Ubiquitin-like modifier-activating enzyme 5

Overview
NameUbiquitin-like modifier-activating enzyme 5
Smed IDSMED30002972
Length (bp)1370
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ubiquitin-like modifier-activating enzyme 5 (SMED30002972) t-SNE clustered cells

Violin plots show distribution of expression levels for Ubiquitin-like modifier-activating enzyme 5 (SMED30002972) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ubiquitin-like modifier-activating enzyme 5 (SMED30002972) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ubiquitin-like modifier-activating enzyme 5 (SMED30002972) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002972

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30002972SMESG000020505.1 dd_Smed_v4_2151_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002972SMESG000020505.1 dd_Smed_v4_2151_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002972SMESG000020505.1 dd_Smed_v4_2151_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002972SMESG000072336.1 SMESG000020505.1 Contig49276newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002972SMESG000072336.1 SMESG000020505.1 Contig49276uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Human
Match: UBA5 (ubiquitin like modifier activating enzyme 5 [Source:HGNC Symbol;Acc:HGNC:23230])

HSP 1 Score: 404.445 bits (1038), Expect = 3.488e-139
Identity = 199/286 (69.58%), Postives = 242/286 (84.62%), Query Frame = 3
Query:  162 DMDNKRSKIDEMSAEVVDSNPYSRLMALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIGKLILFDYDKVELANMNRLFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGGIN-NQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLPPLIVASGVDEKTLKRDGVCAASLPTTMAIVSGFLVQNTLKYLLEFGTVSEFIGYGAIQDNFYKVSLKPNPECGDRFCLKRQSEYQE 1016
            D    R +I++MS+EVVDSNPYSRLMAL+RMGIV +Y KIR  +VA+VGVGGVGSVTAEML RCGIGKL+LFDYDKVELANMNRLFFQP+Q+G+SKV+AA+ TL  INPDV  E HNYNIT + NF+HF+ R++ GG+   +P+D+VLSCVDNFEARMTIN ACNEL Q W+ESGVSENAVSGHIQL+ PG++ CF C PPL+VA+ +DEKTLKR+GVCAASLPTTM +V+G LVQN LK+LL FGTVS ++GY A+QD F  +S+KPNP+C DR C K+Q EY++
Sbjct:   32 DGGGGRVRIEKMSSEVVDSNPYSRLMALKRMGIVSDYEKIRTFAVAIVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVELANMNRLFFQPHQAGLSKVQAAEHTLRNINPDVLFEVHNYNITTVENFQHFMDRISNGGLEEGKPVDLVLSCVDNFEARMTINTACNELGQTWMESGVSENAVSGHIQLIIPGESACFACAPPLVVAANIDEKTLKREGVCAASLPTTMGVVAGILVQNVLKFLLNFGTVSFYLGYNAMQDFFPTMSMKPNPQCDDRNCRKQQEEYKK 317          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Human
Match: UBA5 (ubiquitin like modifier activating enzyme 5 [Source:HGNC Symbol;Acc:HGNC:23230])

HSP 1 Score: 405.986 bits (1042), Expect = 7.085e-139
Identity = 229/377 (60.74%), Postives = 291/377 (77.19%), Query Frame = 3
Query:  162 DMDNKRSKIDEMSAEVVDSNPYSRLMALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIGKLILFDYDKVELANMNRLFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGGIN-NQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLPPLIVASGVDEKTLKRDGVCAASLPTTMAIVSGFLVQNTLKYLLEFGTVSEFIGYGAIQDNFYKVSLKPNPECGDRFCLKRQSEYQEFMRNNISISNAEVVKEEIVHEDNEFQIELVSDEED------SLPAVGQPSLGDGVKLAYNPVKSRKEN--EEFVHKTDLSLDELMKQMKNL 1265
            D    R +I++MS+EVVDSNPYSRLMAL+RMGIV +Y KIR  +VA+VGVGGVGSVTAEML RCGIGKL+LFDYDKVELANMNRLFFQP+Q+G+SKV+AA+ TL  INPDV  E HNYNIT + NF+HF+ R++ GG+   +P+D+VLSCVDNFEARMTIN ACNEL Q W+ESGVSENAVSGHIQL+ PG++ CF C PPL+VA+ +DEKTLKR+GVCAASLPTTM +V+G LVQN LK+LL FGTVS ++GY A+QD F  +S+KPNP+C DR C K+Q EY++ +   +        +EEI+HEDNE+ IELVS+  +      S P    P L +G+ +AY   K ++++  E  V  +  SL++LM +MKN+
Sbjct:   32 DGGGGRVRIEKMSSEVVDSNPYSRLMALKRMGIVSDYEKIRTFAVAIVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVELANMNRLFFQPHQAGLSKVQAAEHTLRNINPDVLFEVHNYNITTVENFQHFMDRISNGGLEEGKPVDLVLSCVDNFEARMTINTACNELGQTWMESGVSENAVSGHIQLIIPGESACFACAPPLVVAANIDEKTLKREGVCAASLPTTMGVVAGILVQNVLKFLLNFGTVSFYLGYNAMQDFFPTMSMKPNPQCDDRNCRKQQEEYKKKVA-ALPKQEVIQEEEEIIHEDNEWGIELVSEVSEEELKNFSGPV---PDLPEGITVAYTIPKKQEDSVTELTVEDSGESLEDLMAKMKNM 404          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Human
Match: UBA5 (ubiquitin like modifier activating enzyme 5 [Source:HGNC Symbol;Acc:HGNC:23230])

HSP 1 Score: 404.06 bits (1037), Expect = 1.388e-138
Identity = 199/286 (69.58%), Postives = 242/286 (84.62%), Query Frame = 3
Query:  162 DMDNKRSKIDEMSAEVVDSNPYSRLMALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIGKLILFDYDKVELANMNRLFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGGIN-NQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLPPLIVASGVDEKTLKRDGVCAASLPTTMAIVSGFLVQNTLKYLLEFGTVSEFIGYGAIQDNFYKVSLKPNPECGDRFCLKRQSEYQE 1016
            D    R +I++MS+EVVDSNPYSRLMAL+RMGIV +Y KIR  +VA+VGVGGVGSVTAEML RCGIGKL+LFDYDKVELANMNRLFFQP+Q+G+SKV+AA+ TL  INPDV  E HNYNIT + NF+HF+ R++ GG+   +P+D+VLSCVDNFEARMTIN ACNEL Q W+ESGVSENAVSGHIQL+ PG++ CF C PPL+VA+ +DEKTLKR+GVCAASLPTTM +V+G LVQN LK+LL FGTVS ++GY A+QD F  +S+KPNP+C DR C K+Q EY++
Sbjct:   32 DGGGGRVRIEKMSSEVVDSNPYSRLMALKRMGIVSDYEKIRTFAVAIVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVELANMNRLFFQPHQAGLSKVQAAEHTLRNINPDVLFEVHNYNITTVENFQHFMDRISNGGLEEGKPVDLVLSCVDNFEARMTINTACNELGQTWMESGVSENAVSGHIQLIIPGESACFACAPPLVVAANIDEKTLKREGVCAASLPTTMGVVAGILVQNVLKFLLNFGTVSFYLGYNAMQDFFPTMSMKPNPQCDDRNCRKQQEEYKK 317          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Human
Match: UBA5 (ubiquitin like modifier activating enzyme 5 [Source:HGNC Symbol;Acc:HGNC:23230])

HSP 1 Score: 372.859 bits (956), Expect = 9.679e-127
Identity = 201/351 (57.26%), Postives = 261/351 (74.36%), Query Frame = 3
Query:  237 MALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIGKLILFDYDKVELANMNRLFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGGIN-NQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLPPLIVASGVDEKTLKRDGVCAASLPTTMAIVSGFLVQNTLKYLLEFGTVSEFIGYGAIQDNFYKVSLKPNPECGDRFCLKRQSEYQEFM-----RNNISISNAEVVKEEIVHEDNEFQIELVSDEEDSLPAVGQPSLGDGVKLAYNPVKSRKEN--EEFVHKTDLSLDELMKQMKNL 1265
            MAL+RMGIV +Y KIR  +VA+VGVGGVGSVTAEML RCGIGKL+LFDYDKVELANMNRLFFQP+Q+G+SKV+AA+ TL  INPDV  E HNYNIT + NF+HF+ R++ GG+   +P+D+VLSCVDNFEARMTIN ACNEL Q W+ESGVSENAVSGHIQL+ PG++ CF C PPL+VA+ +DEKTLKR+GVCAASLPTTM +V+G LVQN LK+LL FGTVS ++GY A+QD F  +S+KPNP+C DR C K+Q EY++ +     +  I      + ++     +   ++     +  S P    P L +G+ +AY   K ++++  E  V  +  SL++LM +MKN+
Sbjct:    1 MALKRMGIVSDYEKIRTFAVAIVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVELANMNRLFFQPHQAGLSKVQAAEHTLRNINPDVLFEVHNYNITTVENFQHFMDRISNGGLEEGKPVDLVLSCVDNFEARMTINTACNELGQTWMESGVSENAVSGHIQLIIPGESACFACAPPLVVAANIDEKTLKREGVCAASLPTTMGVVAGILVQNVLKFLLNFGTVSFYLGYNAMQDFFPTMSMKPNPQCDDRNCRKQQEEYKKKVAALPKQEVIQEEEEIIHEDNEWGIELVSEVSEEELKNFSGPV---PDLPEGITVAYTIPKKQEDSVTELTVEDSGESLEDLMAKMKNM 348          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Human
Match: UBA5 (ubiquitin like modifier activating enzyme 5 [Source:HGNC Symbol;Acc:HGNC:23230])

HSP 1 Score: 372.859 bits (956), Expect = 9.679e-127
Identity = 201/351 (57.26%), Postives = 261/351 (74.36%), Query Frame = 3
Query:  237 MALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIGKLILFDYDKVELANMNRLFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGGIN-NQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLPPLIVASGVDEKTLKRDGVCAASLPTTMAIVSGFLVQNTLKYLLEFGTVSEFIGYGAIQDNFYKVSLKPNPECGDRFCLKRQSEYQEFM-----RNNISISNAEVVKEEIVHEDNEFQIELVSDEEDSLPAVGQPSLGDGVKLAYNPVKSRKEN--EEFVHKTDLSLDELMKQMKNL 1265
            MAL+RMGIV +Y KIR  +VA+VGVGGVGSVTAEML RCGIGKL+LFDYDKVELANMNRLFFQP+Q+G+SKV+AA+ TL  INPDV  E HNYNIT + NF+HF+ R++ GG+   +P+D+VLSCVDNFEARMTIN ACNEL Q W+ESGVSENAVSGHIQL+ PG++ CF C PPL+VA+ +DEKTLKR+GVCAASLPTTM +V+G LVQN LK+LL FGTVS ++GY A+QD F  +S+KPNP+C DR C K+Q EY++ +     +  I      + ++     +   ++     +  S P    P L +G+ +AY   K ++++  E  V  +  SL++LM +MKN+
Sbjct:    1 MALKRMGIVSDYEKIRTFAVAIVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVELANMNRLFFQPHQAGLSKVQAAEHTLRNINPDVLFEVHNYNITTVENFQHFMDRISNGGLEEGKPVDLVLSCVDNFEARMTINTACNELGQTWMESGVSENAVSGHIQLIIPGESACFACAPPLVVAANIDEKTLKREGVCAASLPTTMGVVAGILVQNVLKFLLNFGTVSFYLGYNAMQDFFPTMSMKPNPQCDDRNCRKQQEEYKKKVAALPKQEVIQEEEEIIHEDNEWGIELVSEVSEEELKNFSGPV---PDLPEGITVAYTIPKKQEDSVTELTVEDSGESLEDLMAKMKNM 348          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Celegans
Match: uba-5 (Ubiquitin-like modifier-activating enzyme 5 [Source:UniProtKB/Swiss-Prot;Acc:P91430])

