Tropomyosin-2

Overview
NameTropomyosin-2
Smed IDSMED30002983
Length (bp)1179
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tropomyosin-2 (SMED30002983) t-SNE clustered cells

Violin plots show distribution of expression levels for Tropomyosin-2 (SMED30002983) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tropomyosin-2 (SMED30002983) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tropomyosin-2 (SMED30002983) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002983

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30002983SMESG000000190.1 dd_Smed_v4_436_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002983SMESG000000190.1 dd_Smed_v4_436_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002983SMESG000000190.1 dd_Smed_v4_436_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002983SMESG000000190.1 dd_Smed_v4_436_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30002983SMESG000000190.1 dd_Smed_v4_436_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002983SMESG000000190.1 Contig22215uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002983SMESG000000190.1 Contig22215newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002983SMESG000000190.1 Contig50099uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002983SMESG000000190.1 Contig50099newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
enteric muscle cellSMED30002983SMESG000000190.1 dd_Smed_v4_436_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30002983SMESG000000190.1 dd_Smed_v6_436_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30002983SMESG000000190.1 dd_Smed_v6_436_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle progenitor cellSMED30002983SMESG000000190.1 dd_Smed_v6_436_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30002983SMESG000000190.1 dd_Smed_v4_436_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tropomyosin-2 vs. Ensembl Human
Match: TPM1 (tropomyosin 1 [Source:HGNC Symbol;Acc:HGNC:12010])

HSP 1 Score: 187.193 bits (474), Expect = 3.895e-56
Identity = 119/222 (53.60%), Postives = 157/222 (70.72%), Query Frame = 3
Query:  333 EALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
            EALK+    LE  EK+A +AE +V ++ +R +L+E++L++ + RL  A  K EEA KAADESERG KV+E+R+  DEE++   E QLKEAK+IAEDADRKY+E ARKL I E DLERAE R E ++ K  ELEEEL+ V NN+KSLE   ++  Q+E+ YEE I+  +DKLK  E RA  AER V  L+  +D +EDEL A+K KYK +SEELD A  ++T 
Sbjct:   62 EALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTS 283          
BLAST of Tropomyosin-2 vs. Ensembl Human
Match: TPM1 (tropomyosin 1 [Source:HGNC Symbol;Acc:HGNC:12010])

HSP 1 Score: 187.193 bits (474), Expect = 4.380e-56
Identity = 119/222 (53.60%), Postives = 157/222 (70.72%), Query Frame = 3
Query:  333 EALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
            EALK+    LE  EK+A +AE +V ++ +R +L+E++L++ + RL  A  K EEA KAADESERG KV+E+R+  DEE++   E QLKEAK+IAEDADRKY+E ARKL I E DLERAE R E ++ K  ELEEEL+ V NN+KSLE   ++  Q+E+ YEE I+  +DKLK  E RA  AER V  L+  +D +EDEL A+K KYK +SEELD A  ++T 
Sbjct:   62 EALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTS 283          
BLAST of Tropomyosin-2 vs. Ensembl Human
Match: TPM1 (tropomyosin 1 [Source:HGNC Symbol;Acc:HGNC:12010])

HSP 1 Score: 182.185 bits (461), Expect = 3.481e-54
Identity = 114/222 (51.35%), Postives = 157/222 (70.72%), Query Frame = 3
Query:  333 EALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
            EALK+    LE  EK+A +AE +V ++ +R +L+E++L++ + RL  A  K EEA KAADESERG KV+E+R+  DEE++   E QLKEAK+IAEDADRKY+E ARKL I E DLERAE R E ++ +V +LEE+LR++   +K+L  +E +  Q+E+ YEE I+  +DKLK  E RA  AER V  L+  +D +EDEL A+K KYK +SEELD A  ++T 
Sbjct:   62 EALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGQVRQLEEQLRIMDQTLKALMAAEDKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTS 283          
BLAST of Tropomyosin-2 vs. Ensembl Human
Match: TPM3 (tropomyosin 3 [Source:HGNC Symbol;Acc:HGNC:12012])

HSP 1 Score: 175.637 bits (444), Expect = 1.150e-51
Identity = 122/222 (54.95%), Postives = 159/222 (71.62%), Query Frame = 3
Query:  333 EALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
            EALK+    LE  EK+AA+AE EV ++ +R +L+E++L++ + RL  A  K EEA KAADESERG KV+E R++ DEE++   E QLKEAK+IAE+ADRKY+E ARKL I E DLER E R E A++K  ELEEEL+ V NN+KSLE   ++  Q+E+ YEE I+  TDKLK  E RA  AER VA L+  +D +EDEL A+K KYK +SEELD A  ++T 
Sbjct:   63 EALKDAQEKLELAEKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESKCSELEEELKNVTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTS 284          
BLAST of Tropomyosin-2 vs. Ensembl Human
Match: TPM3 (tropomyosin 3 [Source:HGNC Symbol;Acc:HGNC:12012])

HSP 1 Score: 173.711 bits (439), Expect = 2.326e-51
Identity = 109/210 (51.90%), Postives = 151/210 (71.90%), Query Frame = 3
Query:  372 EKRAAE-AEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
            E+RA E AE EV ++ +R +L+E++L++ + RL  A  K EEA KAADESERG KV+E R++ DEE++   E QLKEAK+IAE+ADRKY+E ARKL I E DLER E R E A+++  E++E++R++  N+K L  +E++  Q+E+ YEE I+  TDKLK  E RA  AER VA L+  +D +EDEL A+K KYK +SEELD A  ++T 
Sbjct:   38 ERRAREQAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESRCREMDEQIRLMDQNLKCLSAAEEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTS 247          
BLAST of Tropomyosin-2 vs. Ensembl Celegans
Match: lev-11 (Tropomyosin isoforms a/b/d/f [Source:UniProtKB/Swiss-Prot;Acc:Q22866])

HSP 1 Score: 226.098 bits (575), Expect = 6.162e-72
Identity = 134/218 (61.47%), Postives = 167/218 (76.61%), Query Frame = 3
Query:  348 VNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTGY 1001
            V   LE   K+  +AE EV A+ +R  L+E+DLE+TE RL+ AT K E+A+KAADE++R RK +ETRS  DEER   LE Q+ EAK IAEDADRKY+E ARKLA+ E DLERAE R E+ +NK++ELEEELRVVGNN+KSLE+SE++A+QRE+ YEE IR  + +LK  E RA  AER V  LQ EVDR+EDEL+ EKE+YK +SEELDS F EL+GY
Sbjct:   39 VKRQLEEERKKREDAEAEVAALNRRIVLVEEDLERTEDRLKTATSKLEQATKAADEADRARKSMETRSQQDEERANFLETQVDEAKVIAEDADRKYEEVARKLAMVEADLERAEERAEAGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSSRLKEAETRAEFAERSVQKLQKEVDRLEDELVHEKERYKTISEELDSTFQELSGY 256          
BLAST of Tropomyosin-2 vs. Ensembl Celegans
Match: lev-11 (Tropomyosin isoforms a/b/d/f [Source:UniProtKB/Swiss-Prot;Acc:Q22866])

HSP 1 Score: 209.92 bits (533), Expect = 3.117e-65
Identity = 137/229 (59.83%), Postives = 171/229 (74.67%), Query Frame = 3
Query:  315 DCETAKEALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTGY 1001
            D + A+E L    S LE  EK   EAE EV ++ +R  LLE++LE+ E RL+ AT K EEA+   DESER RKV+E RS+ DEER   +E QLKEA+ +AE+ADRKYDE ARKLA+ E DLERAE R E+ +NK++ELEEELRVVGNN+KSLE+SE++A+QRE+ YEE IR  + +LK  E RA  AER V  LQ EVDR+EDEL+ EKE+YK +SEELDS F EL+GY
Sbjct:   56 DLDKAQEDLSAATSKLEEKEKTVQEAEAEVASLNRRMTLLEEELERAEERLKIATEKLEEATHNVDESERVRKVMENRSLQDEERANTVEAQLKEAQLLAEEADRKYDEVARKLAMVEADLERAEERAEAGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSSRLKEAETRAEFAERSVQKLQKEVDRLEDELVHEKERYKTISEELDSTFQELSGY 284          
BLAST of Tropomyosin-2 vs. Ensembl Celegans
Match: lev-11 (Tropomyosin isoforms a/b/d/f [Source:UniProtKB/Swiss-Prot;Acc:Q22866])

HSP 1 Score: 207.994 bits (528), Expect = 1.613e-64
Identity = 138/229 (60.26%), Postives = 169/229 (73.80%), Query Frame = 3
Query:  315 DCETAKEALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTGY 1001
            D + A+E L    S LE  EK   EAE EV ++ +R  LLE++LE+ E RL+ AT K EEA+   DESER RK +ETRS  DEER   LE Q+ EAK IAEDADRKY+E ARKLA+ E DLERAE R E+ +NK++ELEEELRVVGNN+KSLE+SE++A+QRE+ YEE IR  + +LK  E RA  AER V  LQ EVDR+EDEL+ EKE+YK +SEELDS F EL+GY
Sbjct:   56 DLDKAQEDLSAATSKLEEKEKTVQEAEAEVASLNRRMTLLEEELERAEERLKIATEKLEEATHNVDESERARKSMETRSQQDEERANFLETQVDEAKVIAEDADRKYEEVARKLAMVEADLERAEERAEAGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSSRLKEAETRAEFAERSVQKLQKEVDRLEDELVHEKERYKTISEELDSTFQELSGY 284          
BLAST of Tropomyosin-2 vs. Ensembl Celegans
Match: lev-11 (Tropomyosin isoforms a/b/d/f [Source:UniProtKB/Swiss-Prot;Acc:Q22866])

HSP 1 Score: 202.986 bits (515), Expect = 1.259e-62
Identity = 133/229 (58.08%), Postives = 170/229 (74.24%), Query Frame = 3
Query:  315 DCETAKEALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTGY 1001
            D + A+E L    S LE  EK   EAE EV ++ +R  LLE++LE+ E RL+ AT K EEA+   DESER RKV+E RS+ DEER   +E QLKEA+ +AE+ADRKYDE ARKLA+ E DLERAE R E+ +NK++ELEEELRVVGNN+KSLE+SE++A+++E+++ E IR    +LK  E RA  AER V  LQ EVDR+EDEL+ EKE+YK +SEELDS F EL+GY
Sbjct:   56 DLDKAQEDLSAATSKLEEKEKTVQEAEAEVASLNRRMTLLEEELERAEERLKIATEKLEEATHNVDESERVRKVMENRSLQDEERANTVEAQLKEAQLLAEEADRKYDEVARKLAMVEADLERAEERAEAGENKIVELEEELRVVGNNLKSLELSEEKALEKEDIFAEQIRQLDFRLKEAETRAEFAERSVQKLQKEVDRLEDELVHEKERYKTISEELDSTFQELSGY 284          
BLAST of Tropomyosin-2 vs. Ensembl Celegans
Match: lev-11 (Tropomyosin isoforms a/b/d/f [Source:UniProtKB/Swiss-Prot;Acc:Q22866])

