEVSKVDE
Sbjct: 2905 DDSVDPNEREIVQPNIKCLDEGETNISEESNVNELSKIDEIDRSVYPNESKLAEHYIIEIDQSKNNITDPVNLNEISKVDEKGHSADLNENEPSEYNINEVDEGEPKQQEQVNPEGVSKVNEKDNSYDPNECELAQHNITEIDQGENNIADSVNVDEVSKVDE 3067          

HSP 13 Score: 110.538 bits (275), Expect = 1.620e-28
Identity = 84/165 (50.91%), Postives = 109/165 (66.06%), Query Frame = 3
Query:    3 DHSANPNESEPFKSNINEVDDGELKQQELV-----SNVDKKVHSADPNENEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEID 482
            D S + NESEP +S INEVD+GE KQQE V     S V++K +S DPNE+  +E  I E+D+        V+L+ +SKVD++D S +LNE+E +ESNI+EVDEGE KQ EQVN E VS V+  D+S +P+E E AE NI E   +  N  EK NL E SK+ E D
Sbjct: 3324 DDSGDSNESEPSESYINEVDEGEPKQQEQVNPEEVSKVNEKDNSYDPNESGLAEYYIVEIDQGKNNITDPVNLNEISKVDEEDHSADLNENEPSESNINEVDEGEPKQQEQVNPEGVSKVNEKDNSNDPSEIEPAESNINEFGGEMTN--EKFNLVEASKIFEKD 3486          

HSP 14 Score: 109.768 bits (273), Expect = 3.650e-28
Identity = 80/164 (48.78%), Postives = 109/164 (66.46%), Query Frame = 3
Query:    3 DHSANPNESEPFKSNINEVDDGELKQQEL----VSNVDKKVHSADPNENEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEID 482
            DHSA+  E EP +SNINE  + E+ Q++     +S V +K  S D NE+EPSES INEVDE + KQQ++V+ + VSKV++KD S + NES LAE  I E+D+G+    + VN  E+S VD  DHS + NE+E +E NI EVD  +    E+VN + VSKV+E D
Sbjct: 3284 DHSADQIEREPAESNINEAGEEEITQEKFNLEDLSKVYEKDDSGDSNESEPSESYINEVDEGEPKQQEQVNPEEVSKVNEKDNSYDPNESGLAEYYIVEIDQGKNNITDPVNLNEISKVDEEDHSADLNENEPSESNINEVDEGEPKQQEQVNPEGVSKVNEKD 3447          

HSP 15 Score: 108.612 bits (270), Expect = 9.691e-28
Identity = 96/250 (38.40%), Postives = 119/250 (47.60%), Query Frame = 3
Query:    3 DHSANPNESEPFKSNINEVDDGELKQQELV----------------------------------------------SNVDKKVHSADPNENEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINL-----------------------------------------NESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFV 491
            DHS  PN+SEP +SNIN+VD+ E KQQ+ V                                              SNVD+K HS D  ++E +E  I  VDE +       +L   SKVDK D S+NL                                         NESE AESNI+EVD+ E KQ ++++ EEVSNVD TDHS + NE +LAEQNIIEVDV +RNISE+ NL+EVS V E D  V
Sbjct: 1611 DHSIFPNQSEPAESNINKVDEEETKQQDQVNSEKVIEVVEKYNSDDPNYGEFIDPNMKNVDEEEKNIIEESNVKSLSNVDEKEHSTDQIKSELAEPNIRNVDEEERNITADANLKEESKVDKIDHSVNLNEKTLTEPITKEIDKNEQTQTDHVISEEKSKLDEKYYSADPNESEPAESNINEVDKAERKQQKKIDLEEVSNVDKTDHSADSNESKLAEQNIIEVDVGERNISEQDNLEEVSNVFETDPSV 1860          