HSP 1 Score: 433.721 bits (1114), Expect = 4.588e-150
Identity = 226/363 (62.26%), Postives = 283/363 (77.96%), Query Frame = 3
Query:  177 RSKIDEMSAEVVDSNPYSRLMALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIGKLILFDYDKVELANMNRLFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGGINNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLPPLIVASGVDEKTLKRDGVCAASLPTTMAIVSGFLVQNTLKYLLEFGTVSEFIGYGAIQDNFYKVSLKPNPECGDRFCLKRQSEYQEFMRNN-ISISNAEVVKEEIVHEDNEFQIELVSDEEDSLPAVGQPSLGDGVKLAYNPVKSRKENEEFVHKTDLSLDELMKQMKN 1262
            R KI+++SAEVVDSNPYSRLMALQRMGIV  Y +IR+K+VAVVGVGGVGSV AEML RCGIGKLILFDYDKVE+ANMNRLF+QP Q+G+SKVEAA+ TL  +NPDV+IE HN+NIT ++NF+ F+ R+ +G + +  ID+VLSCVDNFEARM +N ACNE NQIW+ESGVSENAVSGHIQ + PGKT CF C+PPL+VASG+DE+TLKRDGVCAASLPTTMA+V+GFLV NTLKYLL FG VS+++GY A+ D F + S+KPNP C D  CL+RQ EY+E + N  + +      +E +VHEDNE+ IELV++ E S       + G G+K AY P+K   + E  +     +  + MK +K+
Sbjct:   48 RQKIEKLSAEVVDSNPYSRLMALQRMGIVNEYERIREKTVAVVGVGGVGSVVAEMLTRCGIGKLILFDYDKVEIANMNRLFYQPNQAGLSKVEAARDTLIHVNPDVQIEVHNFNITTMDNFDTFVNRIRKGSLTDGKIDLVLSCVDNFEARMAVNMACNEENQIWMESGVSENAVSGHIQYIEPGKTACFACVPPLVVASGIDERTLKRDGVCAASLPTTMAVVAGFLVMNTLKYLLNFGEVSQYVGYNALSDFFPRDSIKPNPYCDDSHCLQRQKEYEEKVANQPVDLEVEVPEEETVVHEDNEWGIELVNESEPSAEQSSSLNAGTGLKFAYEPIKRDAQTE--LSPAQAATHDFMKSIKD 408          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Celegans
Match: uba-5 (Ubiquitin-like modifier-activating enzyme 5 [Source:UniProtKB/Swiss-Prot;Acc:P91430])

HSP 1 Score: 433.721 bits (1114), Expect = 4.588e-150
Identity = 226/363 (62.26%), Postives = 283/363 (77.96%), Query Frame = 3
Query:  177 RSKIDEMSAEVVDSNPYSRLMALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIGKLILFDYDKVELANMNRLFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGGINNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLPPLIVASGVDEKTLKRDGVCAASLPTTMAIVSGFLVQNTLKYLLEFGTVSEFIGYGAIQDNFYKVSLKPNPECGDRFCLKRQSEYQEFMRNN-ISISNAEVVKEEIVHEDNEFQIELVSDEEDSLPAVGQPSLGDGVKLAYNPVKSRKENEEFVHKTDLSLDELMKQMKN 1262
            R KI+++SAEVVDSNPYSRLMALQRMGIV  Y +IR+K+VAVVGVGGVGSV AEML RCGIGKLILFDYDKVE+ANMNRLF+QP Q+G+SKVEAA+ TL  +NPDV+IE HN+NIT ++NF+ F+ R+ +G + +  ID+VLSCVDNFEARM +N ACNE NQIW+ESGVSENAVSGHIQ + PGKT CF C+PPL+VASG+DE+TLKRDGVCAASLPTTMA+V+GFLV NTLKYLL FG VS+++GY A+ D F + S+KPNP C D  CL+RQ EY+E + N  + +      +E +VHEDNE+ IELV++ E S       + G G+K AY P+K   + E  +     +  + MK +K+
Sbjct:   48 RQKIEKLSAEVVDSNPYSRLMALQRMGIVNEYERIREKTVAVVGVGGVGSVVAEMLTRCGIGKLILFDYDKVEIANMNRLFYQPNQAGLSKVEAARDTLIHVNPDVQIEVHNFNITTMDNFDTFVNRIRKGSLTDGKIDLVLSCVDNFEARMAVNMACNEENQIWMESGVSENAVSGHIQYIEPGKTACFACVPPLVVASGIDERTLKRDGVCAASLPTTMAVVAGFLVMNTLKYLLNFGEVSQYVGYNALSDFFPRDSIKPNPYCDDSHCLQRQKEYEEKVANQPVDLEVEVPEEETVVHEDNEWGIELVNESEPSAEQSSSLNAGTGLKFAYEPIKRDAQTE--LSPAQAATHDFMKSIKD 408          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Celegans
Match: moc-3 (Adenylyltransferase and sulfurtransferase MOCS3 Molybdopterin-synthase adenylyltransferase Molybdopterin-synthase sulfurtransferase [Source:UniProtKB/Swiss-Prot;Acc:O44510])

HSP 1 Score: 64.6994 bits (156), Expect = 4.934e-11
Identity = 57/185 (30.81%), Postives = 89/185 (48.11%), Query Frame = 3
Query:  213 DSNPYSRLMALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIGKLILFDYDKVELANMNR-LFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGGINNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGK-TPCFECLPP 761
            D+  YSR + +   G V     +++ +V +VG GG+G   A  L   GIG + + DYD + L N++R + ++  Q G SK +A    ++  N D+ ++ HN ++   N  + F           +  +IV  C DN   R  IN  C  LN I + SG S     G + + H G   PC+ CL P
Sbjct:   14 DAGRYSRQLLVDDFG-VSGQKNLKNLNVLIVGAGGLGCPVATYLGAAGIGTIGIVDYDHISLDNLHRQVAYKEDQVGKSKAQALADNIKLQNSDLNVQVHNTSLDSSNAMQLF-----------KNYEIVCDCTDNVATRYLINDVCVLLN-IPLVSG-SALRWDGQLSVYHYGSDCPCYRCLFP 184          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Celegans
Match: uba-2 (SUMO-activating enzyme subunit uba-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9NAN1])

HSP 1 Score: 57.7658 bits (138), Expect = 1.009e-8
Identity = 40/140 (28.57%), Postives = 66/140 (47.14%), Query Frame = 3
Query:  342 LVRCGIGKLILFDYDKVELANMNRLF-FQPYQSGMSKVEAAKSTLEFINPDVKIE-AHNYNITLINNFEHFLGRLNQGGINNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECL 755
            L   G  K+ + D D ++++N+NR F F+      SK   A   ++   P +++   H+       N E F           Q  DIVL+ +DN  AR  +N+ C+  N+  I+SG       G + ++  GKT C+EC+
Sbjct:   32 LAVTGFRKVHVIDLDTIDISNLNRQFLFRKEHVSSSKAATATQVVKQFCPQIELTFDHDSIFEKKYNMEFF-----------QAYDIVLNALDNRAARNYVNRMCHAANRPLIDSG--SGGYFGQVSVIMRGKTECYECV 158          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Celegans
Match: uba-1 (UBA (Human ubiquitin) related [Source:UniProtKB/TrEMBL;Acc:Q27481])

HSP 1 Score: 53.9138 bits (128), Expect = 1.849e-7
Identity = 44/141 (31.21%), Postives = 67/141 (47.52%), Query Frame = 3
Query:  339 MLVRCGIGKLI-LFDYDKVELANMNRLF-FQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNF---EHFLGRLNQGGINNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCF 746
            M V CG G LI + D D++E++N+NR F F+    G  K E A   +   N DV+IEA    + L       + F G LN  G+ N         +DN +AR  +++ C       +ESG       G+ Q+++P  T  +
Sbjct:  538 MGVACGEGGLIKITDMDQIEISNLNRQFLFRRRDVGGKKSECAARAVTAFNSDVRIEALAERVGLETEHIFNDEFFGELN--GVAN--------ALDNVDARRYMDRRCVYYRLPLLESGTM--GTKGNTQVVYPYLTESY 666          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Fly
Match: Uba5 (gene:FBgn0030305 transcript:FBtr0073505)

HSP 1 Score: 449.129 bits (1154), Expect = 3.310e-156
Identity = 236/371 (63.61%), Postives = 285/371 (76.82%), Query Frame = 3
Query:  177 RSKIDEMSAEVVDSNPYSRLMALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIGKLILFDYDKVELANMNRLFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGG-INNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLPPLIVASGVDEKTLKRDGVCAASLPTTMAIVSGFLVQNTLKYLLEFGTVSEFIGYGAIQDNFYKVSLKPNPECGDRFCLKRQSEYQEFMRNNISISNAEVVKEEIVHEDNEFQIELVSD---EEDSLPAVGQPSLGDGVKLAYN-PVKSRKENEEFVHKT---DLSLDELMKQMKNL 1265
            R +ID MSAEVVDSNPYSRLMALQRM IV++Y +IR K+VA+VGVGGVGSVTA+ML RCGIGKLILFDYDKVELANMNRLFF P Q+G+SKV AA +TL FINPDV+IE HNYNIT + NF+ FL  ++QGG I  QP+D+VLSCVDNFEARM IN ACNE N  W ESGVSENAVSGHIQ + PG T CF C PPL+VA  +DEKTLKR+GVCAASLPTTM I +GFLVQN LKYLL FG VS+++GY A+ D F K++LKPNP+C DR CL RQ E+Q   R    +   + V EE +H  NE+ IELV++   E ++ PA   P +G+G++LAY  P KS + +EE V      + SL++LM QMK++
Sbjct:   37 RDRIDRMSAEVVDSNPYSRLMALQRMNIVKDYERIRYKAVAIVGVGGVGSVTADMLTRCGIGKLILFDYDKVELANMNRLFFTPDQAGLSKVAAAAATLSFINPDVEIETHNYNITTVENFDRFLDTISQGGRIAGQPVDLVLSCVDNFEARMAINAACNERNLNWFESGVSENAVSGHIQFIRPGDTACFACAPPLVVAENIDEKTLKREGVCAASLPTTMGITAGFLVQNALKYLLNFGEVSDYLGYNALSDFFPKMTLKPNPQCDDRNCLVRQKEFQ--ARPKPVLIEEKAVSEEPLHATNEWGIELVAEDAPESNTTPA-ETPVMGEGLRLAYEAPEKSSETSEETVSAATADETSLEDLMAQMKSM 404          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Fly
Match: Uba2 (gene:FBgn0029113 transcript:FBtr0076734)

HSP 1 Score: 74.3294 bits (181), Expect = 7.932e-14
Identity = 45/140 (32.14%), Postives = 71/140 (50.71%), Query Frame = 3
Query:  342 LVRCGIGKLILFDYDKVELANMNRLF-FQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGGINNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLP 758
            LV  G   + + D D ++L+N+NR F F     G SK   A+ +    NPD KI A++ ++T  +   +F  +           D+VLS +DN  AR  +N+ C   +   IESG +    +G ++L+  G T C+EC P
Sbjct:   38 LVLSGFTDIEIIDLDTIDLSNLNRQFLFHREHVGKSKARVARESALSFNPDAKITAYHDSVTSTDYGVNFFKKF----------DLVLSALDNRAARNHVNRMCLNADVPLIESGTA--GYNGQVELIKRGLTQCYECTP 165          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Fly
Match: Uba4 (gene:FBgn0032054 transcript:FBtr0079683)

HSP 1 Score: 67.781 bits (164), Expect = 6.237e-12
Identity = 56/181 (30.94%), Postives = 93/181 (51.38%), Query Frame = 3
Query:  225 YSRLMALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIGKLILFDYDKVELANMNR-LFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGGINNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLPPL 764
            YSR + L   G V+   K+++ SV +VG+GG+G   A+ L   G G L L DYD+VE +N +R +     + GMSK E+A+  L  +NP  +I+ H+  +   +N  H +          +  D+VL C DN   R  ++ AC  L++  +    S   + G + + +    PC+ C+ P+
Sbjct:   72 YSRQLILPDFG-VQGQLKLKNSSVLIVGLGGLGCPAAQYLAAAGCGHLGLVDYDEVERSNFHRQILHSEDRCGMSKAESARIALLELNPHCEIQCHS-RMLYPHNAMHII----------RGYDVVLDCTDNVPTRYLLSDACVMLSKPLVSG--SALKMDGQLTVYNYANGPCYRCIFPV 238          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Fly
Match: Uba4 (gene:FBgn0032054 transcript:FBtr0333414)

HSP 1 Score: 67.781 bits (164), Expect = 6.237e-12
Identity = 56/181 (30.94%), Postives = 93/181 (51.38%), Query Frame = 3
Query:  225 YSRLMALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIGKLILFDYDKVELANMNR-LFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGGINNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLPPL 764
            YSR + L   G V+   K+++ SV +VG+GG+G   A+ L   G G L L DYD+VE +N +R +     + GMSK E+A+  L  +NP  +I+ H+  +   +N  H +          +  D+VL C DN   R  ++ AC  L++  +    S   + G + + +    PC+ C+ P+
Sbjct:   72 YSRQLILPDFG-VQGQLKLKNSSVLIVGLGGLGCPAAQYLAAAGCGHLGLVDYDEVERSNFHRQILHSEDRCGMSKAESARIALLELNPHCEIQCHS-RMLYPHNAMHII----------RGYDVVLDCTDNVPTRYLLSDACVMLSKPLVSG--SALKMDGQLTVYNYANGPCYRCIFPV 238          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Fly
Match: Uba4 (gene:FBgn0032054 transcript:FBtr0333413)