HSP 1 Score: 198.364 bits (503), Expect = 4.164e-62
Identity = 114/176 (64.77%), Postives = 139/176 (78.98%), Query Frame = 3
Query:  474 ATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTGY 1001
            AT K EEA+   DESER RKV+E RS+ DEER   +E QLKEA+ +AE+ADRKYDE ARKLA+ E DLERAE R E+ +NK++ELEEELRVVGNN+KSLE+SE++A+QRE+ YEE IR  + +LK  E RA  AER V  LQ EVDR+EDEL+ EKE+YK +SEELDS F EL+GY
Sbjct:   18 ATEKLEEATHNVDESERVRKVMENRSLQDEERANTVEAQLKEAQLLAEEADRKYDEVARKLAMVEADLERAEERAEAGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSSRLKEAETRAEFAERSVQKLQKEVDRLEDELVHEKERYKTISEELDSTFQELSGY 193          
BLAST of Tropomyosin-2 vs. Ensembl Fly
Match: Tm1 (gene:FBgn0003721 transcript:FBtr0305654)

HSP 1 Score: 213.001 bits (541), Expect = 2.362e-66
Identity = 131/229 (57.21%), Postives = 170/229 (74.24%), Query Frame = 3
Query:  306 VQTDCETAKEALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAEL 992
            V+ + +  +EAL  V   LE   K    AE EV A+ +R +LLE+DLE++E RL  AT K  EAS+AADESER RK+LE R++ADEER+  LE QLKEA+++AE+AD+KYDE ARKLA+ E DLERAE R E  +NK++ELEEELRVVGNN+KSLE+SE++A QREE Y+  I+    +LK  E RA  AER V  LQ EVDR+ED+L+ EKE+YK + ++LD+AF EL
Sbjct:   53 VENELDQTQEALTLVTGKLEEKNKALQNAESEVAALNRRIQLLEEDLERSEERLGSATAKLSEASQAADESERARKILENRALADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAEERAEQGENKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLNTRLKEAEARAEFAERSVQKLQKEVDRLEDDLVLEKERYKDIGDDLDTAFVEL 281          
BLAST of Tropomyosin-2 vs. Ensembl Fly
Match: Tm1 (gene:FBgn0003721 transcript:FBtr0089964)

HSP 1 Score: 213.001 bits (541), Expect = 2.362e-66
Identity = 131/229 (57.21%), Postives = 170/229 (74.24%), Query Frame = 3
Query:  306 VQTDCETAKEALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAEL 992
            V+ + +  +EAL  V   LE   K    AE EV A+ +R +LLE+DLE++E RL  AT K  EAS+AADESER RK+LE R++ADEER+  LE QLKEA+++AE+AD+KYDE ARKLA+ E DLERAE R E  +NK++ELEEELRVVGNN+KSLE+SE++A QREE Y+  I+    +LK  E RA  AER V  LQ EVDR+ED+L+ EKE+YK + ++LD+AF EL
Sbjct:   53 VENELDQTQEALTLVTGKLEEKNKALQNAESEVAALNRRIQLLEEDLERSEERLGSATAKLSEASQAADESERARKILENRALADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAEERAEQGENKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLNTRLKEAEARAEFAERSVQKLQKEVDRLEDDLVLEKERYKDIGDDLDTAFVEL 281          
BLAST of Tropomyosin-2 vs. Ensembl Fly
Match: Tm1 (gene:FBgn0003721 transcript:FBtr0089967)

HSP 1 Score: 213.001 bits (541), Expect = 2.362e-66
Identity = 131/229 (57.21%), Postives = 170/229 (74.24%), Query Frame = 3
Query:  306 VQTDCETAKEALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAEL 992
            V+ + +  +EAL  V   LE   K    AE EV A+ +R +LLE+DLE++E RL  AT K  EAS+AADESER RK+LE R++ADEER+  LE QLKEA+++AE+AD+KYDE ARKLA+ E DLERAE R E  +NK++ELEEELRVVGNN+KSLE+SE++A QREE Y+  I+    +LK  E RA  AER V  LQ EVDR+ED+L+ EKE+YK + ++LD+AF EL
Sbjct:   53 VENELDQTQEALTLVTGKLEEKNKALQNAESEVAALNRRIQLLEEDLERSEERLGSATAKLSEASQAADESERARKILENRALADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAEERAEQGENKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLNTRLKEAEARAEFAERSVQKLQKEVDRLEDDLVLEKERYKDIGDDLDTAFVEL 281          
BLAST of Tropomyosin-2 vs. Ensembl Fly
Match: Tm1 (gene:FBgn0003721 transcript:FBtr0301959)

HSP 1 Score: 213.001 bits (541), Expect = 2.362e-66
Identity = 131/229 (57.21%), Postives = 170/229 (74.24%), Query Frame = 3
Query:  306 VQTDCETAKEALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAEL 992
            V+ + +  +EAL  V   LE   K    AE EV A+ +R +LLE+DLE++E RL  AT K  EAS+AADESER RK+LE R++ADEER+  LE QLKEA+++AE+AD+KYDE ARKLA+ E DLERAE R E  +NK++ELEEELRVVGNN+KSLE+SE++A QREE Y+  I+    +LK  E RA  AER V  LQ EVDR+ED+L+ EKE+YK + ++LD+AF EL
Sbjct:   53 VENELDQTQEALTLVTGKLEEKNKALQNAESEVAALNRRIQLLEEDLERSEERLGSATAKLSEASQAADESERARKILENRALADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAEERAEQGENKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLNTRLKEAEARAEFAERSVQKLQKEVDRLEDDLVLEKERYKDIGDDLDTAFVEL 281          
BLAST of Tropomyosin-2 vs. Ensembl Fly
Match: Tm1 (gene:FBgn0003721 transcript:FBtr0089957)

HSP 1 Score: 209.149 bits (531), Expect = 2.852e-62
Identity = 129/230 (56.09%), Postives = 167/230 (72.61%), Query Frame = 3
Query:  306 VQTDCETAKEALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELT 995
            V+ + +  +EAL  V   LE   K    AE EV A+ +R +LLE+DLE++E RL  AT K  EAS+AADESER RK+LE R++ADEER+  LE QLKEA+++AE+AD+KYDE ARKLA+ E DLERAE R E  +NK++ELEEELRVVGNN+KSLE+SE++A QREE Y+  I+    +LK  E RA  AER V  LQ EVDR+ED+L+ EKE+Y  + + LD AF +L 
Sbjct:   53 VENELDQTQEALTLVTGKLEEKNKALQNAESEVAALNRRIQLLEEDLERSEERLGSATAKLSEASQAADESERARKILENRALADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAEERAEQGENKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLNTRLKEAEARAEFAERSVQKLQKEVDRLEDDLIVEKERYCMIGDSLDEAFVDLI 282          
BLAST of Tropomyosin-2 vs. Ensembl Zebrafish
Match: tpm3 (tropomyosin 3 [Source:ZFIN;Acc:ZDB-GENE-030826-16])

HSP 1 Score: 190.274 bits (482), Expect = 1.948e-57
Identity = 121/222 (54.50%), Postives = 160/222 (72.07%), Query Frame = 3
Query:  333 EALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
            EALK+    LE +EK+AA+AE EV ++ +R +L+E++L++ + RL  A  K EEA KAADESERG KV+E R++ DEE++   E QLKEAK+IAE+ADRKY+E ARKL I E +LER E R E A++K  ELEEEL+ V NN+KSLE   ++  Q+E+ YEE I+  TDKLK  E RA  AER VA L+  +D +EDEL A+K KYK +SEELD A  ++T 
Sbjct:   62 EALKDAQEKLEISEKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTEERAELAESKCAELEEELKNVTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTS 283          
BLAST of Tropomyosin-2 vs. Ensembl Zebrafish
Match: tpma (alpha-tropomyosin [Source:NCBI gene;Acc:30324])

HSP 1 Score: 186.422 bits (472), Expect = 5.822e-56
Identity = 119/222 (53.60%), Postives = 156/222 (70.27%), Query Frame = 3
Query:  333 EALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
            EALK+    LE  EK+A +AEG+V ++ +R +L+E++L++ + RL  A  K EEA KAADESERG KV+E R++ DEE++   E QLKEAK+IAE+ADRKY+E ARKL I E +LER E R E  + K  ELEEEL+ V NNMKSLE   ++   +E+ YEE I+  TDKLK  E RA  AER VA L+  +D +EDEL A+K KYK +SEELD A  ++T 
Sbjct:   62 EALKDAQEKLELAEKKATDAEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTEERAELNEGKCSELEEELKTVTNNMKSLEAQAEKYSAKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTS 283          
BLAST of Tropomyosin-2 vs. Ensembl Zebrafish
Match: tpm1 (tropomyosin 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-040426-854])

HSP 1 Score: 186.037 bits (471), Expect = 7.522e-56
Identity = 118/222 (53.15%), Postives = 158/222 (71.17%), Query Frame = 3
Query:  333 EALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
            EALK+    LE  EK+A +AEG+V ++ +R +L+E++L++ + RL  A  K EEA KAADESERG KV+E R++ DEE++   E QLKEAK+IAE+ADRKY+E ARKL I E +LER E R E  ++K  ELEEEL+ V NN+KSLE   ++  Q+E+ YEE I+  TDKLK  E RA  AER VA L+  +D +EDEL ++K KYK +SEELD A  ++T 
Sbjct:   62 EALKDAQEKLELAEKKATDAEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTEERAELNESKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDMTS 283          
BLAST of Tropomyosin-2 vs. Ensembl Zebrafish
Match: tpm1 (tropomyosin 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-040426-854])

HSP 1 Score: 186.037 bits (471), Expect = 7.850e-56
Identity = 118/222 (53.15%), Postives = 158/222 (71.17%), Query Frame = 3
Query:  333 EALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
            EALK+    LE  EK+A +AEG+V ++ +R +L+E++L++ + RL  A  K EEA KAADESERG KV+E R++ DEE++   E QLKEAK+IAE+ADRKY+E ARKL I E +LER E R E  ++K  ELEEEL+ V NN+KSLE   ++  Q+E+ YEE I+  TDKLK  E RA  AER VA L+  +D +EDEL ++K KYK +SEELD A  ++T 
Sbjct:   62 EALKDAQEKLELAEKKATDAEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTEERAELNESKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDMTS 283          
BLAST of Tropomyosin-2 vs. Ensembl Zebrafish
Match: tpm4a (tropomyosin 4a [Source:ZFIN;Acc:ZDB-GENE-040426-2185])