HSP 16 Score: 105.916 bits (263), Expect = 6.766e-27
Identity = 94/209 (44.98%), Postives = 114/209 (54.55%), Query Frame = 3
Query:    3 DHSANPNESEPFKSNINEVDDGELKQQELV-----SNVDKKVHSADPNENEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDEGETKQLEQVNSEEVSN-----------------------------------------VDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFV 491
            D S N NESE  +SNI+EVD+ E KQ E V     SNVD   HS +PNE+E +E  I EVD       +KV+LD VSKVD+ D+ ++ NESE AESNI++VDEGETKQ EQVN EEVSN                                         VD TDHS  PN+ E AE NI +VD ++    E+VN DEV  VD  D+ V
Sbjct: 2173 DRSINLNESELAESNISEVDERETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVFELENSVILNENTLTEPIKKEVDNVENIQNVHANSEEESKVDETDHSIFPNQSEPAESNINKVDEEETKQQEQVNSDEVINVDVKDKSV 2381          

HSP 17 Score: 105.531 bits (262), Expect = 1.006e-26
Identity = 88/169 (52.07%), Postives = 109/169 (64.50%), Query Frame = 3
Query:    3 DHSANPNESEPFKSNINEVDDGELKQQELV-----SNVDKKVHSADPNENEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISE-KVNLDEVSKVDEIDQFV 491
            DHS + NESE  +SNI+EVD+GE KQ E V     SNVD   HS +PNE+E +E  I  VD       +KV+LD VSKVD+ D+ ++ NESE AESNI++VDEGETKQ EQVN EEVSNV   ++S   NE+ L E    EVD +  NI     N +E SKVDE D  +
Sbjct: 1447 DHSVDLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIGVDVDKRNISEKVNLDEVSKVDEIDQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVYELENSVILNENTLTESIKKEVD-NVENIQNVHANSEEESKVDETDHSI 1614          

HSP 18 Score: 93.9745 bits (232), Expect = 1.278e-22
Identity = 76/166 (45.78%), Postives = 100/166 (60.24%), Query Frame = 3
Query:    9 SANPNESEPFKSNINEVDDGELKQQELV-----SNVDKKVHSADPNENEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFV 491
            S +PNE E  +SNI  V++G+    E       S +D+   S DPN++E SE  I E+D+ +      V++D VSKV++ DR+ NLNESE  ESNI EVD GE KQ EQVN EEVS V+  D+S +PN  E  + NI E  +  +   EK NL+EVSK  E D  V
Sbjct: 2745 SVDPNEIEIVESNIENVEEGKTNLSEESNINESSTIDEPDLSVDPNKSELSEHYIIEIDQVEKNISDPVNVDEVSKVEETDRTANLNESEPYESNIKEVDVGEPKQKEQVNLEEVSKVNENDYSRDPNGSEPDDSNINE--LGGKMTHEKFNLEEVSKARENDDSV 2908          

HSP 19 Score: 92.8189 bits (229), Expect = 2.990e-22
Identity = 79/209 (37.80%), Postives = 108/209 (51.67%), Query Frame = 3
Query:    3 DHSANPNESEPFKSNINEVDDGELKQQELV----------------------------------------------SNVDKKVHSADPNENEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFV 491
            D   +PNESE  +SNIN+VD+GE KQQE V                                              S VD+  HS  PN++EP+ES IN+VDE + KQQ +V+ + V +V +K  S + N  E  + N+  VDE E   +E+ N + +SNVD  +HS +  + ELAE NI  VD ++RNI+   NL E SKVD+ID  V
Sbjct: 1529 DQFVDPNESESAESNINDVDEGETKQQEQVNFEEVSNVYELENSVILNENTLTESIKKEVDNVENIQNVHANSEEESKVDETDHSIFPNQSEPAESNINKVDEEETKQQDQVNSEKVIEVVEKYNSDDPNYGEFIDPNMKNVDEEEKNIIEESNVKSLSNVDEKEHSTDQIKSELAEPNIRNVDEEERNITADANLKEESKVDKIDHSV 1737          