HSP 1 Score: 67.781 bits (164), Expect = 6.237e-12
Identity = 56/181 (30.94%), Postives = 93/181 (51.38%), Query Frame = 3
Query:  225 YSRLMALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIGKLILFDYDKVELANMNR-LFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGGINNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLPPL 764
            YSR + L   G V+   K+++ SV +VG+GG+G   A+ L   G G L L DYD+VE +N +R +     + GMSK E+A+  L  +NP  +I+ H+  +   +N  H +          +  D+VL C DN   R  ++ AC  L++  +    S   + G + + +    PC+ C+ P+
Sbjct:   72 YSRQLILPDFG-VQGQLKLKNSSVLIVGLGGLGCPAAQYLAAAGCGHLGLVDYDEVERSNFHRQILHSEDRCGMSKAESARIALLELNPHCEIQCHS-RMLYPHNAMHII----------RGYDVVLDCTDNVPTRYLLSDACVMLSKPLVSG--SALKMDGQLTVYNYANGPCYRCIFPV 238          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Zebrafish
Match: uba5 (ubiquitin-like modifier activating enzyme 5 [Source:NCBI gene;Acc:386712])

HSP 1 Score: 441.039 bits (1133), Expect = 5.434e-153
Identity = 234/369 (63.41%), Postives = 288/369 (78.05%), Query Frame = 3
Query:  171 NKRSKIDEMSAEVVDSNPYSRLMALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIGKLILFDYDKVELANMNRLFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGGIN-NQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLPPLIVASGVDEKTLKRDGVCAASLPTTMAIVSGFLVQNTLKYLLEFGTVSEFIGYGAIQDNFYKVSLKPNPECGDRFCLKRQSEYQEFMRNNISISNAEVVKEEIVHEDNEFQIELVSD--EEDSLPAVGQ-PSLGDGVKLAYNPVKSRKENEEFVHKTDLSLDELMKQMKNL 1265
            N R KI++MSAEVVDSNPYSRLMAL+RMGIV++Y KIR  +VAVVGVGGVGSVTAEML RCGIGKL+LFDYDKVELANMNRLFFQP+Q+G+SKVEAA+ TL  INPDV  E HNYNIT ++NF HF+ R++ GG+   +P+D++LSCVDNFEARM IN ACNEL QIW+ESGVSENAVSGHIQL+ PG+T CF C PPL+VA+ +DEKTLKRDGVCAASLPTTM +V+G LVQN LKYLL FGTVS ++GY A+QD F  +++K NP+C DR C ++Q EY++              +EE+VHEDNE+ IELVS+  E +   A G  P L +G+ +AY   +    + E V +T+ SL+ELM QMK +
Sbjct:   31 NIRPKIEQMSAEVVDSNPYSRLMALKRMGIVQDYEKIRSFAVAVVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVELANMNRLFFQPHQAGLSKVEAAQHTLRNINPDVAFETHNYNITTMDNFTHFMDRVSHGGLEEGKPVDLILSCVDNFEARMAINTACNELGQIWMESGVSENAVSGHIQLIIPGETACFACAPPLVVAANIDEKTLKRDGVCAASLPTTMGVVAGLLVQNVLKYLLGFGTVSYYLGYNAMQDFFPSMAMKANPQCDDRHCRRQQDEYKK-KEAERPKQEVVQEEEEVVHEDNEWGIELVSEVTEAELQDASGPIPDLPEGITVAYTIPEKDGGSGETVEETEQSLEELMAQMKKM 398          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Zebrafish
Match: uba5 (ubiquitin-like modifier activating enzyme 5 [Source:NCBI gene;Acc:386712])

HSP 1 Score: 436.032 bits (1120), Expect = 5.076e-151
Identity = 234/370 (63.24%), Postives = 287/370 (77.57%), Query Frame = 3
Query:  171 NKRSKIDEMSAEVVDSNPYSRLMALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIGKLILFDYDKVELANMNRLFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLN-QGGIN-NQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLPPLIVASGVDEKTLKRDGVCAASLPTTMAIVSGFLVQNTLKYLLEFGTVSEFIGYGAIQDNFYKVSLKPNPECGDRFCLKRQSEYQEFMRNNISISNAEVVKEEIVHEDNEFQIELVSD--EEDSLPAVGQ-PSLGDGVKLAYNPVKSRKENEEFVHKTDLSLDELMKQMKNL 1265
            N R KI++MSAEVVDSNPYSRLMAL+RMGIV++Y KIR  +VAVVGVGGVGSVTAEML RCGIGKL+LFDYDKVELANMNRLFFQP+Q+G+SKVEAA+ TL  INPDV  E HNYNIT ++NF HF+ R+   GG+   +P+D++LSCVDNFEARM IN ACNEL QIW+ESGVSENAVSGHIQL+ PG+T CF C PPL+VA+ +DEKTLKRDGVCAASLPTTM +V+G LVQN LKYLL FGTVS ++GY A+QD F  +++K NP+C DR C ++Q EY++              +EE+VHEDNE+ IELVS+  E +   A G  P L +G+ +AY   +    + E V +T+ SL+ELM QMK +
Sbjct:   31 NIRPKIEQMSAEVVDSNPYSRLMALKRMGIVQDYEKIRSFAVAVVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVELANMNRLFFQPHQAGLSKVEAAQHTLRNINPDVAFETHNYNITTMDNFTHFMDRVRYHGGLEEGKPVDLILSCVDNFEARMAINTACNELGQIWMESGVSENAVSGHIQLIIPGETACFACAPPLVVAANIDEKTLKRDGVCAASLPTTMGVVAGLLVQNVLKYLLGFGTVSYYLGYNAMQDFFPSMAMKANPQCDDRHCRRQQDEYKK-KEAERPKQEVVQEEEEVVHEDNEWGIELVSEVTEAELQDASGPIPDLPEGITVAYTIPEKDGGSGETVEETEQSLEELMAQMKKM 399          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Zebrafish
Match: uba2 (ubiquitin-like modifier activating enzyme 2 [Source:NCBI gene;Acc:406672])

HSP 1 Score: 62.3882 bits (150), Expect = 5.625e-10
Identity = 41/147 (27.89%), Postives = 68/147 (46.26%), Query Frame = 3
Query:  342 LVRCGIGKLILFDYDKVELANMNRLF-FQPYQSGMSKVEAAKSTLEFINPDVKIEAH-------NYNITLINNFEHFLGRLNQGGINNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLP 758
            LV  G   + + D D ++++N+NR F FQ    G SK + AK ++    P   I A+       +YN+    NF+                 +V++ +DN  AR  +N+ C   +   IESG +     G + ++  G+T C+EC P
Sbjct:   37 LVLTGFKNIEVIDLDTIDVSNLNRQFLFQKKHVGKSKAQVAKESVLRFCPSANITAYHDSIMNPDYNVEFFRNFQ-----------------LVMNALDNRAARNHVNRMCLAADIPLIESGTA--GYLGQVTVIKKGQTECYECQP 164          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Zebrafish
Match: uba2 (ubiquitin-like modifier activating enzyme 2 [Source:NCBI gene;Acc:406672])

HSP 1 Score: 62.3882 bits (150), Expect = 5.734e-10
Identity = 41/147 (27.89%), Postives = 68/147 (46.26%), Query Frame = 3
Query:  342 LVRCGIGKLILFDYDKVELANMNRLF-FQPYQSGMSKVEAAKSTLEFINPDVKIEAH-------NYNITLINNFEHFLGRLNQGGINNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLP 758
            LV  G   + + D D ++++N+NR F FQ    G SK + AK ++    P   I A+       +YN+    NF+                 +V++ +DN  AR  +N+ C   +   IESG +     G + ++  G+T C+EC P
Sbjct:   37 LVLTGFKNIEVIDLDTIDVSNLNRQFLFQKKHVGKSKAQVAKESVLRFCPSANITAYHDSIMNPDYNVEFFRNFQ-----------------LVMNALDNRAARNHVNRMCLAADIPLIESGTA--GYLGQVTVIKKGQTECYECQP 164          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Zebrafish
Match: uba2 (ubiquitin-like modifier activating enzyme 2 [Source:NCBI gene;Acc:406672])

HSP 1 Score: 62.3882 bits (150), Expect = 6.357e-10
Identity = 41/147 (27.89%), Postives = 68/147 (46.26%), Query Frame = 3
Query:  342 LVRCGIGKLILFDYDKVELANMNRLF-FQPYQSGMSKVEAAKSTLEFINPDVKIEAH-------NYNITLINNFEHFLGRLNQGGINNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLP 758
            LV  G   + + D D ++++N+NR F FQ    G SK + AK ++    P   I A+       +YN+    NF+                 +V++ +DN  AR  +N+ C   +   IESG +     G + ++  G+T C+EC P
Sbjct:   37 LVLTGFKNIEVIDLDTIDVSNLNRQFLFQKKHVGKSKAQVAKESVLRFCPSANITAYHDSIMNPDYNVEFFRNFQ-----------------LVMNALDNRAARNHVNRMCLAADIPLIESGTA--GYLGQVTVIKKGQTECYECQP 164          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Xenopus
Match: fam110c (family with sequence similarity 110 member C [Source:Xenbase;Acc:XB-GENE-7007322])

HSP 1 Score: 447.203 bits (1149), Expect = 3.082e-155
Identity = 234/370 (63.24%), Postives = 290/370 (78.38%), Query Frame = 3
Query:  168 DNKRSKIDEMSAEVVDSNPYSRLMALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIGKLILFDYDKVELANMNRLFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGGIN-NQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLPPLIVASGVDEKTLKRDGVCAASLPTTMAIVSGFLVQNTLKYLLEFGTVSEFIGYGAIQDNFYKVSLKPNPECGDRFCLKRQSEYQEFMRNNISISNAEVVKEEIVHEDNEFQIELVSDEEDSLPAVGQ---PSLGDGVKLAYNPVKSRKENEEFVHKTDLSLDELMKQMKNL 1265
            +  R+KI+ MSAEVVDSNPYSRLMAL+RMGIVE+Y KIR  +VAVVGVGGVGSVTAEML RCGIGKL+LFDYDKVE+ANMNRLFFQP+Q+G+SKVEAA+ TL  INPDV+ E HNYNIT ++NF+HF+ R+++GG+    P+D+VLSCVDNFEARM IN ACNEL QIW+ESGVSENAVSGHIQL+ PG+T CF C PPL+VA+ +DEKTLKR+GVCAASLPTTM +V+G LVQN LKYLL FGTVS ++GY A+QD F  +++KPNP+CGD++C K+Q E++             V +EEIVHEDN++ IELVS+  +          P L +G+K+AY    +   +   V  ++ SLDELM QMKNL
Sbjct:   30 EGHRAKINTMSAEVVDSNPYSRLMALKRMGIVEDYEKIRTFTVAVVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVEMANMNRLFFQPHQAGLSKVEAAEHTLRNINPDVQFEVHNYNITTLDNFQHFMDRISKGGLKEGTPVDLVLSCVDNFEARMAINTACNELVQIWMESGVSENAVSGHIQLIKPGETACFACAPPLVVAANIDEKTLKREGVCAASLPTTMGVVAGMLVQNVLKYLLNFGTVSFYLGYNAMQDFFPTMAMKPNPQCGDKYCRKQQEEFKLKEAARPKQEPIVVKEEEIVHEDNDWGIELVSEVSEEELKAASGPVPELPEGIKVAYTVPITEPTSGFIVEDSEQSLDELMAQMKNL 399          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Xenopus
Match: fam110c (family with sequence similarity 110 member C [Source:Xenbase;Acc:XB-GENE-7007322])