HSP 1 Score: 175.637 bits (444), Expect = 6.968e-52
Identity = 120/222 (54.05%), Postives = 161/222 (72.52%), Query Frame = 3
Query:  333 EALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
            EALK+    LE +EK+AA+AEG+V A+ +R +L+E++L++ + RL  A  K EEA KAADESERG KV+E R++ DEE++   E QLKEAK+IAE+ADRKY+E ARKL I E +LERAE R E A+ K  +LEEEL+ V NN+KSLE   ++  ++E+ YEE I+  +DKLK  E RA  AER VA L+  +D +EDEL A+K KYK +SEELD A  ++T 
Sbjct:   62 EALKDAQEKLELSEKKAADAEGDVAALNRRIQLVEEELDRAQERLGTALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVAECKASDLEEELKNVTNNLKSLEAQAEKYSEKEDKYEEEIKVLSDKLKEAETRAEFAERTVAKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTS 283          
BLAST of Tropomyosin-2 vs. Ensembl Xenopus
Match: tpm1 (tropomyosin 1 [Source:NCBI gene;Acc:448541])

HSP 1 Score: 191.815 bits (486), Expect = 5.463e-58
Identity = 121/222 (54.50%), Postives = 160/222 (72.07%), Query Frame = 3
Query:  333 EALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
            EALK+    LE  EK+A +AEG+V ++ +R +L+E++L++ + RL  A  K EEA KAADESERG KV+E R++ DEE++   E QLKEAK+IAE+ADRKY+E ARKL I E DLERAE R E +++K  ELEEEL+ V NN+KSLE   ++  Q+E+ YEE I+  TDKLK  E RA  AER VA L+  +D +EDEL A+K KYK +SEELD A  ++T 
Sbjct:   62 EALKDAQEKLELAEKKATDAEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERAEERAELSESKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERTVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTS 283          
BLAST of Tropomyosin-2 vs. Ensembl Xenopus
Match: tpm1 (tropomyosin 1 [Source:NCBI gene;Acc:448541])

HSP 1 Score: 192.2 bits (487), Expect = 6.366e-58
Identity = 121/222 (54.50%), Postives = 160/222 (72.07%), Query Frame = 3
Query:  333 EALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
            EALK+    LE  EK+A +AEG+V ++ +R +L+E++L++ + RL  A  K EEA KAADESERG KV+E R++ DEE++   E QLKEAK+IAE+ADRKY+E ARKL I E DLERAE R E +++K  ELEEEL+ V NN+KSLE   ++  Q+E+ YEE I+  TDKLK  E RA  AER VA L+  +D +EDEL A+K KYK +SEELD A  ++T 
Sbjct:   74 EALKDAQEKLELAEKKATDAEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERAEERAELSESKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERTVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTS 295          
BLAST of Tropomyosin-2 vs. Ensembl Xenopus
Match: tpm1 (tropomyosin 1 [Source:NCBI gene;Acc:448541])

HSP 1 Score: 179.104 bits (453), Expect = 4.600e-53
Identity = 115/222 (51.80%), Postives = 154/222 (69.37%), Query Frame = 3
Query:  333 EALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
            EALK+    LE  EK+A +AEG+V ++ +R +L+E++L++ + RL  A  K EEA KAADESERG KV+E R++ DEE++   E QLKEAK+IAE+ADRKY+E ARKL I E DLE   S      +++  LEEEL+ V NN+KSLE   ++  Q+E+ YEE I+  TDKLK  E RA  AER VA L+  +D +EDEL A+K KYK +SEELD A  ++T 
Sbjct:   62 EALKDAQEKLELAEKKATDAEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLELCFSSF----SEINTLEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERTVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTS 279          
BLAST of Tropomyosin-2 vs. Ensembl Xenopus
Match: gucy2d (guanylate cyclase 2D, membrane (retina-specific) [Source:Xenbase;Acc:XB-GENE-1014102])

HSP 1 Score: 172.94 bits (437), Expect = 1.387e-50
Identity = 119/222 (53.60%), Postives = 159/222 (71.62%), Query Frame = 3
Query:  333 EALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
            EALK+    LE  +K+A +AEGEV A+ +R +L+E++L++ + RL  A  K EEA KAADESERG KV+E R++ DEE++   E QLKEAK+IAE+ADRKY+E ARKL I E +LERAE R E ++ K  +LEEEL+ V NN+KSLE   ++  ++E+ YEE I+  TDKLK  E RA  AER VA L+  +D +EDEL A+K KYK +SEELD A  ++T 
Sbjct:   62 EALKDAQEKLEQADKKATDAEGEVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQELQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKCSDLEEELKNVTNNLKSLEAQSEKYSEKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTS 283          
BLAST of Tropomyosin-2 vs. Ensembl Xenopus
Match: tpm1 (tropomyosin 1 [Source:NCBI gene;Acc:448541])

HSP 1 Score: 170.629 bits (431), Expect = 1.189e-49
Identity = 113/259 (43.63%), Postives = 157/259 (60.62%), Query Frame = 3
Query:  333 EALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTGY*GQGYLAISIVHIF-IHKASFVSFEISVFKKCVPLC 1106
            EALK+    LE  EK+A +AEG+V ++ +R +L+E++L++ + RL  A  K EEA KAADESERG KV+E R++ DEE++   E QLKEAK+IAE+ADRKY+E ARKL I E DLERAE R E +++K  ELEEEL+ V NN+KSLE   ++  Q+E+ YEE I+  TDKLK  E RA  AER VA L+  +D +E                            G  +L+  + H++      F+   + VF  C+ + 
Sbjct:   62 EALKDAQEKLELAEKKATDAEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERAEERAELSESKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERTVAKLEKTIDDLE----------------------------GMNFLSTYVEHLWRFCIFFFLCSPLGVFYPCLDIW 292          
BLAST of Tropomyosin-2 vs. Ensembl Mouse
Match: Tpm1 (tropomyosin 1, alpha [Source:MGI Symbol;Acc:MGI:98809])

HSP 1 Score: 187.578 bits (475), Expect = 2.025e-56
Identity = 119/222 (53.60%), Postives = 157/222 (70.72%), Query Frame = 3
Query:  333 EALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
            EALK+    LE  EK+A +AE +V ++ +R +L+E++L++ + RL  A  K EEA KAADESERG KV+E+R+  DEE++   E QLKEAK+IAEDADRKY+E ARKL I E DLERAE R E ++ K  ELEEEL+ V NN+KSLE   ++  Q+E+ YEE I+  +DKLK  E RA  AER V  L+  +D +EDEL A+K KYK +SEELD A  ++T 
Sbjct:   62 EALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTS 283          
BLAST of Tropomyosin-2 vs. Ensembl Mouse
Match: Tpm1 (tropomyosin 1, alpha [Source:MGI Symbol;Acc:MGI:98809])

HSP 1 Score: 187.578 bits (475), Expect = 2.206e-56
Identity = 119/222 (53.60%), Postives = 157/222 (70.72%), Query Frame = 3
Query:  333 EALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
            EALK+    LE  EK+A +AE +V ++ +R +L+E++L++ + RL  A  K EEA KAADESERG KV+E+R+  DEE++   E QLKEAK+IAEDADRKY+E ARKL I E DLERAE R E ++ K  ELEEEL+ V NN+KSLE   ++  Q+E+ YEE I+  +DKLK  E RA  AER V  L+  +D +EDEL A+K KYK +SEELD A  ++T 
Sbjct:   62 EALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTS 283          
BLAST of Tropomyosin-2 vs. Ensembl Mouse
Match: Tpm1 (tropomyosin 1, alpha [Source:MGI Symbol;Acc:MGI:98809])

HSP 1 Score: 182.185 bits (461), Expect = 2.195e-54
Identity = 114/222 (51.35%), Postives = 157/222 (70.72%), Query Frame = 3
Query:  333 EALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
            EALK+    LE  EK+A +AE +V ++ +R +L+E++L++ + RL  A  K EEA KAADESERG KV+E+R+  DEE++   E QLKEAK+IAEDADRKY+E ARKL I E DLERAE R E ++ +V +LEE+LR++   +K+L  +E +  Q+E+ YEE I+  +DKLK  E RA  AER V  L+  +D +EDEL A+K KYK +SEELD A  ++T 
Sbjct:   62 EALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGQVRQLEEQLRIMDQTLKALMAAEDKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTS 283          
BLAST of Tropomyosin-2 vs. Ensembl Mouse
Match: Tpm3 (tropomyosin 3, gamma [Source:MGI Symbol;Acc:MGI:1890149])

HSP 1 Score: 175.637 bits (444), Expect = 3.057e-52
Identity = 115/210 (54.76%), Postives = 151/210 (71.90%), Query Frame = 3
Query:  372 EKRAAE-AEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
            E+RA E AE EV ++ +R +L+E++L++ + RL  A  K EEA KAADESERG KV+E R++ DEE++   E QLKEAK+IAE+ADRKY+E ARKL I E DLER E R E A++K  ELEEEL+ V NN+KSLE   ++  Q+E+ YEE I+  TDKLK  E RA  AER VA L+  +D +EDEL A+K KYK +S+ELD A  ++T 
Sbjct:   38 ERRAREQAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESKCSELEEELKNVTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISDELDHALNDMTS 247          
BLAST of Tropomyosin-2 vs. Ensembl Mouse
Match: Tpm3 (tropomyosin 3, gamma [Source:MGI Symbol;Acc:MGI:1890149])

HSP 1 Score: 174.096 bits (440), Expect = 3.515e-51
Identity = 121/222 (54.50%), Postives = 159/222 (71.62%), Query Frame = 3
Query:  333 EALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
            EALK+    LE  EK+AA+AE EV ++ +R +L+E++L++ + RL  A  K EEA KAADESERG KV+E R++ DEE++   E QLKEAK+IAE+ADRKY+E ARKL I E DLER E R E A++K  ELEEEL+ V NN+KSLE   ++  Q+E+ YEE I+  TDKLK  E RA  AER VA L+  +D +EDEL A+K KYK +S+ELD A  ++T 
Sbjct:   62 EALKDAQEKLELAEKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESKCSELEEELKNVTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISDELDHALNDMTS 283          
BLAST of Tropomyosin-2 vs. UniProt/SwissProt
Match: sp|P42638|TPM2_SCHMA (Tropomyosin-2 OS=Schistosoma mansoni OX=6183 PE=2 SV=1)