HSP 20 Score: 90.8929 bits (224), Expect = 1.155e-21
Identity = 72/165 (43.64%), Postives = 100/165 (60.61%), Query Frame = 3
Query:    3 DHSANPNESEPFKSNINEVDDGELKQQELVS-----NVDKKVHSADPNENEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEID 482
            DHS  PN+SEP +SNIN+VD+ E KQQE V+     NVD K  S +P+E+E  E    E+ E D    ++ ++  + KV + + S++ NE EL E NI E+D+ E    +QVN +E+S VD  DHS +PNE E A  NI EV+  +    E VN  E+S+V E D
Sbjct: 2337 DHSIFPNQSEPAESNINKVDEEETKQQEQVNSDEVINVDVKDKSVNPDESELGEPNCIEIVEVDKNISEESNVKELLKVTETNHSVDQNEGELDEQNIIEIDKSEKNISDQVNVDELSKVDEIDHSADPNESESANSNINEVNKKETKQQELVNSKELSEVYEKD 2501          

HSP 21 Score: 89.7373 bits (221), Expect = 2.891e-21
Identity = 75/175 (42.86%), Postives = 104/175 (59.43%), Query Frame = 3
Query:    3 DHSANPNESEPFKSNINEVDDGELKQQELV-----SNVDKKVHSADPNENEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDEGETKQLEQVNSEEVSNV-------DI---TDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEID 482
            DH+ N NESEP++SNI EVD+GE KQQE V     S V++K  S D NE+E  E  I  V E +    ++ +++ +SK+D+ DRS+  NES+LAE  I E+D+GE    + V  +E SN        D+   TDHS +  E E AE NI E   ++    EK NL+++SKV E D
Sbjct: 3151 DHTGNLNESEPYESNIKEVDEGEPKQQEQVNPEEVSKVNEKGDSGDTNESEIVEPNIKNVYEGETDISEEPNVNELSKIDEIDRSVYTNESKLAEHYIIEIDQGENNVADPVYVDEGSNFYGKDDSGDLNEETDHSADQIEREPAESNINEAG-EEEITQEKFNLEDLSKVYEKD 3324          

HSP 22 Score: 80.1073 bits (196), Expect = 7.018e-18
Identity = 64/134 (47.76%), Postives = 84/134 (62.69%), Query Frame = 3
Query:   90 VSNVDKKVHSADPNENEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFV 491
            VS VD+  +S DPNEN  +E    EVD  +  Q   V  + + K D+ + S++  E E AESNI EVDE E  Q E+ N +EVS VD TDHS +PNE E +  NI E+   ++NIS+KVN+D+VSK DE D  V
Sbjct: 2576 VSKVDEIYYSEDPNENTLTEPITKEVDNIENIQTDYVKSEEL-KADETEYSVDQIERESAESNIDEVDEEEITQ-EKFNLKEVSKVDETDHSVDPNESEPSGSNINEIGQGEKNISDKVNVDQVSKDDESDHSV 2707          

HSP 23 Score: 76.6406 bits (187), Expect = 1.240e-16
Identity = 76/206 (36.89%), Postives = 106/206 (51.46%), Query Frame = 3
Query:    3 DHSANPNESEPFKSNINEVDDGELKQQELV-----SNVDKKVHSADPNENEPSESKINE---------------------------------------VDEADWKQQKK-VDLDGVSKVDKKDRSINLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQ 485
            DHSA+ NE+EP +SNINEVD+GE KQQE V     S V++K +S DP+E EP+ES INE                                       VDE + KQQ++  + +  SKV +KD S + NE+EL E +I  + EGE    E+ N +E++ V    HS +           IE + ++RNI++ VN  +VS VDE D 
Sbjct: 3406 DHSADLNENEPSESNINEVDEGEPKQQEQVNPEGVSKVNEKDNSNDPSEIEPAESNINEFGGEMTNEKFNLVEASKIFEKDDSFDPNKSELAELNINGVDEEEPKQQQQNFNFEEASKVHEKDNSDDPNENELVEPHIKNIVEGEKNISEESNVKELTKVFGKQHSFDQ----------IEGNSEERNITDDVNYKDVSHVDETDH 3601          