HSP 1 Score: 391.734 bits (1005), Expect = 6.815e-134
Identity = 217/370 (58.65%), Postives = 266/370 (71.89%), Query Frame = 3
Query:  168 DNKRSKIDEMSAEVVDSNPYSRLMALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIGKLILFDYDKVELANMNRLFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGGIN-NQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLPPLIVASGVDEKTLKRDGVCAASLPTTMAIVSGFLVQNTLKYLLEFGTVSEFIGYGAIQDNFYKVSLKPNPECGDRFCLKRQSEYQEFMRNNISISNAEVVKEEIVHEDNEFQIELVSDEEDSLPAVGQ---PSLGDGVKLAYNPVKSRKENEEFVHKTDLSLDELMKQMKNL 1265
            +  R+KI+ MSAEVVDSNPYSRLMAL+RMGIVE+Y KIR  +VAVVGVGGVGSVTAEML RCGIGKL+LFDYDKVE+ANMNRLFFQP+Q+G+SKVEAA+ TL                              +GG+    P+D+VLSCVDNFEARM IN ACNEL QIW+ESGVSENAVSGHIQL+ PG+T CF C PPL+VA+ +DEKTLKR+GVCAASLPTTM +V+G LVQN LKYLL FGTVS ++GY A+QD F  +++KPNP+CGD++C K+Q E++             V +EEIVHEDN++ IELVS+  +          P L +G+K+AY    +   +   V  ++ SLDELM QMKNL
Sbjct:   30 EGHRAKINTMSAEVVDSNPYSRLMALKRMGIVEDYEKIRTFTVAVVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVEMANMNRLFFQPHQAGLSKVEAAEHTL-----------------------------RKGGLKEGTPVDLVLSCVDNFEARMAINTACNELVQIWMESGVSENAVSGHIQLIKPGETACFACAPPLVVAANIDEKTLKREGVCAASLPTTMGVVAGMLVQNVLKYLLNFGTVSFYLGYNAMQDFFPTMAMKPNPQCGDKYCRKQQEEFKLKEAARPKQEPIVVKEEEIVHEDNDWGIELVSEVSEEELKAASGPVPELPEGIKVAYTVPITEPTSGFIVEDSEQSLDELMAQMKNL 370          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Xenopus
Match: fam110c (family with sequence similarity 110 member C [Source:Xenbase;Acc:XB-GENE-7007322])

HSP 1 Score: 387.882 bits (995), Expect = 7.853e-133
Identity = 199/313 (63.58%), Postives = 250/313 (79.87%), Query Frame = 3
Query:  168 DNKRSKIDEMSAEVVDSNPYSRLMALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIGKLILFDYDKVELANMNRLFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGGIN-NQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLPPLIVASGVDEKTLKRDGVCAASLPTTMAIVSGFLVQNTLKYLLEFGTVSEFIGYGAIQDNFYKVSLKPNPECGDRFCLKRQSEYQEFMRNNISISNAEVVKEEIVHEDNEFQIEL 1103
            +  R+KI+ MSAEVVDSNPY   +    + +++   KIR  +VAVVGVGGVGSVTAEML RCGIGKL+LFDYDKVE+ANMNRLFFQP+Q+G+SKVEAA+ TL  INPDV+ E HNYNIT ++NF+HF+ R+++GG+    P+D+VLSCVDNFEARM IN ACNEL QIW+ESGVSENAVSGHIQL+ PG+T CF C PPL+VA+ +DEKTLKR+GVCAASLPTTM +V+G LVQN LKYLL FGTVS ++GY A+QD F  +++KPNP+CGD++C K+Q E++             V +EEIVHEDN++  E+
Sbjct:   30 EGHRAKINTMSAEVVDSNPYRWDIFNLLIFLIQ---KIRTFTVAVVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVEMANMNRLFFQPHQAGLSKVEAAEHTLRNINPDVQFEVHNYNITTLDNFQHFMDRISKGGLKEGTPVDLVLSCVDNFEARMAINTACNELVQIWMESGVSENAVSGHIQLIKPGETACFACAPPLVVAANIDEKTLKREGVCAASLPTTMGVVAGMLVQNVLKYLLNFGTVSFYLGYNAMQDFFPTMAMKPNPQCGDKYCRKQQEEFKLKEAARPKQEPIVVKEEEIVHEDNDWGKEI 339          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Xenopus
Match: arf4 (ADP ribosylation factor 4 [Source:Xenbase;Acc:XB-GENE-484079])

HSP 1 Score: 57.3806 bits (137), Expect = 3.454e-8
Identity = 40/139 (28.78%), Postives = 69/139 (49.64%), Query Frame = 3
Query:  354 GIGKLILFDYDKVELANMNRLF-FQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLIN---NFEHFLGRLNQGGINNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLP 758
             + +++L D D ++++N+NR F FQ    G SK + AK ++    P+  I A  Y+ +++N   N E F           +   +V++ +DN  AR  +N+ C       IESG +     G + ++  G T C+EC P
Sbjct:   26 SLWEIVLIDLDTIDVSNLNRQFLFQKKHVGRSKAQVAKESVLQFCPEANITA--YHDSIMNPDYNVEFF-----------KQFTMVMNALDNNAARNHVNRMCLAAGIPLIESGTA--GYLGQVTVVKKGVTECYECQP 149          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Xenopus
Match: arf4 (ADP ribosylation factor 4 [Source:Xenbase;Acc:XB-GENE-484079])

HSP 1 Score: 56.225 bits (134), Expect = 7.807e-8
Identity = 40/138 (28.99%), Postives = 69/138 (50.00%), Query Frame = 3
Query:  357 IGKLILFDYDKVELANMNRLF-FQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLIN---NFEHFLGRLNQGGINNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLP 758
            + +++L D D ++++N+NR F FQ    G SK + AK ++    P+  I A  Y+ +++N   N E F           +   +V++ +DN  AR  +N+ C       IESG +     G + ++  G T C+EC P
Sbjct:   27 LWEIVLIDLDTIDVSNLNRQFLFQKKHVGRSKAQVAKESVLQFCPEANITA--YHDSIMNPDYNVEFF-----------KQFTMVMNALDNNAARNHVNRMCLAAGIPLIESGTA--GYLGQVTVVKKGVTECYECQP 149          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Mouse
Match: Uba5 (ubiquitin-like modifier activating enzyme 5 [Source:MGI Symbol;Acc:MGI:1913913])

HSP 1 Score: 426.402 bits (1095), Expect = 3.639e-147
Identity = 225/372 (60.48%), Postives = 279/372 (75.00%), Query Frame = 3
Query:  177 RSKIDEMSAEVVDSNPYSRLMALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIGKLILFDYDKVELANMNRLFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGGIN-NQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLPPLIVASGVDEKTLKRDGVCAASLPTTMAIVSGFLVQNTLKYLLEFGTVSEFIGYGAIQDNFYKVSLKPNPECGDRFCLKRQSEYQEFMRNNISISNAEVVKEEIVHEDNEFQI------ELVSDEEDSLPAVGQPSLGDGVKLAYN-PVKSRKENEEF-VHKTDLSLDELMKQMKNL 1265
            R++I EMS EV+DSNPYSRLMAL+RMGIV +Y KIR  +VA+VGVGGVGSVTAEML RCGIGKL+LFDYDKVELANMNRLFFQPYQ+G+SKV AA+ TL  INPDV  E HNYNIT + +FEHF+ R++ GG+   QP+D+VLSCVDNFEARM IN ACNEL Q W+ESGVSENAVSGHIQLM PG++ CF C PPL+VAS +DEKTLKR+GVCAASLPTTM +V+G LVQN LK+LL+FGTVS ++GY A+QD F  + +KPNP+C D+ C K+Q EY++      +       + E+VHEDNE+ I           +  S P    P+L +G+ +AY  P K+     E  V  +  SL++LM +MKN+
Sbjct:   35 RTRIQEMSDEVLDSNPYSRLMALKRMGIVSDYKKIRTYAVAIVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVELANMNRLFFQPYQAGLSKVHAAEHTLRNINPDVLFEVHNYNITTVEHFEHFMNRISNGGLEEGQPVDLVLSCVDNFEARMAINTACNELGQTWMESGVSENAVSGHIQLMIPGESACFACAPPLVVASNIDEKTLKREGVCAASLPTTMGVVAGILVQNVLKFLLKFGTVSFYLGYNAMQDFFPTMFMKPNPQCDDKNCRKQQEEYKKRAAALPTQEAEPQEEAEVVHEDNEWGIELVSEVSEEELKNSSGPV---PTLPEGITVAYTVPKKTEDSASEVTVEDSGESLEDLMARMKNM 403          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Mouse
Match: Uba5 (ubiquitin-like modifier activating enzyme 5 [Source:MGI Symbol;Acc:MGI:1913913])

HSP 1 Score: 78.5666 bits (192), Expect = 2.941e-17
Identity = 50/67 (74.63%), Postives = 58/67 (86.57%), Query Frame = 3
Query:  177 RSKIDEMSAEVVDSNPYSRLMALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIGKLILF 377
            R++I EMS EV+DSNPYSRLMAL+RMGIV +Y KIR  +VA+VGVGGVGSVTAEML RCGIGK+  F
Sbjct:   22 RTRIQEMSDEVLDSNPYSRLMALKRMGIVSDYKKIRTYAVAIVGVGGVGSVTAEMLTRCGIGKVKRF 88          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Mouse
Match: Uba5 (ubiquitin-like modifier activating enzyme 5 [Source:MGI Symbol;Acc:MGI:1913913])

HSP 1 Score: 78.5666 bits (192), Expect = 4.259e-17
Identity = 50/67 (74.63%), Postives = 58/67 (86.57%), Query Frame = 3
Query:  177 RSKIDEMSAEVVDSNPYSRLMALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIGKLILF 377
            R++I EMS EV+DSNPYSRLMAL+RMGIV +Y KIR  +VA+VGVGGVGSVTAEML RCGIGK+  F
Sbjct:   35 RTRIQEMSDEVLDSNPYSRLMALKRMGIVSDYKKIRTYAVAIVGVGGVGSVTAEMLTRCGIGKVKRF 101          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Mouse
Match: Uba5 (ubiquitin-like modifier activating enzyme 5 [Source:MGI Symbol;Acc:MGI:1913913])

HSP 1 Score: 75.485 bits (184), Expect = 2.042e-16
Identity = 47/62 (75.81%), Postives = 54/62 (87.10%), Query Frame = 3
Query:  177 RSKIDEMSAEVVDSNPYSRLMALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIG 362
            R++I EMS EV+DSNPYSRLMAL+RMGIV +Y KIR  +VA+VGVGGVGSVTAEML RCGI 
Sbjct:   35 RTRIQEMSDEVLDSNPYSRLMALKRMGIVSDYKKIRTYAVAIVGVGGVGSVTAEMLTRCGIA 96          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Mouse
Match: Uba2 (ubiquitin-like modifier activating enzyme 2 [Source:MGI Symbol;Acc:MGI:1858313])

HSP 1 Score: 65.4698 bits (158), Expect = 8.008e-11
Identity = 44/147 (29.93%), Postives = 68/147 (46.26%), Query Frame = 3
Query:  342 LVRCGIGKLILFDYDKVELANMNRLF-FQPYQSGMSKVEAAKSTLEFINPDVKIEAH-------NYNITLINNFEHFLGRLNQGGINNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLP 758
            LV  G   + L D D ++++N+NR F FQ    G SK + AK ++   +P   IEAH       +YN+     F  F+              +V++ +DN  AR  +N+ C   +   IESG +     G +  +  G T C+EC P
Sbjct:   36 LVLTGFSHIDLIDLDTIDVSNLNRQFLFQKKHVGRSKAQVAKESVLQFHPQANIEAHHDSIMNPDYNVEF---FRQFI--------------LVMNALDNRAARNHVNRMCLAADVPLIESGTA--GYLGQVTTIKKGVTECYECHP 163          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. UniProt/SwissProt
Match: sp|B4PYA4|UBA5_DROYA (Ubiquitin-like modifier-activating enzyme 5 OS=Drosophila yakuba OX=7245 GN=GE15940 PE=3 SV=1)