HSP 1 Score: 303.138 bits (775), Expect = 1.216e-100
Identity = 206/283 (72.79%), Postives = 241/283 (85.16%), Query Frame = 3
Query:  150 MEAIXXXXXXXXXXXXNAMDEADXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVQTDCETAKEALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
            ME IKKKML+MK++KENA+DEADQLE +L+EKELE   KDEE+ E+ KK+QQV TD ETA+  L E N+ LE T+KRA EAE EV ++ KR R LED+LE TETRLQEATVK EEASKAADES+RGRKVLE R+ ADEER+ QLEEQLKE+ ++AEDADRKYDEAARKLAITEV+LERAESRLE+A++K+ ELEEELR+VGNN+KSLEISEQEA QREE YEE IRD T++LK+ E RA E+ER V TLQ + DR+EDEL+ EKEKYK LSEELDS FAELTG
Sbjct:    1 MEHIKKKMLAMKLDKENAVDEADQLEAKLREKELEMQTKDEEVAEVLKKIQQVDTDKETAQTQLAETNTKLEETDKRATEAEAEVASLQKRIRQLEDELESTETRLQEATVKLEEASKAADESDRGRKVLENRTFADEERINQLEEQLKESTFMAEDADRKYDEAARKLAITEVELERAESRLEAAESKITELEEELRIVGNNVKSLEISEQEAAQREEAYEENIRDLTERLKAAEDRAQESERLVNTLQADADRLEDELVTEKEKYKALSEELDSTFAELTG 283          
BLAST of Tropomyosin-2 vs. UniProt/SwissProt
Match: sp|O16127|TPM_ECHGR (Tropomyosin A (Fragment) OS=Echinococcus granulosus OX=6210 PE=2 SV=3)

HSP 1 Score: 301.212 bits (770), Expect = 5.484e-100
Identity = 161/232 (69.40%), Postives = 202/232 (87.07%), Query Frame = 3
Query:  306 VQTDCETAKEALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTGY 1001
            +QT+ +T +E+L+E  S LE TEKRA  AE EV AMT+R RLLE+D EQ+  RL E + K ++ASKAA+ESER RK LETRSI+D+ER+AQLEEQ+KEAKYIAEDA+RKYDEAAR+LA+TEVDLERAESRLE++++K++ELEEELR+VGNNMKSLE+SEQE++QREE YEETIRD T++LK+ EQRA EAERQV+ LQ EVDR+EDELL+EKE+Y+ +S ELD+ FAELT +
Sbjct:   47 IQTEVDTVQESLQEAISKLEETEKRATNAEAEVAAMTRRIRLLEEDFEQSSGRLTETSTKLDDASKAAEESERNRKTLETRSISDDERMAQLEEQVKEAKYIAEDAERKYDEAARRLAVTEVDLERAESRLETSESKIVELEEELRIVGNNMKSLEVSEQESLQREESYEETIRDLTERLKTAEQRAAEAERQVSKLQNEVDRLEDELLSEKERYRAISGELDTTFAELTSF 278          
BLAST of Tropomyosin-2 vs. UniProt/SwissProt
Match: sp|Q95PU1|TPM_ECHMU (Tropomyosin OS=Echinococcus multilocularis OX=6211 PE=2 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 5.635e-100
Identity = 161/232 (69.40%), Postives = 202/232 (87.07%), Query Frame = 3
Query:  306 VQTDCETAKEALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTGY 1001
            +QT+ +T +E+L+E  S LE TEKRA  AE EV AMT+R RLLE+D EQ+  RL E + K ++ASKAA+ESER RK LETRSI+D+ER+AQLEEQ+KEAKYIAEDA+RKYDEAAR+LA+TEVDLERAESRLE++++K++ELEEELR+VGNNMKSLE+SEQE++QREE YEETIRD T++LK+ EQRA EAERQV+ LQ EVDR+EDELL+EKE+Y+ +S ELD+ FAELT +
Sbjct:   53 IQTEVDTVQESLQEAISKLEETEKRATNAEAEVAAMTRRIRLLEEDFEQSSGRLTETSTKLDDASKAAEESERNRKTLETRSISDDERMAQLEEQVKEAKYIAEDAERKYDEAARRLAVTEVDLERAESRLETSESKIVELEEELRIVGNNMKSLEVSEQESLQREESYEETIRDLTERLKTAEQRAAEAERQVSKLQNEVDRLEDELLSEKERYRAISGELDTTFAELTSF 284          
BLAST of Tropomyosin-2 vs. UniProt/SwissProt
Match: sp|P42637|TPM1_SCHMA (Tropomyosin-1 OS=Schistosoma mansoni OX=6183 PE=2 SV=1)

HSP 1 Score: 297.745 bits (761), Expect = 1.639e-98
Identity = 167/231 (72.29%), Postives = 194/231 (83.98%), Query Frame = 3
Query:  309 QTDCETAKEALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTGY 1001
            Q DC+ A+E L+E  + LE T+KRA  AE EV AMT+R RLLE+DLE + +RL E   K EEASK A+ESERGRK LE RSIAD+ERL QLE+Q KEAKYIAEDADRKYDEAARKLAI EVD ERAE+RLE+A++K++ELEEELRVVGNNMK+LEISEQE+ QREE YEETIRD T++LK+ EQRATEAERQV+ LQ EVD +ED+LLAEKE+YK LS ELD  FAELTGY
Sbjct:   54 QIDCDEAQETLQEQMNKLEETDKRATNAEAEVAAMTRRIRLLEEDLEVSSSRLTETLTKLEEASKTAEESERGRKDLEIRSIADDERLNQLEDQQKEAKYIAEDADRKYDEAARKLAIAEVDFERAEARLEAAESKIVELEEELRVVGNNMKALEISEQESAQREESYEETIRDLTERLKAAEQRATEAERQVSKLQNEVDHLEDDLLAEKERYKALSGELDQTFAELTGY 284          
BLAST of Tropomyosin-2 vs. UniProt/SwissProt
Match: sp|Q26519|TPM_SCHJA (Tropomyosin OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 296.204 bits (757), Expect = 6.448e-98
Identity = 166/231 (71.86%), Postives = 193/231 (83.55%), Query Frame = 3
Query:  309 QTDCETAKEALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTGY 1001
            Q DC+  +E L+E  + LE TEKRA  AE +V AMT+R RLLE+DLE + +RL E   K EEASK A+ESERGRK LE RSIAD+ERL QLE+Q KEAKYIAEDADRKYDEAARKLAI EVD ERAE+RLE+A++K++ELEEELRVVGNNMK+LEISEQE+ QREE YEETIRD T++LK+ EQRATEAERQV+ LQ EVD +ED+LLAEKE+YK LS ELD  FAELTGY
Sbjct:   54 QIDCDEVQETLQEQMNKLEETEKRATNAEAQVAAMTRRIRLLEEDLEVSSSRLTETLTKLEEASKTAEESERGRKDLEIRSIADDERLNQLEDQQKEAKYIAEDADRKYDEAARKLAIAEVDFERAEARLEAAESKIVELEEELRVVGNNMKALEISEQESAQREESYEETIRDLTERLKAAEQRATEAERQVSKLQNEVDHLEDDLLAEKERYKALSGELDQTFAELTGY 284          
BLAST of Tropomyosin-2 vs. TrEMBL
Match: A0A267FJJ9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001652g1 PE=4 SV=1)

HSP 1 Score: 332.798 bits (852), Expect = 8.639e-110
Identity = 220/284 (77.46%), Postives = 253/284 (89.08%), Query Frame = 3
Query:  150 MEAIXXXXXXXXXXXXNAMDEADXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVQTDCETAKEALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTGY 1001
            M+AIKKKML+MK++KENAMD ADQ+E +LKEKE E  KK+EEM ELQKK  Q+Q + +TA+E+L   N+NLEATEKRA +AE EVQA+T+R RL+E+DLEQTETRL EAT K EEASKAADESERGRKVLE RSIAD+ER+  LEEQLKEAKYIAEDADRKYDEAARKLAITE DLERAESRLESA++K+LELEEELRVVG+NMKSLEISEQEA QREE YEETIRD +++LK+ EQRATEAERQVA LQ+EVDR+EDELL+EKE+YK +SEELD  FAELTGY
Sbjct:    1 MDAIKKKMLAMKLDKENAMDRADQVETKLKEKEDEMTKKEEEMGELQKKFSQLQQELDTAQESLAGANTNLEATEKRANDAEAEVQALTRRIRLIEEDLEQTETRLTEATQKLEEASKAADESERGRKVLENRSIADDERINTLEEQLKEAKYIAEDADRKYDEAARKLAITEGDLERAESRLESAESKILELEEELRVVGSNMKSLEISEQEAAQREESYEETIRDLSERLKTAEQRATEAERQVAKLQSEVDRLEDELLSEKERYKGISEELDQTFAELTGY 284          
BLAST of Tropomyosin-2 vs. TrEMBL
Match: A0A267GDX8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001652g4 PE=4 SV=1)

HSP 1 Score: 331.257 bits (848), Expect = 3.801e-109
Identity = 219/284 (77.11%), Postives = 253/284 (89.08%), Query Frame = 3
Query:  150 MEAIXXXXXXXXXXXXNAMDEADXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVQTDCETAKEALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTGY 1001
            M+AIKKKML+MK++KENAMD ADQ+E +LKEKE E  KK+EEM ELQKK  Q+Q + +TA+E+L   N+NLEATEKRA +AE EVQA+T+R RL+E+DLEQTETRL EAT K EEASKAADESERGRKVLE RSIAD+ER+  LEEQLKEAKYIAEDADRKYDEAARKLAITE DLERAESRLESA++K+LELEEELRVVG+NMKSLEISEQEA QREE YEETIR+ +++LK+ EQRATEAERQVA LQ+EVDR+EDELL+EKE+YK +SEELD  FAELTGY
Sbjct:    1 MDAIKKKMLAMKLDKENAMDRADQVETKLKEKEDEMTKKEEEMGELQKKFSQLQQELDTAQESLAGANTNLEATEKRANDAEAEVQALTRRIRLIEEDLEQTETRLTEATQKLEEASKAADESERGRKVLENRSIADDERINTLEEQLKEAKYIAEDADRKYDEAARKLAITEGDLERAESRLESAESKILELEEELRVVGSNMKSLEISEQEAAQREESYEETIRNLSERLKTAEQRATEAERQVAKLQSEVDRLEDELLSEKERYKGISEELDQTFAELTGY 284          
BLAST of Tropomyosin-2 vs. TrEMBL
Match: A0A267FWC7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001499g1 PE=4 SV=1)