HSP 24 Score: 75.8702 bits (185), Expect = 2.457e-16
Identity = 72/164 (43.90%), Postives = 99/164 (60.37%), Query Frame = 3
Query:    3 DHSANPNESEPFKSNINEVDDGELKQQELV-----SNVDKKVHSADPNENEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEI 479
            +HS + NE E  + NI E+D  E    + V     S VD+  HSADPNE+E + S INEV++ + KQQ+ V+   +S+V +KD S N N+ E  E NI  VDE E   +E+   + +S +D T HS + NE ELAE NI  V+  +R++    NL EVSKVDEI
Sbjct: 2419 NHSVDQNEGELDEQNIIEIDKSEKNISDQVNVDELSKVDEIDHSADPNESESANSNINEVNKKETKQQELVNSKELSEVYEKDNSYNPNKKEFVEPNIKNVDEVEKNIIEESYLKALSMIDGTKHSVDENEEELAELNIKNVNEKERSLIYNANLIEVSKVDEI 2582          

HSP 25 Score: 75.0998 bits (183), Expect = 3.542e-16
Identity = 66/163 (40.49%), Postives = 88/163 (53.99%), Query Frame = 3
Query:    3 DHSANPNESEPFKSNINEVDDGELKQQELVSNVDKKVHSADPNENEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFV 491
            +HS N  + +  + NI   DD  L+    +S VD+  HS + NE   +   + EVD+    Q +  +L+ +SKVD+   S N NESEL ESNI EVDEGET Q +QVN               PNE    E N  EVD  ++  +E VNL+E S VD+ID FV
Sbjct: 3676 EHSVNQMKCKIEERNI--TDDANLRD---LSQVDEIDHSVNSNERTLTGDNVIEVDKGQKNQHEPANLEEMSKVDEIHHSANPNESELDESNIYEVDEGETNQQKQVN---------------PNESTPIECNTNEVDGGEKYQTEHVNLEEESMVDKIDNFV 3818          

HSP 26 Score: 68.9366 bits (167), Expect = 6.212e-14
Identity = 80/207 (38.65%), Postives = 100/207 (48.31%), Query Frame = 3
Query:    3 DHSANPNESEPFKSNINEVDDGELKQQELV-----SNVDKKVHSADPNENEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVD--------------------------------------VDKRNIS-EKVNLDEVSKVDEIDQFV 491
            DHSA+PNESE   SNINEV+  E KQQELV     S V +K +S +PN+ E  E  I  VDE +    ++  L  +S +D    S++ NE ELAE NI  V+E E   +   N  EVS VD   +S +PNE+ L E    EVD                                      VD+  I+ EK NL EVSKVDE D  V
Sbjct: 2460 DHSADPNESESANSNINEVNKKETKQQELVNSKELSEVYEKDNSYNPNKKEFVEPNIKNVDEVEKNIIEESYLKALSMIDGTKHSVDENEEELAELNIKNVNEKERSLIYNANLIEVSKVDEIYYSEDPNENTLTEPITKEVDNIENIQTDYVKSEELKADETEYSVDQIERESAESNIDEVDEEEITQEKFNLKEVSKVDETDHSV 2666          

HSP 27 Score: 63.1586 bits (152), Expect = 5.946e-12
Identity = 44/104 (42.31%), Postives = 61/104 (58.65%), Query Frame = 3
Query:    6 HSANPNESEPFKSNINEVDDGELKQQELVSNVDKKVHSADPNENEPSESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDEGETKQLE 317
            HSANPNESE  +SNI EVD+GE  QQ+ V          +PNE+ P E   NEVD  +  Q + V+L+  S VDK D  ++  ES   + ++++V EGE  + E
Sbjct: 3749 HSANPNESELDESNIYEVDEGETNQQKQV----------NPNESTPIECNTNEVDGGEKYQTEHVNLEEESMVDKIDNFVDPKESPFTKPDVNKVSEGEKNKAE 3842          