HSP 1 Score: 450.669 bits (1158), Expect = 7.194e-156
Identity = 236/370 (63.78%), Postives = 286/370 (77.30%), Query Frame = 3
Query:  177 RSKIDEMSAEVVDSNPYSRLMALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIGKLILFDYDKVELANMNRLFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGG-INNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLPPLIVASGVDEKTLKRDGVCAASLPTTMAIVSGFLVQNTLKYLLEFGTVSEFIGYGAIQDNFYKVSLKPNPECGDRFCLKRQSEYQEFMRNNISISNAEVVKEEIVHEDNEFQIELVS-DEEDSLPAVGQ-PSLGDGVKLAYN-PVKSRKENEEFVHKT---DLSLDELMKQMKNL 1265
            R +ID MSAEVVDSNPYSRLMALQRM IV++Y +IRDK+VA+VGVGGVGSVTA+ML RCGIGKLILFDYDKVELANMNRLFF P Q+G+SKVEAA +TL FINPDV+IE HNYNIT + NF+ FL  ++QGG I  QP+D+VLSCVDNFEARM IN ACNE N  W ESGVSENAVSGHIQ + PG T CF C PPL+VA  +DEKTLKR+GVCAASLPTTM I +GFLVQN LKYLL FG VS+++GY A+ D F K++LKPNP+C DR C+ RQ E+Q   R    +   + V EE +H  NE+ IELV+ D  +S P   + P +G+G++LAY  P +S + +EE V      + SL++LM QMK++
Sbjct:   36 RDRIDRMSAEVVDSNPYSRLMALQRMNIVKDYERIRDKAVAIVGVGGVGSVTADMLTRCGIGKLILFDYDKVELANMNRLFFTPDQAGLSKVEAAAATLSFINPDVEIETHNYNITTVENFDRFLDTISQGGRIAGQPVDLVLSCVDNFEARMAINAACNERNLNWFESGVSENAVSGHIQFIRPGDTACFACAPPLVVAENIDEKTLKREGVCAASLPTTMGITAGFLVQNALKYLLNFGEVSDYLGYNALSDFFPKMTLKPNPQCDDRNCIVRQKEFQ--ARPKPVVIEEKAVSEEPLHATNEWGIELVAEDAPESNPTPTEAPVVGEGLRLAYEAPERSSETSEETVTTAPADETSLEDLMAQMKSM 403          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. UniProt/SwissProt
Match: sp|B4IK21|UBA5_DROSE (Ubiquitin-like modifier-activating enzyme 5 OS=Drosophila sechellia OX=7238 GN=GM13085 PE=3 SV=1)

HSP 1 Score: 450.669 bits (1158), Expect = 8.126e-156
Identity = 236/370 (63.78%), Postives = 284/370 (76.76%), Query Frame = 3
Query:  177 RSKIDEMSAEVVDSNPYSRLMALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIGKLILFDYDKVELANMNRLFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGG-INNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLPPLIVASGVDEKTLKRDGVCAASLPTTMAIVSGFLVQNTLKYLLEFGTVSEFIGYGAIQDNFYKVSLKPNPECGDRFCLKRQSEYQEFMRNNISISNAEVVKEEIVHEDNEFQIELVS-DEEDSLPAVGQ-PSLGDGVKLAYN-PVKSRKENEEFVHKT---DLSLDELMKQMKNL 1265
            R +ID MSAEVVDSNPYSRLMALQRM IV++Y +IRDK+VA+VGVGGVGSVTA+ML RCGIGKLILFDYDKVELANMNRLFF P Q+G+SKV AA +TL FINPDV+IE HNYNIT + NF+ FL  ++QGG I  QP+D+VLSCVDNFEARM IN ACNE N  W ESGVSENAVSGHIQ + PG T CF C PPL+VA  +DEKTLKR+GVCAASLPTTM I +GFLVQN LKYLL FG VS+++GY A+ D F K++LKPNP+C DR C+ RQ E+Q   R    +   + V EE +H  NE+ IELV+ D   S P   + P +G+G++LAY  P KS + +EE V      + SL++LM QMK++
Sbjct:   37 RDRIDRMSAEVVDSNPYSRLMALQRMNIVKDYERIRDKAVAIVGVGGVGSVTADMLTRCGIGKLILFDYDKVELANMNRLFFTPDQAGLSKVAAAAATLSFINPDVEIETHNYNITTVENFDRFLDTISQGGRIAGQPVDLVLSCVDNFEARMAINAACNERNLNWFESGVSENAVSGHIQFIRPGDTACFACAPPLVVAENIDEKTLKREGVCAASLPTTMGITAGFLVQNALKYLLNFGEVSDYLGYNALSDFFPKMTLKPNPQCDDRNCIVRQKEFQ--ARPKPVVIEEKAVSEEPLHATNEWGIELVAEDAPQSNPTPAETPVMGEGLRLAYEAPEKSSETSEETVTAATADETSLEDLMAQMKSM 404          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. UniProt/SwissProt
Match: sp|Q9VYY3|UBA5_DROME (Ubiquitin-like modifier-activating enzyme 5 OS=Drosophila melanogaster OX=7227 GN=Uba5 PE=2 SV=1)

HSP 1 Score: 449.129 bits (1154), Expect = 3.318e-155
Identity = 236/371 (63.61%), Postives = 285/371 (76.82%), Query Frame = 3
Query:  177 RSKIDEMSAEVVDSNPYSRLMALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIGKLILFDYDKVELANMNRLFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGG-INNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLPPLIVASGVDEKTLKRDGVCAASLPTTMAIVSGFLVQNTLKYLLEFGTVSEFIGYGAIQDNFYKVSLKPNPECGDRFCLKRQSEYQEFMRNNISISNAEVVKEEIVHEDNEFQIELVSD---EEDSLPAVGQPSLGDGVKLAYN-PVKSRKENEEFVHKT---DLSLDELMKQMKNL 1265
            R +ID MSAEVVDSNPYSRLMALQRM IV++Y +IR K+VA+VGVGGVGSVTA+ML RCGIGKLILFDYDKVELANMNRLFF P Q+G+SKV AA +TL FINPDV+IE HNYNIT + NF+ FL  ++QGG I  QP+D+VLSCVDNFEARM IN ACNE N  W ESGVSENAVSGHIQ + PG T CF C PPL+VA  +DEKTLKR+GVCAASLPTTM I +GFLVQN LKYLL FG VS+++GY A+ D F K++LKPNP+C DR CL RQ E+Q   R    +   + V EE +H  NE+ IELV++   E ++ PA   P +G+G++LAY  P KS + +EE V      + SL++LM QMK++
Sbjct:   37 RDRIDRMSAEVVDSNPYSRLMALQRMNIVKDYERIRYKAVAIVGVGGVGSVTADMLTRCGIGKLILFDYDKVELANMNRLFFTPDQAGLSKVAAAAATLSFINPDVEIETHNYNITTVENFDRFLDTISQGGRIAGQPVDLVLSCVDNFEARMAINAACNERNLNWFESGVSENAVSGHIQFIRPGDTACFACAPPLVVAENIDEKTLKREGVCAASLPTTMGITAGFLVQNALKYLLNFGEVSDYLGYNALSDFFPKMTLKPNPQCDDRNCLVRQKEFQ--ARPKPVLIEEKAVSEEPLHATNEWGIELVAEDAPESNTTPA-ETPVMGEGLRLAYEAPEKSSETSEETVSAATADETSLEDLMAQMKSM 404          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. UniProt/SwissProt
Match: sp|B4R345|UBA5_DROSI (Ubiquitin-like modifier-activating enzyme 5 OS=Drosophila simulans OX=7240 GN=GD17028 PE=3 SV=2)

HSP 1 Score: 447.973 bits (1151), Expect = 8.113e-155
Identity = 235/370 (63.51%), Postives = 283/370 (76.49%), Query Frame = 3
Query:  177 RSKIDEMSAEVVDSNPYSRLMALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIGKLILFDYDKVELANMNRLFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGG-INNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLPPLIVASGVDEKTLKRDGVCAASLPTTMAIVSGFLVQNTLKYLLEFGTVSEFIGYGAIQDNFYKVSLKPNPECGDRFCLKRQSEYQEFMRNNISISNAEVVKEEIVHEDNEFQIELVS-DEEDSLPAVGQ-PSLGDGVKLAYN-PVKSRKENEEFVHKT---DLSLDELMKQMKNL 1265
            R +ID MSAEVVDSNPYSRLMALQRM IV++Y +IRDK+VA+VGVGGVGSVTA+ML RCGIGKLILFDYDKVEL NMNRLFF P Q+G+SKV AA +TL FINPDV+IE HNYNIT + NF+ FL  ++QGG I  QP+D+VLSCVDNFEARM IN ACNE N  W ESGVSENAVSGHIQ + PG T CF C PPL+VA  +DEKTLKR+GVCAASLPTTM I +GFLVQN LKYLL FG VS+++GY A+ D F K++LKPNP+C DR C+ RQ E+Q   R    +   + V EE +H  NE+ IELV+ D   S P   + P +G+G++LAY  P KS + +EE V      + SL++LM QMK++
Sbjct:   37 RDRIDRMSAEVVDSNPYSRLMALQRMNIVKDYERIRDKAVAIVGVGGVGSVTADMLTRCGIGKLILFDYDKVELDNMNRLFFTPDQAGLSKVAAAAATLSFINPDVEIETHNYNITTVENFDRFLDTISQGGRIAGQPVDLVLSCVDNFEARMAINAACNERNLNWFESGVSENAVSGHIQFIRPGDTACFACAPPLVVAENIDEKTLKREGVCAASLPTTMGITAGFLVQNALKYLLNFGEVSDYLGYNALSDFFPKMTLKPNPQCDDRNCIVRQKEFQ--ARPKPVVIEEKAVSEEPLHATNEWGIELVAEDAPQSNPTPAETPVMGEGLRLAYEAPEKSSETSEETVTAATADETSLEDLMAQMKSM 404          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. UniProt/SwissProt
Match: sp|Q6GLG7|UBA5_XENTR (Ubiquitin-like modifier-activating enzyme 5 OS=Xenopus tropicalis OX=8364 GN=uba5 PE=2 SV=1)

HSP 1 Score: 447.203 bits (1149), Expect = 1.633e-154
Identity = 234/370 (63.24%), Postives = 290/370 (78.38%), Query Frame = 3
Query:  168 DNKRSKIDEMSAEVVDSNPYSRLMALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIGKLILFDYDKVELANMNRLFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGGIN-NQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLPPLIVASGVDEKTLKRDGVCAASLPTTMAIVSGFLVQNTLKYLLEFGTVSEFIGYGAIQDNFYKVSLKPNPECGDRFCLKRQSEYQEFMRNNISISNAEVVKEEIVHEDNEFQIELVSDEEDSLPAVGQ---PSLGDGVKLAYNPVKSRKENEEFVHKTDLSLDELMKQMKNL 1265
            +  R+KI+ MSAEVVDSNPYSRLMAL+RMGIVE+Y KIR  +VAVVGVGGVGSVTAEML RCGIGKL+LFDYDKVE+ANMNRLFFQP+Q+G+SKVEAA+ TL  INPDV+ E HNYNIT ++NF+HF+ R+++GG+    P+D+VLSCVDNFEARM IN ACNEL QIW+ESGVSENAVSGHIQL+ PG+T CF C PPL+VA+ +DEKTLKR+GVCAASLPTTM +V+G LVQN LKYLL FGTVS ++GY A+QD F  +++KPNP+CGD++C K+Q E++             V +EEIVHEDN++ IELVS+  +          P L +G+K+AY    +   +   V  ++ SLDELM QMKNL
Sbjct:   30 EGHRAKINTMSAEVVDSNPYSRLMALKRMGIVEDYEKIRTFTVAVVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVEMANMNRLFFQPHQAGLSKVEAAEHTLRNINPDVQFEVHNYNITTLDNFQHFMDRISKGGLKEGTPVDLVLSCVDNFEARMAINTACNELVQIWMESGVSENAVSGHIQLIKPGETACFACAPPLVVAANIDEKTLKREGVCAASLPTTMGVVAGMLVQNVLKYLLNFGTVSFYLGYNAMQDFFPTMAMKPNPQCGDKYCRKQQEEFKLKEAARPKQEPIVVKEEEIVHEDNDWGIELVSEVSEEELKAASGPVPELPEGIKVAYTVPITEPTSGFIVEDSEQSLDELMAQMKNL 399          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. TrEMBL
Match: A0A4V3SEK9 (ThiF domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006129 PE=4 SV=1)