HSP 1 Score: 330.872 bits (847), Expect = 5.271e-109
Identity = 181/232 (78.02%), Postives = 210/232 (90.52%), Query Frame = 3
Query:  306 VQTDCETAKEALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTGY 1001
            +Q D +TA+E+L   N+NLE TEKRA++AE EVQA+T+R RL+E+DLEQTE RLQEAT K EEASKAADESERGRKVLETRSIADEER+  LEEQLKEAK+IAEDADRKYDEAARKLAITEVDLERAESRLE+A++K+LELEEELRVVG+NMKSLEISEQEA QREE YEETIRD +++LK+ EQRA EAERQV+ LQ+EVDR+EDELL+EK++YK +SEELD  FAELTGY
Sbjct:   53 LQQDLDTAQESLTTTNTNLEGTEKRASDAEAEVQALTRRIRLIEEDLEQTEGRLQEATQKLEEASKAADESERGRKVLETRSIADEERVNTLEEQLKEAKFIAEDADRKYDEAARKLAITEVDLERAESRLEAAESKILELEEELRVVGSNMKSLEISEQEAAQREESYEETIRDLSERLKAAEQRAQEAERQVSKLQSEVDRLEDELLSEKDRYKGISEELDQTFAELTGY 284          
BLAST of Tropomyosin-2 vs. TrEMBL
Match: A0A267E821 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014037g1 PE=4 SV=1)

HSP 1 Score: 325.479 bits (833), Expect = 1.890e-107
Identity = 180/232 (77.59%), Postives = 209/232 (90.09%), Query Frame = 3
Query:  306 VQTDCETAKEALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTGY 1001
            +Q D +TA+E+    N+NLE TEKRA++AE EVQA+T+R RL+E+DLEQTE RLQEAT K EEASKAADESERGRKVLETRSIADEER+  LEEQLKEAK+IAEDADRKYDEAARKLAITEVDLERAESRLE+A++K+LELEEELRVVG+NMKSLEISEQEA QREE YEETIRD +++LK+ EQRA EAERQV+ LQ+EVDR+EDELL+EK++YK +SEELD  FAELTGY
Sbjct:   18 LQQDLDTAQES-SHTNTNLEGTEKRASDAEAEVQALTRRIRLIEEDLEQTEGRLQEATQKLEEASKAADESERGRKVLETRSIADEERVNTLEEQLKEAKFIAEDADRKYDEAARKLAITEVDLERAESRLEAAESKILELEEELRVVGSNMKSLEISEQEAAQREESYEETIRDLSERLKAAEQRAQEAERQVSKLQSEVDRLEDELLSEKDRYKGISEELDQTFAELTGY 248          
BLAST of Tropomyosin-2 vs. TrEMBL
Match: G4VN74 (Putative tropomyosin OS=Schistosoma mansoni OX=6183 GN=Smp_031770.4 PE=2 SV=1)

HSP 1 Score: 303.138 bits (775), Expect = 3.604e-98
Identity = 206/283 (72.79%), Postives = 241/283 (85.16%), Query Frame = 3
Query:  150 MEAIXXXXXXXXXXXXNAMDEADXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVQTDCETAKEALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
            ME IKKKML+MK++KENA+DEADQLE +L+EKELE   KDEE+ E+ KK+QQV TD ETA+  L E N+ LE T+KRA EAE EV ++ KR R LED+LE TETRLQEATVK EEASKAADES+RGRKVLE R+ ADEER+ QLEEQLKE+ ++AEDADRKYDEAARKLAITEV+LERAESRLE+A++K+ ELEEELR+VGNN+KSLEISEQEA QREE YEE IRD T++LK+ E RA E+ER V TLQ + DR+EDEL+ EKEKYK LSEELDS FAELTG
Sbjct:    1 MEHIKKKMLAMKLDKENAVDEADQLEAKLREKELEMQTKDEEVAEVLKKIQQVDTDKETAQTQLAETNTKLEETDKRATEAEAEVASLQKRIRQLEDELESTETRLQEATVKLEEASKAADESDRGRKVLENRTFADEERINQLEEQLKESTFMAEDADRKYDEAARKLAITEVELERAESRLEAAESKITELEEELRIVGNNVKSLEISEQEAAQREEAYEENIRDLTERLKAAEDRAQESERLVNTLQADADRLEDELVTEKEKYKALSEELDSTFAELTG 283          
BLAST of Tropomyosin-2 vs. Ensembl Cavefish
Match: tpm1 (tropomyosin 1 [Source:NCBI gene;Acc:103046255])

HSP 1 Score: 185.652 bits (470), Expect = 8.414e-56
Identity = 118/222 (53.15%), Postives = 158/222 (71.17%), Query Frame = 3
Query:  333 EALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
            EALK+    LE  EK+A +AEG+V ++ +R +L+E++L++ + RL  A  K EEA KAADESERG KV+E R++ DEE++   E QLKEAK+IAE+ADRKY+E ARKL I E +LER E R E +++K  ELEEEL+ V N +KSLE   ++  Q+E+ YEE I+  TDKLK  E RA  AER VA L+  +D +EDEL A+K KYK +SEELD A  ++T 
Sbjct:   62 EALKDAQEKLELAEKKATDAEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTEERAELSESKCAELEEELKTVTNTLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTS 283          
BLAST of Tropomyosin-2 vs. Ensembl Cavefish
Match: tpm1 (tropomyosin 1 [Source:NCBI gene;Acc:103046255])

HSP 1 Score: 185.652 bits (470), Expect = 8.414e-56
Identity = 118/222 (53.15%), Postives = 158/222 (71.17%), Query Frame = 3
Query:  333 EALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
            EALK+    LE  EK+A +AEG+V ++ +R +L+E++L++ + RL  A  K EEA KAADESERG KV+E R++ DEE++   E QLKEAK+IAE+ADRKY+E ARKL I E +LER E R E +++K  ELEEEL+ V N +KSLE   ++  Q+E+ YEE I+  TDKLK  E RA  AER VA L+  +D +EDEL A+K KYK +SEELD A  ++T 
Sbjct:   62 EALKDAQEKLELAEKKATDAEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTEERAELSESKCAELEEELKTVTNTLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTS 283          
BLAST of Tropomyosin-2 vs. Ensembl Cavefish
Match: tpma (tropomyosin alpha-1 chain [Source:NCBI gene;Acc:103040917])

HSP 1 Score: 181.8 bits (460), Expect = 2.373e-54
Identity = 117/222 (52.70%), Postives = 156/222 (70.27%), Query Frame = 3
Query:  333 EALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
            EALK+    LE  EK+A +AEG+V ++ +R +L+E++L++ + RL  A  K EEA KAADESERG KV+E R++ DEE++   E QLKEAK+IAE+ADRKY+E ARKL I E +LER E R E  + K  ELEEEL+ V N +KSLE   ++  Q+E+ YEE I+  TDKLK  E RA  AER VA L+  +D +EDEL ++K KYK +SEELD A  ++T 
Sbjct:   62 EALKDAQEKLELAEKKATDAEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTEERAELNEGKCSELEEELKTVTNLLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDMTS 283          
BLAST of Tropomyosin-2 vs. Ensembl Cavefish
Match: tpm2 (tropomyosin 2 (beta) [Source:ZFIN;Acc:ZDB-GENE-040625-114])

HSP 1 Score: 175.637 bits (444), Expect = 7.305e-52
Identity = 117/230 (50.87%), Postives = 159/230 (69.13%), Query Frame = 3
Query:  306 VQTDCETAKEALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELT 995
            V+ + +   E+LK+    LE  EK+A +AE EV ++ +R +L+E++L++ + RL  A  K EEA KAADESERG KV+E R+  DEE++   E QLKEAK+IAE+ADRKY+E ARKL I E DLER+E R E A+ K  +LEEEL+ V NN+KSLE   ++   +E+ YEE I+  T+KLK  E RA  AER VA L+  +D +EDE+ A+K K K LSEELD A  ++T
Sbjct:   53 VEDELDKYSESLKDAQEKLEQAEKKATDAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRATKDEEKMELQEMQLKEAKHIAEEADRKYEEVARKLVILEGDLERSEERAEVAEAKSGDLEEELKNVTNNLKSLEAQAEKYSTKEDKYEEEIKVLTEKLKEAETRAEFAERSVAKLEKTIDDLEDEVYAQKLKGKALSEELDLALNDMT 282          
BLAST of Tropomyosin-2 vs. Ensembl Cavefish
Match: tpm4a (tropomyosin alpha-1 chain [Source:NCBI gene;Acc:103036175])

HSP 1 Score: 174.866 bits (442), Expect = 2.854e-51
Identity = 119/222 (53.60%), Postives = 161/222 (72.52%), Query Frame = 3
Query:  333 EALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
            EALK+    LE +EK+AA+AEG+V A+ +R +L+E++L++ + RL  A  K EEA KAADESERG KV+E R++ DEE++   E QLKEAK+IAE+ADRKY+E ARKL I E +LERAE R E ++ K  +LEEEL+ V NN+KSLE   ++  ++E+ YEE I+  +DKLK  E RA  AER VA L+  +D +EDEL A+K KYK +SEELD A  ++T 
Sbjct:   91 EALKDAQEKLELSEKKAADAEGDVAALNRRIQLVEEELDRAQERLTTALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSECKASDLEEELKNVTNNLKSLEAQAEKYSEKEDKYEEEIKVLSDKLKEAETRAEFAERTVAKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTS 312          
BLAST of Tropomyosin-2 vs. Ensembl Sea Lamprey
Match: TPM4 (tropomyosin 4 [Source:HGNC Symbol;Acc:HGNC:12013])

HSP 1 Score: 176.407 bits (446), Expect = 6.541e-54
Identity = 108/204 (52.94%), Postives = 149/204 (73.04%), Query Frame = 3
Query:  387 EAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
            +AE +V ++ +R +L+E++L++ + RL  A  K EEA+KAADESERG KV+E R++ DEE++   E QLKEAK+IAE+ADRKY+E ARKL I E +LER E R E  + +V +LEEELRV+  NMKSL ++E++  Q+E+ YEE I+  TDKLK  E RA  AER VA L+  +D +EDEL ++K KYK +SEELD A  ++T 
Sbjct:    2 QAEADVASLNRRIQLVEEELDRAQERLATALQKLEEATKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGELERTEERAEVGETRVRQLEEELRVMDQNMKSLLVAEEQYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDMTA 205          
BLAST of Tropomyosin-2 vs. Ensembl Sea Lamprey
Match: tpm3 (tropomyosin 3 [Source:ZFIN;Acc:ZDB-GENE-030826-16])