HSP 28 Score: 59.3066 bits (142), Expect = 1.365e-10
Identity = 46/115 (40.00%), Postives = 74/115 (64.35%), Query Frame = 3
Query:  147 ESKINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFV 491
            E++IN++ E   +  +  +L  ++K+D+KD S++  ES   E+ I+++DE   KQ +QVN EEV  VD T+    PN  ELA+ NII+V+ + +   E++NL+EV+ VDE D  V
Sbjct: 1297 ETQINKLGENVDQVNETFNLYVMTKMDQKDNSVDPYESAHIEAKINKIDEETIKQ-KQVNLEEVPKVDETEEFINPNRSELADHNIIKVEEETKK-QEQINLEEVTNVDERDYSV 1409          

HSP 29 Score: 51.2174 bits (121), Expect = 8.520e-8
Identity = 71/200 (35.50%), Postives = 98/200 (49.00%), Query Frame = 3
Query:    3 DHSANPNESEPFKSNINEVDDGELKQQ------ELVSNVDKKVHSADPNENE----------------PSESKINEVDEADWKQQKKVDLDG---------------VSKVDKKDRSINLNESELAESNISEVDEGETKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNLDEVSKVDEIDQFV 491
            D S +PN+SE  + NIN VD+ E KQQ      E  S V +K +S DPNENE                  ES + E+ +   KQ     ++G               VS VD+ D + + NESE AESN +EVDE E         EE S VD  D+S +P ++EL E  I   +V ++NIS +  L ++ KVD+ +  V
Sbjct: 3486 DDSFDPNKSELAELNINGVDEEEPKQQQQNFNFEEASKVHEKDNSDDPNENELVEPHIKNIVEGEKNISEESNVKELTKVFGKQHSFDQIEGNSEERNITDDVNYKDVSHVDETDHADDSNESEPAESNFNEVDEEEGNS------EEESKVDEKDNSDDPYKNELVEPLIKNFNVGEKNISGESCLKDLLKVDKTEHSV 3679          
The following BLAST results are available for this feature:
BLAST of SMED30002984 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002984 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002984 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002984 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002984 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002984 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002984 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002984 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002984 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002984 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002984 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002984 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002984 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002984 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000064314.11.169e-7282.21SMESG000064314.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002984 ID=SMED30002984|Name=SMED30002984|organism=Schmidtea mediterranea sexual|type=transcript|length=491bp
CAGATCATTCTGCTAATCCAAATGAAAGTGAACCTTTTAAGTCTAATATT
AATGAGGTTGATGATGGAGAACTGAAACAACAAGAGCTAGTTTCAAATGT
TGATAAAAAAGTTCATTCTGCCGATCCAAATGAAAATGAACCTTCTGAGT
CTAAAATCAATGAGGTAGATGAGGCAGATTGGAAACAACAGAAGAAAGTT
GATTTGGATGGAGTATCAAAGGTTGATAAAAAGGATCGTTCCATCAATCT
AAATGAAAGTGAACTTGCTGAGTCTAATATCAGTGAAGTTGATGAGGGAG
AGACTAAACAACTAGAGCAAGTTAATTCAGAAGAAGTTTCAAATGTTGAT
ATAACAGATCATTCTGGTGAACCAAATGAACATGAACTTGCAGAGCAAAA
TATCATTGAGGTCGATGTTGATAAAAGGAATATATCCGAAAAAGTTAATT
TGGATGAGGTGTCAAAGGTTGATGAAATAGATCAATTTGTC
back to top

protein sequence of SMED30002984-orf-1

>SMED30002984-orf-1 ID=SMED30002984-orf-1|Name=SMED30002984-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=163bp
DHSANPNESEPFKSNINEVDDGELKQQELVSNVDKKVHSADPNENEPSES
KINEVDEADWKQQKKVDLDGVSKVDKKDRSINLNESELAESNISEVDEGE
TKQLEQVNSEEVSNVDITDHSGEPNEHELAEQNIIEVDVDKRNISEKVNL
DEVSKVDEIDQFV
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002089reproductive organ
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 119..135
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 95..109
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 12..87
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..135