HSP 1 Score: 484.567 bits (1246), Expect = 1.715e-166
Identity = 246/385 (63.90%), Postives = 303/385 (78.70%), Query Frame = 3
Query:  177 RSKIDEMSAEVVDSNPYSRLMALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIGKLILFDYDKVELANMNRLFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGG-INNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLPPLIVASGVDEKTLKRDGVCAASLPTTMAIVSGFLVQNTLKYLLEFGTVSEFIGYGAIQDNFYKVSLKPNPECGDRFCLKRQSEY----------------QEFMRNNISISNAEVVKEEIVHEDNEFQIELVSDEEDSLPAVGQP--SLGDGVKLAYNP-VKSR--KENEEFVHKTDLSLDELMKQMKNL 1265
            RSKID++S+EVVDSNPYSRLMALQRMG+VENY+ IRDK+VA+VG+GGVGSVTAEMLVRCGIG+LILFDYDKVE+ANMNRLFFQP+QSG+SKV AA +TL FINPDV IEAHNY+ITL+ ++EHFL R+  GG ++ QP+D+VLSCVDNFEARMTINKACNELNQ+W ESGVSE+A+S HIQL++PG+TPCFECLPPLIVASG+DEKTLKR+GVCAASLPTTM +V+  LVQN+LK+LL FG VS +IGYGA +D+FY+V L+PNP C D +C +RQ+E                 +E +R       A+   +   H+DNEF+IE+ SD E   P+  QP   LG+GV+  Y P VKS     +E+ V  T+ SL+ LM +MK L
Sbjct:   40 RSKIDKISSEVVDSNPYSRLMALQRMGVVENYAAIRDKTVAIVGIGGVGSVTAEMLVRCGIGRLILFDYDKVEMANMNRLFFQPHQSGLSKVSAAAATLSFINPDVDIEAHNYDITLVEHYEHFLSRIQHGGKVSGQPVDLVLSCVDNFEARMTINKACNELNQVWFESGVSEDAMSCHIQLLYPGRTPCFECLPPLIVASGLDEKTLKREGVCAASLPTTMGLVASLLVQNSLKWLLNFGEVSSYIGYGAAKDSFYRVDLRPNPHCADNWCCRRQAERKKQLESRGLPATGAWNEEKLREAAMKQQADAATDRPKHDDNEFEIEVESDSE---PSNSQPQGQLGEGVRTIYQPSVKSTDPSTDEQCVASTEESLEALMARMKQL 421          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. TrEMBL
Match: A0A419PZS4 (Ubiquitin-like modifier-activating enzyme 5 OS=Clonorchis sinensis OX=79923 GN=CSKR_517s PE=4 SV=1)

HSP 1 Score: 484.182 bits (1245), Expect = 3.301e-166
Identity = 244/385 (63.38%), Postives = 302/385 (78.44%), Query Frame = 3
Query:  177 RSKIDEMSAEVVDSNPYSRLMALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIGKLILFDYDKVELANMNRLFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGG-INNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLPPLIVASGVDEKTLKRDGVCAASLPTTMAIVSGFLVQNTLKYLLEFGTVSEFIGYGAIQDNFYKVSLKPNPECGDRFCLKRQSEY----------------QEFMRNNISISNAEVVKEEIVHEDNEFQIELVSDEEDSLPAVGQP--SLGDGVKLAYNPVKSRKE---NEEFVHKTDLSLDELMKQMKNL 1265
            RSKIDE+S+EVVDSNPYSRLMALQRMG+VENY+ IRDK+VA+VG+GGVGSVTAEMLVRCGIG+LILFDYDKVE+ANMNRLFFQP+QSG+SKV AA +TL FINPDV IEAHNY+ITL+ ++EHFL R+  GG ++ QP+D++LSCVDNFEARMTINKACNELNQ+W ESGVSE+A+S HIQL++PG+TPCFECLPPLIVASG+DEKTLKR+GVCAASLPTTM +V+  LVQN+LK+LL FG VS +IGYGA++D+FY+V L+PNP C D +C +RQ+E                 +E ++       A+   +   HEDNEF+IE+ SD E   P  GQP   LG+GV+  Y P     +   +E+ V  T+ SL+ LM +MK L
Sbjct:   40 RSKIDEISSEVVDSNPYSRLMALQRMGVVENYAAIRDKTVAIVGIGGVGSVTAEMLVRCGIGRLILFDYDKVEMANMNRLFFQPHQSGLSKVSAAAATLSFINPDVDIEAHNYDITLMEHYEHFLSRIQHGGKVSGQPVDLLLSCVDNFEARMTINKACNELNQVWFESGVSEDAMSCHIQLLYPGRTPCFECLPPLIVASGLDEKTLKREGVCAASLPTTMGLVASLLVQNSLKWLLNFGEVSSYIGYGAVKDSFYRVDLRPNPHCADNWCCRRQAERKRQLESLGLPANGAWNEEKLQEAAMKQQADAATDRPKHEDNEFEIEVESDSE---PPNGQPQGQLGEGVRTIYQPNGKSTDPSTDEQCVASTEESLEALMARMKQL 421          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. TrEMBL
Match: G7YDE8 (Ubiquitin-like modifier-activating enzyme 5 OS=Clonorchis sinensis OX=79923 GN=CLF_105336 PE=4 SV=1)

HSP 1 Score: 483.797 bits (1244), Expect = 3.931e-166
Identity = 244/385 (63.38%), Postives = 302/385 (78.44%), Query Frame = 3
Query:  177 RSKIDEMSAEVVDSNPYSRLMALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIGKLILFDYDKVELANMNRLFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGG-INNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLPPLIVASGVDEKTLKRDGVCAASLPTTMAIVSGFLVQNTLKYLLEFGTVSEFIGYGAIQDNFYKVSLKPNPECGDRFCLKRQSEY----------------QEFMRNNISISNAEVVKEEIVHEDNEFQIELVSDEEDSLPAVGQP--SLGDGVKLAYNPVKSRKE---NEEFVHKTDLSLDELMKQMKNL 1265
            RSKIDE+S+EVVDSNPYSRLMALQRMG+VENY+ IRDK+VA+VG+GGVGSVTAEMLVRCGIG+LILFDYDKVE+ANMNRLFFQP+QSG+SKV AA +TL FINPDV IEAHNY+ITL+ ++EHFL R+  GG ++ QP+D++LSCVDNFEARMTINKACNELNQ+W ESGVSE+A+S HIQL++PG+TPCFECLPPLIVASG+DEKTLKR+GVCAASLPTTM +V+  LVQN+LK+LL FG VS +IGYGA++D+FY+V L+PNP C D +C +RQ+E                 +E ++       A+   +   HEDNEF+IE+ SD E   P  GQP   LG+GV+  Y P     +   +E+ V  T+ SL+ LM +MK L
Sbjct:   40 RSKIDEISSEVVDSNPYSRLMALQRMGVVENYAAIRDKTVAIVGIGGVGSVTAEMLVRCGIGRLILFDYDKVEMANMNRLFFQPHQSGLSKVSAAAATLSFINPDVDIEAHNYDITLMEHYEHFLSRIQHGGKVSGQPVDLLLSCVDNFEARMTINKACNELNQVWFESGVSEDAMSCHIQLLYPGRTPCFECLPPLIVASGLDEKTLKREGVCAASLPTTMGLVASLLVQNSLKWLLNFGEVSSYIGYGAVKDSFYRVHLRPNPHCADNWCCRRQAERKRQLESLGLPANGAWNEEKLQEAAMKQQADAATDRPKHEDNEFEIEVESDSE---PPNGQPQGQLGEGVRTIYQPNGKSTDPSTDEQCVASTEESLEALMARMKQL 421          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. TrEMBL
Match: A0A074YX31 (ThiF domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_15625 PE=4 SV=1)

HSP 1 Score: 477.633 bits (1228), Expect = 1.135e-163
Identity = 241/386 (62.44%), Postives = 301/386 (77.98%), Query Frame = 3
Query:  177 RSKIDEMSAEVVDSNPYSRLMALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIGKLILFDYDKVELANMNRLFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGG-INNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLPPLIVASGVDEKTLKRDGVCAASLPTTMAIVSGFLVQNTLKYLLEFGTVSEFIGYGAIQDNFYKVSLKPNPECGDRFCLKRQSEY----------------QEFMRNNISISNAEVVKEEIVHEDNEFQIELVSDEEDSLPAVGQPS---LGDGVKLAYNPVKSRKE---NEEFVHKTDLSLDELMKQMKNL 1265
            RSKID++S+EVVDSNPYSRLMALQRMG+VENY+ IR+K+VA+VG+GGVGSVTAEMLVRCGIG+LILFDYDKVE+ANMNRLFFQP+QSG+SKV AA +TL FINPDV IEAHNYNITL+ ++EHFL R+  GG ++ QP+D+VLSCVDNFEARMTINKACNELNQ+W ESGVSE+A+S HIQL++PG+TPCFECLPPLIVASG+DEKTLKR+GVCAASLPTTM +V+  LVQN+LK+LL FG VS ++GYGA +D+FY+V L+PNP C D +C +RQ+E                 +E +R       A+   ++  H+DNEF+IE+ SD E   P+   P    LG+GV+  Y P     +   +E+ V  T+ SL+ LM +MK L
Sbjct:   40 RSKIDKISSEVVDSNPYSRLMALQRMGVVENYAAIREKTVAIVGIGGVGSVTAEMLVRCGIGRLILFDYDKVEMANMNRLFFQPHQSGLSKVSAAAATLSFINPDVDIEAHNYNITLLEHYEHFLSRIQYGGKVSGQPVDLVLSCVDNFEARMTINKACNELNQVWFESGVSEDAMSCHIQLLYPGRTPCFECLPPLIVASGLDEKTLKREGVCAASLPTTMGLVASLLVQNSLKWLLNFGEVSSYVGYGAAKDSFYRVDLRPNPHCADNWCCRRQAERKKQLESLGLPANGAWNEEKLREAAMKQQADAATDKPKHDDNEFEIEVESDSE---PSNSHPQGQLLGEGVRTIYQPNGKSTDPSTDEQCVASTEESLEALMARMKQL 422          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. TrEMBL
Match: A0A131YTP3 (Ubiquitin-like modifier-activating enzyme 5 OS=Rhipicephalus appendiculatus OX=34631 PE=4 SV=1)

HSP 1 Score: 469.929 bits (1208), Expect = 4.106e-161
Identity = 240/369 (65.04%), Postives = 288/369 (78.05%), Query Frame = 3
Query:  171 NKRSKIDEMSAEVVDSNPYSRLMALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIGKLILFDYDKVELANMNRLFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGGINNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLPPLIVASGVDEKTLKRDGVCAASLPTTMAIVSGFLVQNTLKYLLEFGTVSEFIGYGAIQDNFYKVSLKPNPECGDRFCLKRQSEYQEFMRNNISISNAEVVKEEIVHEDNEFQIELVSD---EEDSLPAVGQPSLGDGVKLAYN-PVKSRKENEEFVHKTDLSLDELMKQMKNL 1265
            N R KI +MS+EVVDSNPYSRLMAL+RMGIV+NY  IR  +VAVVGVGGVGSVTAEML RCGIGKLILFDYDKVELANMNRLFFQP+Q+GMSKVEAA  TL+FINPDV+ + +NYNIT ++NF+HF+  +  G +   P+D+VLSCVDNFEARM IN ACNELNQ+WIESGVSENAVSGHIQL+ PG+T CF C PPL+VAS +DEKTLKR+GVCAASLPTTM IV+GFLVQNTLKYLL+FGTVS ++GY A+QD F  + +KPN +C D FC +RQ EYQ            E  KEE+VHEDNE+ I LVS+   +E S      P L  G++LAY  P   + E+ E   +++ +L+ELM QMK+L
Sbjct:   28 NPREKISQMSSEVVDSNPYSRLMALKRMGIVDNYEAIRTYTVAVVGVGGVGSVTAEMLTRCGIGKLILFDYDKVELANMNRLFFQPHQAGMSKVEAAAKTLQFINPDVEFDTYNYNITTVDNFQHFMDTIKTGSLQGGPVDLVLSCVDNFEARMAINTACNELNQVWIESGVSENAVSGHIQLVVPGETACFACAPPLVVASNIDEKTLKREGVCAASLPTTMGIVAGFLVQNTLKYLLKFGTVSHYLGYNALQDFFPTMQMKPNSQCDDSFCRQRQKEYQVREAAKPPPEPVEEQKEEVVHEDNEWGICLVSETPADEGSCAECTVPGLAPGIQLAYTVPEPQKVEDTEVAAESEQTLEELMAQMKSL 396          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Cavefish
Match: uba5 (ubiquitin like modifier activating enzyme 5 [Source:NCBI gene;Acc:103037044])