HSP 1 Score: 174.481 bits (441), Expect = 3.439e-53
Identity = 111/204 (54.41%), Postives = 145/204 (71.08%), Query Frame = 3
Query:  387 EAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
            +AE +V ++ +R +L+E++L++ + RL  A  K EEA KAADESERG KV+E R+  DEE++   E QLKEAK+IAE++DRKY+E ARKL I E DLER E R E AD K  ELEEEL+VV NN+KSLE    +  Q+E+ YEE I+  TDKLK  E RA  AER VA L+  +D +EDE+ A+K KYK +SEELD A  ++T 
Sbjct:    1 QAEADVASLNRRIQLVEEELDRAQERLSTALQKLEEAEKAADESERGMKVIENRASKDEEKMELQEIQLKEAKHIAEESDRKYEEVARKLVILEGDLERTEERAEVADAKCSELEEELKVVTNNLKSLEAQSDKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKSIDDLEDEVYAQKLKYKSVSEELDLALNDMTS 204          
BLAST of Tropomyosin-2 vs. Ensembl Sea Lamprey
Match: TPM4 (tropomyosin 4 [Source:HGNC Symbol;Acc:HGNC:12013])

HSP 1 Score: 139.043 bits (349), Expect = 6.586e-40
Identity = 90/178 (50.56%), Postives = 126/178 (70.79%), Query Frame = 3
Query:  387 EAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIE 920
            +AE +V ++ +R +L+E++L++ + RL  A  K E+A KAADESERG KV+E R+  DEE++   E QLKEAK+IAE+ADRKY+E ARKL I E DLER E R E ++ +V ++E+ELR V   ++SL  SE++  Q+E+ YEE I+  TDKLK  E RA  AER VA L+  +D +E
Sbjct:    1 QAEADVASLNRRIQLVEEELDRAQERLTTALQKLEDAEKAADESERGMKVIENRAGKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAEISETRVRQMEDELRHVQEELRSLFASEEQYSQKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLE 178          
BLAST of Tropomyosin-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003430.1 (pep scaffold:Pmarinus_7.0:GL477772:12496:42818:-1 gene:ENSPMAG00000003137.1 transcript:ENSPMAT00000003430.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.1301 bits (235), Expect = 6.697e-23
Identity = 67/188 (35.64%), Postives = 117/188 (62.23%), Query Frame = 3
Query:  435 EDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
            E+ L+ T  +L  A  + EEA K ADES+RG +V+E+R++ + +RL + E+QL+EAK IAE+ADRK++EA  K    E ++++ +   + ++ +  +LEEELR+    ++SL+  E++ V +E   E+ ++    KL+  E RA   +R V  L+ +VD +E++L+  KE+  +++  LD    EL  
Sbjct:   49 EEKLDTTLEQLNSALRRLEEAEKVADESKRGTRVIESRAVKELQRLGRQEDQLREAKMIAENADRKFEEATNKFVHLESEMDKLDDHAKHSEFRAKQLEEELRLKSAQLQSLKAGEKKYVLKENKCEDELKMLRSKLREYENRADVGQRNVTKLEQQVDYMEEQLIKAKEENMEINRVLDQTLNELNS 236          
BLAST of Tropomyosin-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009404.1 (pep scaffold:Pmarinus_7.0:GL481466:589:9607:1 gene:ENSPMAG00000008509.1 transcript:ENSPMAT00000009404.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.707 bits (169), Expect = 5.619e-15
Identity = 49/120 (40.83%), Postives = 74/120 (61.67%), Query Frame = 3
Query:  639 EAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
            + ARKL + E DLERAE R + A+ K   LEE+L+ + N++KSL    +E  Q+E+ +EE I+  ++KLK  EQRA  AER V  L+  +D +E++L   KE+   +++ LD    EL  
Sbjct:    2 QVARKLIVLESDLERAEERADHAETKCSALEEDLKNMTNDLKSLMAQNEEYSQKEDKFEEEIKVLSEKLKEVEQRAEYAERTVVKLENSIDDLEEQLARAKEENLGINQVLDQTLLELNN 121          
BLAST of Tropomyosin-2 vs. Ensembl Nematostella
Match: EDO37230 (Predicted protein; Tropomyosin [Source:UniProtKB/TrEMBL;Acc:Q6S5G5])

HSP 1 Score: 123.25 bits (308), Expect = 5.661e-33
Identity = 98/206 (47.57%), Postives = 143/206 (69.42%), Query Frame = 3
Query:  378 RAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELT 995
            RA  AE EV A+TK+ + LEDDL+  E++L +   +  EA K ADESER RKVLE R  +DEERLA LE Q  +A    E+A+++Y+E + +L   E +LE AE + ++A+ +V ELEEE+ +VGNN++SLEISE +A +RE+ YE  IR+   KL+  E+RA +AE++V  L+ + + +E EL   KE+Y+++ EELDS  AEL+
Sbjct:   35 RADSAETEVAALTKQLQQLEDDLDAAESKLADTQGQLTEAEKQADESERARKVLENRGASDEERLASLERQYNDALERTEEAEKQYEEISERLQELENELEEAEQKADAAEARVKELEEEVTLVGNNLRSLEISEGKASEREDTYENQIRELETKLQDAEERAEKAEQKVQELEAQAEAMEAELEKAKEQYEKVKEELDSTLAELS 240          
BLAST of Tropomyosin-2 vs. Ensembl Nematostella
Match: EDO47561 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM94])

HSP 1 Score: 62.003 bits (149), Expect = 4.011e-11
Identity = 63/189 (33.33%), Postives = 97/189 (51.32%), Query Frame = 3
Query:  345 EVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVD 911
            E   +L+   +R  +AE  ++ M +R +LLED+L +    L +AT +  E     +E +   K L    +  +E L + E Q KEA  IAE+  + Y +A RK    ++D +RA+ RLE A  ++  LE +L   G  M  LE  ++ A +RE   EE I     +LK   +R   AER+V  LQ  +D
Sbjct:   20 EAKYHLKEALERGDKAEENIEGMIRRRKLLEDELARITASLDQATQQLFEKRNKTEEEQATEKELGHMELEIDEVLNERECQCKEALAIAEEKHQNYIDACRKHTKAQLDCDRAKERLEKAQERIESLEYDLHRAGETMVELEAKDEVASEREMEREEKIAFLQAELKKLVEREDIAEREVQKLQRIID 208          
BLAST of Tropomyosin-2 vs. Ensembl Nematostella
Match: EDO39668 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9G3])

HSP 1 Score: 55.8398 bits (133), Expect = 5.703e-9
Identity = 57/184 (30.98%), Postives = 93/184 (50.54%), Query Frame = 3
Query:  360 LEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVD 911
            L+  E+RA + E ++ +M KR  LL +DL++T    +E   + +   +  +      + LE+  +  +ERLA+LEE+ KEA       +    E  +K+ +TE +L +   RLE A   +  LE  +     NM SLE  + +A Q E   EE I    ++LK    RA +AER+   L+  +D
Sbjct:   29 LKDAEERAYQHESDLDSMQKRINLLSEDLDKTLEAYEEKKARLDSLEEKQESDGTVVRELESVELEGDERLAELEEKTKEAVATVNQKEHDNTEINQKIVVTETELSKVNERLERALETIERLEATIEEESTNMASLEQKDTDASQWEIEVEEKIGFLNEQLKEVLVRAEDAERRCGPLERLLD 212          
BLAST of Tropomyosin-2 vs. Ensembl Nematostella
Match: EDO42849 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0B9])

HSP 1 Score: 55.0694 bits (131), Expect = 9.767e-9
Identity = 61/191 (31.94%), Postives = 103/191 (53.93%), Query Frame = 3
Query:  399 EVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEEL 971
            E   + +R  LL  +LE+T  R++E     +     ++ +E  RK LE   +  +E++  LE +LKE + + ++      EA RK  +   DLERA  +  + +N++  LE  +     N++ LE S  EA +REE+ EE ++ F ++LK  EQR  +AER+   L    +RI D ++ E + YK+  EE+
Sbjct:   45 EASGIQRRITLLNSELEKTNERVEEQEKLLQNLVHNSEMNEEARKGLEESEMKGDEKIMDLEAKLKEMERVEKETLETLTEAERKEVVVTRDLERAIEKGRTLENRIQSLESTMGNALTNIQKLEASGDEAYEREELKEEKLKFFQEQLKQYEQRYEDAEREALKL----ERINDTIIIEIDSYKKKKEEI 231          
BLAST of Tropomyosin-2 vs. Ensembl Nematostella
Match: EDO47978 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKG4])

HSP 1 Score: 49.2914 bits (116), Expect = 7.526e-7
Identity = 58/203 (28.57%), Postives = 101/203 (49.75%), Query Frame = 3
Query:  384 AEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAEL 992
            A+ + E   + +   L E  L++TE  L +   +     K  ++  +  KVLE R +  +  L +LE   K A     DA+ +  E  R+L +T  +L +  +R    + +V ELE  L+V G +++ L ISE++   +E+ +   IR     L +T  RA E+ER+   L+ E D +E+E  A K+ Y  + +EL     ++
Sbjct:   37 AKDKNESATLRRSCSLTEHQLDKTEDILDQKLERLVMLHKKTEQDIQMLKVLEDRELEVDNSLDRLEPSAKAAIQRQHDAEMRCMEVQRRLTLTTSELHKIRARQREKEEEVRELENRLKVGGRSIQQLVISEEKYCDKEDEFRHRIRLLKANLAATILRAEESERRCMRLERENDMVEEETRAYKKNYDMMQKELHDTLNDI 239          
BLAST of Tropomyosin-2 vs. Ensembl Medaka
Match: ENSORLT00000015429.2 (tropomyosin alpha-1 chain [Source:NCBI gene;Acc:101164789])

HSP 1 Score: 191.045 bits (484), Expect = 7.679e-58
Identity = 119/222 (53.60%), Postives = 158/222 (71.17%), Query Frame = 3
Query:  333 EALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
            EALK+    LE  EK+A +AEG+V ++ +R +L+E++L++ + RL  A  K EEA KAADESERG KV+E R++ DEE++   E QLKEAK+IAE+ADRKY+E ARKL I E DLER E R E ++ K  ELEEEL+ V NN+KSLE   ++  Q+E+ YEE I+  TDKLK  E RA  AER VA L+  +D +EDEL ++K KYK +SEELD A  ++T 
Sbjct:   62 EALKDAQEKLELAEKKATDAEGDVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAADESERGMKVIENRAMKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTEERAELSEGKCSELEEELKTVQNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDMTS 283          
BLAST of Tropomyosin-2 vs. Ensembl Medaka
Match: tpm4a (tropomyosin 4 [Source:NCBI gene;Acc:101160801])

HSP 1 Score: 190.66 bits (483), Expect = 5.634e-57
Identity = 119/222 (53.60%), Postives = 159/222 (71.62%), Query Frame = 3
Query:  333 EALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
            E LK+    LE  EK+AA+AEG+V A+ +R +L+E++L++ + RL  A  K EEA KAADESERG KV+E R++ DEE++   E QLKEAK+IAE+ADRKY+E ARKL I E DLERAE R E +++K  +LEEEL+ V NN+KSLE   ++  ++E+ YEE I+  TDKLK  E RA  AER V  L+  +D +EDEL A+K KYK +SEELD A  ++T 
Sbjct:  119 EGLKDAQEKLELAEKKAADAEGDVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGDLERAEERAEVSESKASDLEEELKNVTNNLKSLEAQAEKYSEKEDKYEEEIKVLTDKLKEAETRAEFAERTVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTS 340          
BLAST of Tropomyosin-2 vs. Ensembl Medaka
Match: TPM1 (tropomyosin 1 [Source:NCBI gene;Acc:101168205])

HSP 1 Score: 184.496 bits (467), Expect = 2.232e-55
Identity = 117/222 (52.70%), Postives = 156/222 (70.27%), Query Frame = 3
Query:  333 EALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
            EALK+    LE  EK+A +AE +V ++ +R +L+E++L++ + RL  A  K EEA KAADESERG KV+E R++ DEE++   E QLKEAK+IAE+ADRKY+E ARKL I E DLER E R E ++ K  ELEEEL+ V NN+KSLE   ++   +E+ YEE I+  TDKLK  E RA  AER VA L+  +D +EDEL ++K KYK +SEELD A  ++T 
Sbjct:   62 EALKDAQEKLELAEKKATDAESDVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTEERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSLKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDMTS 283          
BLAST of Tropomyosin-2 vs. Ensembl Medaka
Match: ENSORLT00000046199.1 (tropomyosin alpha-1 chain [Source:NCBI gene;Acc:101164789])

HSP 1 Score: 179.104 bits (453), Expect = 1.253e-53
Identity = 118/243 (48.56%), Postives = 161/243 (66.26%), Query Frame = 3
Query:  312 TDCETAKEALKEVNSNLEATEKRAAE--------------AEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
            +  E  K+ +K +    +A E+RAA+              AEG+V ++ +R +L+E++L++ + RL  A  K EEA KAADESERG KV+E R++ DEE++   E QLKEAK+IAE+ADRKY+E ARKL I E DLER E R E ++ K  ELEEEL+ V NN+KSLE   ++  Q+E+ YEE I+  TDKLK  E RA  AER VA L+  +D +EDEL ++K KYK +SEELD A  ++T 
Sbjct:    5 SSLEAVKKKIKSLQEQADAAEERAAQLQRDLNQERSAREAAEGDVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAADESERGMKVIENRAMKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTEERAELSEGKCSELEEELKTVQNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDMTS 247          
BLAST of Tropomyosin-2 vs. Ensembl Medaka
Match: TPM1 (tropomyosin 1 [Source:NCBI gene;Acc:101168205])

HSP 1 Score: 171.014 bits (432), Expect = 1.272e-50
Identity = 108/203 (53.20%), Postives = 144/203 (70.94%), Query Frame = 3
Query:  390 AEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
            AE +V ++ +R +L+E++L++ + RL  A  K EEA KAADESERG KV+E R++ DEE++   E QLKEAK+IAE+ADRKY+E ARKL I E DLER E R E ++ K  ELEEEL+ V NN+KSLE   ++   +E+ YEE I+  TDKLK  E RA  AER VA L+  +D +EDEL ++K KYK +SEELD A  ++T 
Sbjct:   45 AESDVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTEERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSLKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDMTS 247          
BLAST of Tropomyosin-2 vs. Planmine SMEST
Match: SMESG000000190.1 (SMESG000000190.1)

HSP 1 Score: 431.024 bits (1107), Expect = 5.353e-152
Identity = 284/284 (100.00%), Postives = 284/284 (100.00%), Query Frame = 3
Query:  150 MEAIXXXXXXXXXXXXNAMDEADXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVQTDCETAKEALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTGY 1001
            MEAIKKKMLSMKMEKENAMDEADQLEQQLKEKELEKLKKDEEMQELQKKLQQVQTDCETAKEALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVLELEEELRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTGY
Sbjct:    1 MEAIKKKMLSMKMEKENAMDEADQLEQQLKEKELEKLKKDEEMQELQKKLQQVQTDCETAKEALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVLELEEELRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTGY 284          
BLAST of Tropomyosin-2 vs. Planmine SMEST
Match: SMESG000074053.1 (SMESG000074053.1)

HSP 1 Score: 313.538 bits (802), Expect = 6.691e-106
Identity = 172/231 (74.46%), Postives = 205/231 (88.74%), Query Frame = 3
Query:  306 VQTDCETAKEALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
             QT+C+ A+EAL E N+ LEATEKRA +AE EV A+T+R +L+E DLEQTE+R QEA+ K EEASK A+ESE+ RK+LETRSIAD+E+LAQLEEQ+KEAKYIAEDADRKYDE ARKLAI EVDLER E+RLE+ ++K LELEEEL+VVGNNMKSLEISEQEA QREE YE+TIRD T++LK+ EQRATEAERQV+ LQ+EVDR+ED+LL+EKEKYK LS+ELD+AFAELTG
Sbjct:   46 AQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQEASAKLEEASKNAEESEKNRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTLELEEELKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKAAEQRATEAERQVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTG 276          
BLAST of Tropomyosin-2 vs. Planmine SMEST
Match: SMESG000074053.1 (SMESG000074053.1)

HSP 1 Score: 313.538 bits (802), Expect = 8.206e-106
Identity = 172/231 (74.46%), Postives = 205/231 (88.74%), Query Frame = 3
Query:  306 VQTDCETAKEALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
             QT+C+ A+EAL E N+ LEATEKRA +AE EV A+T+R +L+E DLEQTE+R QEA+ K EEASK A+ESE+ RK+LETRSIAD+E+LAQLEEQ+KEAKYIAEDADRKYDE ARKLAI EVDLER E+RLE+ ++K LELEEEL+VVGNNMKSLEISEQEA QREE YE+TIRD T++LK+ EQRATEAERQV+ LQ+EVDR+ED+LL+EKEKYK LS+ELD+AFAELTG
Sbjct:   53 AQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQEASAKLEEASKNAEESEKNRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTLELEEELKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKAAEQRATEAERQVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTG 283          
BLAST of Tropomyosin-2 vs. Planmine SMEST
Match: SMESG000066854.1 (SMESG000066854.1)

HSP 1 Score: 255.373 bits (651), Expect = 4.034e-83
Identity = 146/230 (63.48%), Postives = 183/230 (79.57%), Query Frame = 3
Query:  309 QTDCETAKEALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
            Q +C+  + AL EVNS  E TEKRA +AE EV A+ +R  LL+ D+EQTE R QEA+ K E ASK AD +E+ RK +E +S  ++E+L  LE+Q+KEAKYIAEDADRKY+EAARKLAI+ VDLER E+RLES + K  ELEEEL ++G NMK+LEISEQEA++REE YE+TIRD T++LK++EQRA EAERQVA L++EVDR+ED+LL E E+YK LS ELD AFAELT 
Sbjct:   47 QQECDKVQLALSEVNSKCEETEKRATDAESEVAALARRMVLLQTDIEQTENRFQEASEKLETASKLADINEKARKEIEVKSCLEDEKLNHLEQQVKEAKYIAEDADRKYEEAARKLAISAVDLERTETRLESCELKTAELEEELAIMGRNMKALEISEQEAMRREESYEDTIRDITERLKTSEQRAAEAERQVAKLESEVDRLEDDLLCEMERYKGLSGELDFAFAELTN 276          
BLAST of Tropomyosin-2 vs. Planmine SMEST
Match: SMESG000066854.1 (SMESG000066854.1)