HSP 1 Score: 415.231 bits (1066), Expect = 7.151e-143
Identity = 232/383 (60.57%), Postives = 291/383 (75.98%), Query Frame = 3
Query:  156 NRDMDNKRSKIDEMSAEVVDSNPYSRLMALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIGKLILFDYDKVELANMNRLFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGGIN-NQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLPPLIVASGVDEKTLKRDGVCAASLPTTMAIVSGFLVQNTLKYLLEFGTVSEFIGYGAIQDNFYKVSLKPNPECGDRFCLKRQSEYQEFMRNNISISNAEVVKE-------EIVHEDNEFQIELVSD-EEDSLPAVG--QPSLGDGVKLAYN-PVKSRKENE-EFVHKTDLSLDELMKQMKNL 1265
            + + +  R +I+ MSAEVVDSNPYSRLMAL+RMGIVE+Y KIR  +VAVVGVGGVGSVTAEML RCGIGKL+LFDYDKVELANMNRLFFQP+Q+G+SKVEAA+ TL  INPDV  E HNYNIT ++NF HF+ R++ GG+   +P+D+VLSCVDNFEARM IN ACNEL QIW+ESGVSENAVSGHIQL+ PG+T CF C PPL+VA+ +DEKTLK+DGVCAASLPTTM +V+G LVQN LK+LL FGTVS ++GY A+ D F  +++K NP+C D+ C ++Q E+++          AE  K+       EIVHE+NE+ IELVS+  E  L A    +P L +G+ +AY  P K    +  + V +TD SL+ELM QM+ +
Sbjct:   27 SEEQNQPRGRIERMSAEVVDSNPYSRLMALKRMGIVEDYEKIRSFTVAVVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVELANMNRLFFQPHQAGLSKVEAAEHTLRNINPDVVFETHNYNITTMDNFTHFMERVSNGGLEEGKPVDLVLSCVDNFEARMAINTACNELGQIWMESGVSENAVSGHIQLIIPGETACFACAPPLVVAANIDEKTLKKDGVCAASLPTTMGVVAGILVQNVLKHLLGFGTVSFYLGYNAMLDFFPTMTMKANPQCDDKHCRRQQEEFKK--------KEAERPKQEVVQEEEEIVHEENEWGIELVSEVTEAELQAASGPKPDLPEGITVAYTIPEKDEGASSGQTVEETDQSLEELMAQMRKM 401          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Cavefish
Match: uba2 (ubiquitin like modifier activating enzyme 2 [Source:NCBI gene;Acc:103037342])

HSP 1 Score: 58.9214 bits (141), Expect = 6.129e-9
Identity = 40/147 (27.21%), Postives = 67/147 (45.58%), Query Frame = 3
Query:  342 LVRCGIGKLILFDYDKVELANMNRLF-FQPYQSGMSKVEAAKSTLEFINPDVKIEAH-------NYNITLINNFEHFLGRLNQGGINNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLP 758
            LV  G   + + D D ++++N+NR F FQ    G SK + AK ++    P   I A+       +YN+    +F+                 +V++ +DN  AR  +N+ C   +   IESG +     G + ++  G T C+EC P
Sbjct:   37 LVLTGFKNIEVIDLDTIDVSNLNRQFLFQKKHVGKSKAQVAKESVLRFCPSANITAYHDSIMNPDYNVEFFRSFQ-----------------LVMNALDNRAARNHVNRMCLAADIPLIESGTA--GYLGQVTVIKKGVTECYECQP 164          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Cavefish
Match: uba1 (ubiquitin like modifier activating enzyme 1 [Source:NCBI gene;Acc:103045813])

HSP 1 Score: 53.5286 bits (127), Expect = 3.628e-7
Identity = 38/143 (26.57%), Postives = 71/143 (49.65%), Query Frame = 3
Query:  333 AEMLVRCGIGKLILFDYDKVELANMNRLF-FQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNI----TLINNFEHFLGRLNQGGINNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCF 746
            A M +  G G++I+ D D +E +N+NR F F+P+     K E A + ++ +NP V+I  H   +      + + + F           + +D V + +DN +ARM +++ C    +  +ESG       G++Q++ P  T  +
Sbjct:  489 AMMGLASGEGEVIVTDMDTIEKSNLNRQFLFRPWDVTKMKSETAAAAVKQMNPSVRITGHQNRVGPDTEKVYDDDFF-----------ESLDGVANALDNVDARMYMDRRCVYYRKPLLESGTL--GTKGNVQVVMPFLTESY 618          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Cavefish
Match: uba1 (ubiquitin like modifier activating enzyme 1 [Source:NCBI gene;Acc:103045813])

HSP 1 Score: 53.5286 bits (127), Expect = 4.273e-7
Identity = 38/143 (26.57%), Postives = 71/143 (49.65%), Query Frame = 3
Query:  333 AEMLVRCGIGKLILFDYDKVELANMNRLF-FQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNI----TLINNFEHFLGRLNQGGINNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCF 746
            A M +  G G++I+ D D +E +N+NR F F+P+     K E A + ++ +NP V+I  H   +      + + + F           + +D V + +DN +ARM +++ C    +  +ESG       G++Q++ P  T  +
Sbjct:  486 AMMGLASGEGEVIVTDMDTIEKSNLNRQFLFRPWDVTKMKSETAAAAVKQMNPSVRITGHQNRVGPDTEKVYDDDFF-----------ESLDGVANALDNVDARMYMDRRCVYYRKPLLESGTL--GTKGNVQVVMPFLTESY 615          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Sea Lamprey
Match: uba5 (ubiquitin-like modifier activating enzyme 5 [Source:NCBI gene;Acc:386712])

HSP 1 Score: 335.88 bits (860), Expect = 4.468e-115
Identity = 165/223 (73.99%), Postives = 195/223 (87.44%), Query Frame = 3
Query:  216 SNPYSRLMALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIGKLILFDYDKVELANMNRLFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGGIN-NQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLPPLIVASGVDEKTLKRDGVCAASLPTTMAIVSGFLVQNTLKY 881
            SNPYSRLMAL+RMG+V+NY +IRD +VAVVGVGGVGSVTAEML RCG+GKL+LFDYDKVELANMNRLFFQP Q+GMSKVEAA+ TL  INPDV+ E HNYN+T + NF+HF+ R++ GG+   +P+++VL CVDNFEARM IN ACNEL+Q+WIESGVSENAVSGHIQL+ PG+T CF C PPL+VA+ +DEK LKRDGVCAASLPTTM +V+G LVQN LKY
Sbjct:    1 SNPYSRLMALKRMGVVDNYERIRDVAVAVVGVGGVGSVTAEMLTRCGVGKLLLFDYDKVELANMNRLFFQPQQAGMSKVEAAEHTLRNINPDVQFETHNYNVTTMGNFQHFMERVSHGGLQEGRPVELVLCCVDNFEARMAINTACNELSQVWIESGVSENAVSGHIQLIIPGETACFACAPPLVVAAKMDEKALKRDGVCAASLPTTMGVVAGLLVQNALKY 223          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Yeast
Match: UBA2 (Subunit of heterodimeric nuclear SUMO activating enzyme E1 with Aos1p; activates Smt3p (SUMO) before its conjugation to proteins (sumoylation), which may play a role in protein targeting; essential for viability [Source:SGD;Acc:S000002798])

HSP 1 Score: 57.7658 bits (138), Expect = 2.210e-9
Identity = 42/134 (31.34%), Postives = 65/134 (48.51%), Query Frame = 3
Query:  360 GKLILFDYDKVELANMNR--LFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFE-HFLGRLNQGGINNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFEC 752
            G++ + D D ++L+N+NR  LF Q          A K+   F N   K+  +  N+  I+ F  H+  +           DI+ + +DN  AR  +NK    L+   IESG +     G++Q + PGKT CFEC
Sbjct:   46 GEIHIVDLDTIDLSNLNRQFLFRQKDIKQPKSTTAVKAVQHFNNS--KLVPYQGNVMDISTFPLHWFEQF----------DIIFNALDNLAARRYVNKISQFLSLPLIESGTA--GFDGYMQPIIPGKTECFEC 165          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Nematostella
Match: EDO37275 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGA5])

HSP 1 Score: 359.762 bits (922), Expect = 1.399e-123
Identity = 180/236 (76.27%), Postives = 208/236 (88.14%), Query Frame = 3
Query:  174 KRSKIDEMSAEVVDSNPYSRLMALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIGKLILFDYDKVELANMNRLFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGGINNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLPPLIVASGVDEKTLKRDGVCAASLPTTMAIVSGFLVQNTLKY 881
            +R K++EMSAEVVDSNPYSRLMAL+RMGIV+NY KIR+ +VAVVG+GGVGSVTAEML RCGIGKL+LFDYDKVELANMNRLFF+P  SGMSKVEAA +TL  INPDV+ EA+NY+ITL+ NF HFL R++ GG +N+ +D+VLSCVDNFEARM IN ACNEL Q W ESGVSENAVSGHIQ ++PG+  CF C PPL+VAS +DEKTLKR+GVCAASLPTTM IV+GFLVQNTLKY
Sbjct:   29 RREKLNEMSAEVVDSNPYSRLMALKRMGIVDNYEKIREFTVAVVGIGGVGSVTAEMLTRCGIGKLLLFDYDKVELANMNRLFFRPEHSGMSKVEAAVNTLRDINPDVEFEAYNYDITLMENFNHFLARISHGGFDNKAVDLVLSCVDNFEARMAINTACNELGQPWFESGVSENAVSGHIQYINPGEMACFACAPPLVVASNIDEKTLKREGVCAASLPTTMGIVAGFLVQNTLKY 264          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Nematostella
Match: EDO46454 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPW5])

HSP 1 Score: 66.2402 bits (160), Expect = 1.269e-11
Identity = 45/144 (31.25%), Postives = 69/144 (47.92%), Query Frame = 3
Query:  342 LVRCGIGKLILFDYDKVELANMNRLF-FQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITL----INNFEHFLGRLNQGGINNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLP 758
            LV  G   + L D D ++++N+NR F F     G SK + A+ +    NPD KI A + NIT     I+ F+ F              D+V++ +DN  AR  +N+ C   +   +ESG +     G   ++  G T C+EC P
Sbjct:   42 LVLTGFKNIDLIDLDTIDVSNLNRQFLFHKQHVGKSKAKVARESALRFNPDAKIVAIHDNITSPEYGIDYFKQF--------------DVVMNALDNRAARNHVNRMCLAADVPLVESGTA--GYLGQTTVIKKGVTECYECQP 169          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Nematostella
Match: EDO48528 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ71])

HSP 1 Score: 63.1586 bits (152), Expect = 8.322e-11
Identity = 83/298 (27.85%), Postives = 134/298 (44.97%), Query Frame = 3
Query:  171 NKRSKIDEMSAEVVDS--NPYSRLMALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIGKLILFDYDKVELANMNR-LFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGGINNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECL-----PPLIVASGVDEKTLKRDGVCAASLPTTMAIVSGFLVQNTLKYLLEFGTVS---EFIGYGAIQDNFYKVSLKPNPE----CGDRFCLKRQSEYQEF 1019
            N  SK +E +  + +S  + YSR + L  +G V+    ++  SV VVG GG+G   A  L   GIG L L DYD V+ +N++R +     +  + KVE+AK TL  +N D +   H   +  +N  +          I N+  D+++   DN   R  +N AC  L +  + SG S   + G + + +    PC+ CL     PP  V +  D   L   G     + T  AI         +  ++  G  S   + + Y A+   F +V L+P  +    CGD   +    +Y++F
Sbjct:    7 NIPSKQNEKTKNLTNSEISRYSRQLILPEIG-VKGQQSLKSSSVLVVGAGGLGCPAALYLAAAGIGCLGLVDYDVVDTSNLHRQVLHTEDRVEVPKVESAKQTLLRLNSDAQYNTHCLQLNSVNALD----------IINK-YDVIVDATDNVATRYLLNDAC-VLAKKPLVSG-SALRLEGQLVVYNHDNGPCYRCLFPTPPPPETVGNCSDNGVL---GAVPGIIGTLQAI--------EVIKIITSGKSSFSRKMLVYDAMDSRFLQVKLRPKQQTCSVCGDSPTIHTLIDYEQF 279          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Nematostella
Match: EDO38775 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBV9])

HSP 1 Score: 52.373 bits (124), Expect = 2.782e-7
Identity = 35/130 (26.92%), Postives = 65/130 (50.00%), Query Frame = 3
Query:  360 GKLILFDYDKVELANMNRLF-FQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGGINNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCF 746
            G + + D D +E +N+NR F F+P+    +K   + ++ + INP + IEAH   +      + F    N     +Q  ++V++ +DN EAR  ++  C    +  +E+G       GH+Q++ P  T  +
Sbjct:  445 GLISITDNDLIEKSNLNRQFLFRPHHIQKAKSTTSATSTKEINPSLHIEAHQQKVCPDTEQDTF----NDAFFESQ--EVVVNALDNVEARRYVDSRCVSNQRALLETGTM--GAKGHVQVIVPHLTESY 566          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Nematostella
Match: EDO29306 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T407])