HSP 1 Score: 255.373 bits (651), Expect = 6.274e-83
Identity = 146/230 (63.48%), Postives = 183/230 (79.57%), Query Frame = 3
Query:  309 QTDCETAKEALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVXXXXXXXRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 998
            Q +C+  + AL EVNS  E TEKRA +AE EV A+ +R  LL+ D+EQTE R QEA+ K E ASK AD +E+ RK +E +S  ++E+L  LE+Q+KEAKYIAEDADRKY+EAARKLAI+ VDLER E+RLES + K  ELEEEL ++G NMK+LEISEQEA++REE YE+TIRD T++LK++EQRA EAERQVA L++EVDR+ED+LL E E+YK LS ELD AFAELT 
Sbjct:   54 QQECDKVQLALSEVNSKCEETEKRATDAESEVAALARRMVLLQTDIEQTENRFQEASEKLETASKLADINEKARKEIEVKSCLEDEKLNHLEQQVKEAKYIAEDADRKYEEAARKLAISAVDLERTETRLESCELKTAELEEELAIMGRNMKALEISEQEAMRREESYEDTIRDITERLKTSEQRAAEAERQVAKLESEVDRLEDDLLCEMERYKGLSGELDFAFAELTN 283          
The following BLAST results are available for this feature:
BLAST of Tropomyosin-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TPM13.895e-5653.60tropomyosin 1 [Source:HGNC Symbol;Acc:HGNC:12010][more]
TPM14.380e-5653.60tropomyosin 1 [Source:HGNC Symbol;Acc:HGNC:12010][more]
TPM13.481e-5451.35tropomyosin 1 [Source:HGNC Symbol;Acc:HGNC:12010][more]
TPM31.150e-5154.95tropomyosin 3 [Source:HGNC Symbol;Acc:HGNC:12012][more]
TPM32.326e-5151.90tropomyosin 3 [Source:HGNC Symbol;Acc:HGNC:12012][more]
back to top
BLAST of Tropomyosin-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lev-116.162e-7261.47Tropomyosin isoforms a/b/d/f [Source:UniProtKB/Sw... [more]
lev-113.117e-6559.83Tropomyosin isoforms a/b/d/f [Source:UniProtKB/Sw... [more]
lev-111.613e-6460.26Tropomyosin isoforms a/b/d/f [Source:UniProtKB/Sw... [more]
lev-111.259e-6258.08Tropomyosin isoforms a/b/d/f [Source:UniProtKB/Sw... [more]
lev-114.164e-6264.77Tropomyosin isoforms a/b/d/f [Source:UniProtKB/Sw... [more]
back to top
BLAST of Tropomyosin-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tm12.362e-6657.21gene:FBgn0003721 transcript:FBtr0305654[more]
Tm12.362e-6657.21gene:FBgn0003721 transcript:FBtr0089964[more]
Tm12.362e-6657.21gene:FBgn0003721 transcript:FBtr0089967[more]
Tm12.362e-6657.21gene:FBgn0003721 transcript:FBtr0301959[more]
Tm12.852e-6256.09gene:FBgn0003721 transcript:FBtr0089957[more]
back to top
BLAST of Tropomyosin-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tpm31.948e-5754.50tropomyosin 3 [Source:ZFIN;Acc:ZDB-GENE-030826-16][more]
tpma5.822e-5653.60alpha-tropomyosin [Source:NCBI gene;Acc:30324][more]
tpm17.522e-5653.15tropomyosin 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-04... [more]
tpm17.850e-5653.15tropomyosin 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-04... [more]
tpm4a6.968e-5254.05tropomyosin 4a [Source:ZFIN;Acc:ZDB-GENE-040426-21... [more]
back to top
BLAST of Tropomyosin-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tpm15.463e-5854.50tropomyosin 1 [Source:NCBI gene;Acc:448541][more]
tpm16.366e-5854.50tropomyosin 1 [Source:NCBI gene;Acc:448541][more]
tpm14.600e-5351.80tropomyosin 1 [Source:NCBI gene;Acc:448541][more]
gucy2d1.387e-5053.60guanylate cyclase 2D, membrane (retina-specific) [... [more]
tpm11.189e-4943.63tropomyosin 1 [Source:NCBI gene;Acc:448541][more]
back to top
BLAST of Tropomyosin-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tpm12.025e-5653.60tropomyosin 1, alpha [Source:MGI Symbol;Acc:MGI:98... [more]
Tpm12.206e-5653.60tropomyosin 1, alpha [Source:MGI Symbol;Acc:MGI:98... [more]
Tpm12.195e-5451.35tropomyosin 1, alpha [Source:MGI Symbol;Acc:MGI:98... [more]
Tpm33.057e-5254.76tropomyosin 3, gamma [Source:MGI Symbol;Acc:MGI:18... [more]
Tpm33.515e-5154.50tropomyosin 3, gamma [Source:MGI Symbol;Acc:MGI:18... [more]
back to top
BLAST of Tropomyosin-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P42638|TPM2_SCHMA1.216e-10072.79Tropomyosin-2 OS=Schistosoma mansoni OX=6183 PE=2 ... [more]
sp|O16127|TPM_ECHGR5.484e-10069.40Tropomyosin A (Fragment) OS=Echinococcus granulosu... [more]
sp|Q95PU1|TPM_ECHMU5.635e-10069.40Tropomyosin OS=Echinococcus multilocularis OX=6211... [more]
sp|P42637|TPM1_SCHMA1.639e-9872.29Tropomyosin-1 OS=Schistosoma mansoni OX=6183 PE=2 ... [more]
sp|Q26519|TPM_SCHJA6.448e-9871.86Tropomyosin OS=Schistosoma japonicum OX=6182 PE=2 ... [more]
back to top
BLAST of Tropomyosin-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FJJ98.639e-11077.46Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GDX83.801e-10977.11Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FWC75.271e-10978.02Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267E8211.890e-10777.59Uncharacterized protein OS=Macrostomum lignano OX=... [more]
G4VN743.604e-9872.79Putative tropomyosin OS=Schistosoma mansoni OX=618... [more]
back to top
BLAST of Tropomyosin-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tpm18.414e-5653.15tropomyosin 1 [Source:NCBI gene;Acc:103046255][more]
tpm18.414e-5653.15tropomyosin 1 [Source:NCBI gene;Acc:103046255][more]
tpma2.373e-5452.70tropomyosin alpha-1 chain [Source:NCBI gene;Acc:10... [more]
tpm27.305e-5250.87tropomyosin 2 (beta) [Source:ZFIN;Acc:ZDB-GENE-040... [more]
tpm4a2.854e-5153.60tropomyosin alpha-1 chain [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Tropomyosin-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TPM46.541e-5452.94tropomyosin 4 [Source:HGNC Symbol;Acc:HGNC:12013][more]
tpm33.439e-5354.41tropomyosin 3 [Source:ZFIN;Acc:ZDB-GENE-030826-16][more]
TPM46.586e-4050.56tropomyosin 4 [Source:HGNC Symbol;Acc:HGNC:12013][more]
ENSPMAT00000003430.16.697e-2335.64pep scaffold:Pmarinus_7.0:GL477772:12496:42818:-1 ... [more]
ENSPMAT00000009404.15.619e-1540.83pep scaffold:Pmarinus_7.0:GL481466:589:9607:1 gene... [more]
back to top
BLAST of Tropomyosin-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tropomyosin-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO372305.661e-3347.57Predicted protein; Tropomyosin [Source:UniProtKB/... [more]
EDO475614.011e-1133.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO396685.703e-930.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428499.767e-931.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479787.526e-728.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tropomyosin-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000015429.27.679e-5853.60tropomyosin alpha-1 chain [Source:NCBI gene;Acc:10... [more]
tpm4a5.634e-5753.60tropomyosin 4 [Source:NCBI gene;Acc:101160801][more]
TPM12.232e-5552.70tropomyosin 1 [Source:NCBI gene;Acc:101168205][more]
ENSORLT00000046199.11.253e-5348.56tropomyosin alpha-1 chain [Source:NCBI gene;Acc:10... [more]
TPM11.272e-5053.20tropomyosin 1 [Source:NCBI gene;Acc:101168205][more]
back to top
BLAST of Tropomyosin-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000190.15.353e-152100.00SMESG000000190.1[more]
SMESG000074053.16.691e-10674.46SMESG000074053.1[more]
SMESG000074053.18.206e-10674.46SMESG000074053.1[more]
SMESG000066854.14.034e-8363.48SMESG000066854.1[more]
SMESG000066854.16.274e-8363.48SMESG000066854.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002983 ID=SMED30002983|Name=Tropomyosin-2|organism=Schmidtea mediterranea sexual|type=transcript|length=1179bp
CAAAATTCATGTTGTATAAAGATTCTCTAAAATTTATAAATTAATTCTGC
CTCCAATTTCTATTTCGATATTGATTTCTAACAGAATACAGTTTTTTTGC
TTTAAATTTTTTTTCAAAATCAACCTTTAAACATTCTTGTATTCTCAAAA
TGGAAGCAATTAAAAAGAAAATGTTGTCCATGAAAATGGAAAAAGAAAAC
GCCATGGATGAAGCAGATCAGTTGGAACAGCAATTGAAAGAAAAGGAATT
AGAAAAATTGAAAAAAGATGAAGAGATGCAAGAATTACAAAAAAAGTTAC
AGCAAGTACAAACCGACTGTGAAACTGCTAAAGAGGCATTGAAAGAAGTC
AACTCGAATCTTGAGGCGACTGAAAAGAGGGCAGCTGAAGCTGAAGGAGA
AGTTCAAGCAATGACTAAAAGAACGCGATTATTGGAAGATGATCTTGAAC
AAACAGAAACAAGGTTGCAGGAAGCTACGGTAAAATATGAAGAAGCAAGT
AAAGCAGCTGATGAAAGTGAACGAGGTCGCAAAGTCTTAGAAACTCGTTC
GATTGCAGACGAAGAAAGATTGGCGCAACTTGAGGAACAACTGAAAGAAG
CCAAATACATTGCCGAAGATGCTGATAGAAAATATGACGAAGCAGCGAGA
AAACTGGCAATCACCGAAGTCGATTTAGAACGAGCTGAGTCTCGACTAGA
ATCGGCTGATAATAAAGTTTTAGAACTCGAAGAAGAATTACGAGTTGTTG
GTAACAATATGAAATCACTTGAAATTTCCGAACAAGAAGCTGTTCAAAGA
GAAGAAGTTTATGAAGAAACGATCCGCGATTTCACTGATAAATTAAAATC
GACCGAGCAAAGAGCCACTGAAGCAGAACGTCAAGTAGCTACATTACAAA
CGGAAGTCGATAGAATTGAGGACGAATTATTGGCGGAAAAAGAAAAATAT
AAACAACTTAGTGAAGAATTGGATTCAGCCTTTGCTGAGCTCACTGGTTA
CTGAGGTCAAGGGTATCTAGCAATATCAATTGTGCATATTTTTATCCATA
AAGCCTCTTTTGTTTCGTTCGAAATTAGCGTTTTCAAAAAATGTGTCCCT
TTATGCTTGACATTTTTTATTTAGAAAATTTTATTAGATATTTCTGATAA
TAAATTATATCTATGGGTTTCAAAAAAAA
back to top

protein sequence of SMED30002983-orf-1

>SMED30002983-orf-1 ID=SMED30002983-orf-1|Name=SMED30002983-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=285bp
MEAIKKKMLSMKMEKENAMDEADQLEQQLKEKELEKLKKDEEMQELQKKL
QQVQTDCETAKEALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLE
QTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKE
AKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVLELEEELRVV
GNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQ
TEVDRIEDELLAEKEKYKQLSEELDSAFAELTGY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000019muscle progenitor cell
PLANA:0000028Category 2 cell
PLANA:0000101muscle cell
PLANA:0000428musculature system
PLANA:0000478pharynx musculature
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR000533Tropomyosin
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 218..280
NoneNo IPR availableCOILSCoilCoilcoord: 1..210
NoneNo IPR availableGENE3DG3DSA:1.20.5.340coord: 1..93
e-value: 7.9E-27
score: 95.5
NoneNo IPR availableGENE3DG3DSA:1.20.5.340coord: 94..139
e-value: 1.1E-6
score: 30.6
coord: 160..259
e-value: 1.0E-16
score: 62.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..21
NoneNo IPR availablePANTHERPTHR19269TROPOMYOSINcoord: 1..282
NoneNo IPR availableSUPERFAMILYSSF57997Tropomyosincoord: 1..284
IPR000533TropomyosinPRINTSPR00194TROPOMYOSINcoord: 84..101
score: 36.35
coord: 145..173
score: 75.43
coord: 175..198
score: 60.84
coord: 120..140
score: 68.61
coord: 231..256
score: 51.83
IPR000533TropomyosinPFAMPF00261Tropomyosincoord: 48..283
e-value: 9.2E-87
score: 290.3