HSP 1 Score: 47.3654 bits (111), Expect = 3.733e-6
Identity = 31/110 (28.18%), Postives = 47/110 (42.73%), Query Frame = 3
Query:  330 TAEMLVRCGIGKLILFDYDKVELANMNR-LFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGGINNQPIDIVLSCVDNFEARMTINKACNE 656
             AE L R G+G++ LFD D V ++N NR L       G  KVE   + +  INP   + A             F+ R        + +D V+ C+D+  A+  +   C  
Sbjct:   40 AAEALARSGVGEISLFDLDDVCVSNSNRQLHALDSTVGQPKVEVMAARIRAINPGCVVHA----------VADFVTRETMAEYITEQLDAVIDCIDSVNAKAALISWCKR 139          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Medaka
Match: uba5 (ubiquitin like modifier activating enzyme 5 [Source:NCBI gene;Acc:101172851])

HSP 1 Score: 437.573 bits (1124), Expect = 1.197e-151
Identity = 234/367 (63.76%), Postives = 286/367 (77.93%), Query Frame = 3
Query:  177 RSKIDEMSAEVVDSNPYSRLMALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIGKLILFDYDKVELANMNRLFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGGIN-NQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLPPLIVASGVDEKTLKRDGVCAASLPTTMAIVSGFLVQNTLKYLLEFGTVSEFIGYGAIQDNFYKVSLKPNPECGDRFCLKRQSEYQEFMRNNISISNAEVVKEEIVHEDNEFQIELVSD--EEDSLPAVGQ-PSLGDGVKLAYNPVKSRKENEEFVHKTDLSLDELMKQMKNL 1265
            R KID+MSAEVVDSNPYSRLMAL+RMGIVE+Y KIR  +VAVVGVGGVGSVTAEML RCGIGKL+LFDYDKVELANMNRLFFQP+Q+G+SKVEAA+ TL  INPDV  E HNYNIT + NF HF+ R++ GG+    P+D+VLSCVDNFEARM IN ACNEL QIW+ESGVSENAVSGHIQL++PG+T CF C PPL+VA+ +DEKTLKR+GVCAASLPTTM +V+G LVQN LKYLL+FG VS ++GY A+QD F  +++K NP+C DR C ++Q EY +           +  +EEIVHE+N++ IELVS+  +E+  PA G  P L +G+ +AY          E V +T+ SL++LM QMK L
Sbjct:   41 RPKIDKMSAEVVDSNPYSRLMALKRMGIVEDYEKIRTFTVAVVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVELANMNRLFFQPHQAGLSKVEAAEHTLRNINPDVVFETHNYNITTMQNFTHFMDRISNGGLEEGNPVDLVLSCVDNFEARMAINTACNELGQIWMESGVSENAVSGHIQLINPGETACFACAPPLVVAANIDEKTLKREGVCAASLPTTMGVVAGLLVQNVLKYLLKFGKVSYYLGYNAMQDFFPSMAMKANPQCHDRHCRRQQEEYTKKEMERPKEVFVQEEEEEIVHEENDWGIELVSEVTDEELQPASGTVPDLPEGITVAYTIPAEESAGGEVVEETEQSLEDLMAQMKKL 407          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Medaka
Match: uba5 (ubiquitin like modifier activating enzyme 5 [Source:NCBI gene;Acc:101172851])

HSP 1 Score: 397.512 bits (1020), Expect = 1.813e-136
Identity = 201/288 (69.79%), Postives = 237/288 (82.29%), Query Frame = 3
Query:  177 RSKIDEMSAEVVDSNPYSRLMALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIG---------KLILFDYDKVELANMNRLFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGGIN-NQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLPPLIVASGVDEKTLKRDGVCAASLPTTMAIVSGFLVQNTLKYLLEFGTVSEFIGYGAIQDNFYKVSLKPNPECGDRFCLKRQSEY 1010
            R KID+MSAEVVDSNPYSRLMAL+RMGIVE+Y KIR  +VAVVGVGGVGSVTAEML RCGIG          L+LFDYDKVELANMNRLFFQP+Q+G+SKVEAA+ TL  INPDV  E HNYNIT + NF HF+ R++ GG+    P+D+VLSCVDNFEARM IN ACNEL QIW+ESGVSENAVSGHIQL++PG+T CF C PPL+VA+ +DEKTLKR+GVCAASLPTTM +V+G LVQN LKYLL+FG VS ++GY A+QD F  +++K NP+C DR C ++Q EY
Sbjct:   42 RPKIDKMSAEVVDSNPYSRLMALKRMGIVEDYEKIRTFTVAVVGVGGVGSVTAEMLTRCGIGCLCMLLFWHSLLLFDYDKVELANMNRLFFQPHQAGLSKVEAAEHTLRNINPDVVFETHNYNITTMQNFTHFMDRISNGGLEEGNPVDLVLSCVDNFEARMAINTACNELGQIWMESGVSENAVSGHIQLINPGETACFACAPPLVVAANIDEKTLKREGVCAASLPTTMGVVAGLLVQNVLKYLLKFGKVSYYLGYNAMQDFFPSMAMKANPQCHDRHCRRQQEEY 329          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Medaka
Match: mocs3 (molybdenum cofactor synthesis 3 [Source:NCBI gene;Acc:101157580])

HSP 1 Score: 56.9954 bits (136), Expect = 2.012e-8
Identity = 77/296 (26.01%), Postives = 130/296 (43.92%), Query Frame = 3
Query:  165 MDNKRSKIDEMSAEVVDSNP----YSRLMALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIGKLILFDYDKVELANMNRLFFQPYQS-GMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGGINNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLPPLIVASGVDEKTLKRDGVCAASLPTTMAIVSGFLVQNTLKYLLEFGTV--SEFIGYGAIQDNFYKVSLKPNPE----CGDRFCLKRQSEYQEF 1019
            + +K + ++ ++A+   SN     YSR + L  +G V+   K+   SV VVG GG+G   A+ L   GIG+L L DYD+VEL+N++R      ++ G +K  +A  ++  +N  V+   ++  ++  N  +             Q  DIV  C DN   R  +N AC    +  + +  S   + G + + +    PC+ CL    V    +  T   DG     +P  M  +    V   LK     GT    + + + A    F  + L+P       CG+   + R  +Y+ F
Sbjct:   74 IQDKVTTLNPLTAKPSLSNEDIMRYSRQLLLPDLG-VQGQLKLSQTSVLVVGCGGLGCPLAQYLAAAGIGRLGLLDYDEVELSNLHRQVLHGEENQGQAKALSAARSVIRLNSGVECIPYHLQLSPENALQLV-----------QQYDIVADCSDNVPTRYLVNDACVLSGKPLVSA--SALRMEGQLTVYNYHGGPCYRCL--YPVPPPPETVTNCSDGGVLGVVPGIMGCLQALEV---LKIASGQGTACGQQLLLFDAQNARFRSIRLRPKQPSCVVCGEIPSVTRLVDYEAF 350          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Medaka
Match: uba2 (ubiquitin like modifier activating enzyme 2 [Source:NCBI gene;Acc:101172730])

HSP 1 Score: 57.3806 bits (137), Expect = 2.016e-8
Identity = 42/143 (29.37%), Postives = 69/143 (48.25%), Query Frame = 3
Query:  342 LVRCGIGKLILFDYDKVELANMNRLF-FQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLIN---NFEHFLGRLNQGGINNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLP 758
            LV  G   + + D D ++++N+NR F FQ    G SK + AK ++    P   I A  Y+ +++N   N E F   +           +V++ +DN  AR  +N+ C   +   IESG +     G + ++  G T C+EC P
Sbjct:   37 LVLTGFKNIEVIDLDTIDVSNLNRQFLFQKKHVGKSKAQVAKESVLQFCPSANITA--YHDSIMNPDYNVEFFRKFM-----------LVMNALDNRAARNHVNRMCLAADVPLIESGTA--GYLGQVTVIKKGLTECYECQP 164          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Planmine SMEST
Match: SMESG000020505.1 (SMESG000020505.1)

HSP 1 Score: 751.895 bits (1940), Expect = 0.000e+0
Identity = 397/398 (99.75%), Postives = 398/398 (100.00%), Query Frame = 3
Query:   72 MSNYNNVSRXXXXXXXXXXXXXXXXNEINRDMDNKRSKIDEMSAEVVDSNPYSRLMALQRMGIVENYSKIRDKXXXXXXXXXXXXXTAEMLVRCGIGKLILFDYDKVELANMNRLFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGGINNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLPPLIVASGVDEKTLKRDGVCAASLPTTMAIVSGFLVQNTLKYLLEFGTVSEFIGYGAIQDNFYKVSLKPNPECGDRFCLKRQSEYQEFMRNNISISNAEVVKEEIVHEDNEFQIELVSDEEDSLPAVGQPSLGDGVKLAYNPVKSRKENEEFVHKTDLSLDELMKQMKNL 1265
            MSNYNNVSREELLEIIKSLELKNKENEI+RDMDNKRSKIDEMSAEVVDSNPYSRLMALQRMGIVENYSKIRDKSVAVVGVGGVGSVTAEMLVRCGIGKLILFDYDKVELANMNRLFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGGINNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLPPLIVASGVDEKTLKRDGVCAASLPTTMAIVSGFLVQNTLKYLLEFGTVSEFIGYGAIQDNFYKVSLKPNPECGDRFCLKRQSEYQEFMRNNISISNAEVVKEEIVHEDNEFQIELVSDEEDSLPAVGQPSLGDGVKLAYNPVKSRKENEEFVHKTDLSLDELMKQMKNL
Sbjct:    1 MSNYNNVSREELLEIIKSLELKNKENEIHRDMDNKRSKIDEMSAEVVDSNPYSRLMALQRMGIVENYSKIRDKSVAVVGVGGVGSVTAEMLVRCGIGKLILFDYDKVELANMNRLFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGGINNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLPPLIVASGVDEKTLKRDGVCAASLPTTMAIVSGFLVQNTLKYLLEFGTVSEFIGYGAIQDNFYKVSLKPNPECGDRFCLKRQSEYQEFMRNNISISNAEVVKEEIVHEDNEFQIELVSDEEDSLPAVGQPSLGDGVKLAYNPVKSRKENEEFVHKTDLSLDELMKQMKNL 398          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Planmine SMEST
Match: SMESG000001644.1 (SMESG000001644.1)

HSP 1 Score: 67.0106 bits (162), Expect = 7.686e-12
Identity = 61/240 (25.42%), Postives = 102/240 (42.50%), Query Frame = 3
Query:  342 LVRCGIGKLILFDYDKVELANMNR-LFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGGINNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECL----PPLIVASGVDEKTLKRDGVCAASLPTTMAIVSGFLVQNTLKYLLEFGTV--SEFIGYGAIQDNFYKVSLKPNPE----CGDRFCLKRQSEYQEFMRN 1028
            L   GIG + L D+D V+ +N++R +  +  + G+SKVE+   +L+ +N  + IEAH           H L   N      +  D+VL C DN   R  IN  C  L +  + +  S     G + + +    PC+ CL    PP    +  +E            L T   ++       T+K L + GT    + + Y A   +F  + L+   +    CGD   +    +Y+EF ++
Sbjct:   53 LAGAGIGTIGLVDHDVVDESNLHRQICHKESKIGLSKVESLSESLKLLNSSLNIEAH-----------HILINNNNAIDIIKNYDVVLDCTDNVVTRYLINDCCVILKKPLVSA--SALGFEGQLTVYNYNNGPCYRCLFPIPPPANTVTNCNE---------GGVLGTVPGMLGTLQATETIKILTQIGTTFSGKMLLYDAEVGSFRNIKLRGRNKDCAVCGDNPIITAPIDYEEFCQS 270          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Planmine SMEST
Match: SMESG000047759.1 (SMESG000047759.1)

HSP 1 Score: 65.4698 bits (158), Expect = 4.040e-11
Identity = 45/141 (31.91%), Postives = 72/141 (51.06%), Query Frame = 3
Query:  342 LVRCGIGKLILFDYDKVELANMNRLF-FQPYQSGMSKVEAAKSTLEFINPDVKIEA-HNYNITLINNFEHFLGRLNQGGINNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFECLP 758
            LV     ++ + D D ++++N+NR F F+    G SK   AK ++   NP+V I+A H+  ++   N + F           +  DIVL+ +DN  AR  +N+ C + N   IE G       G +Q++  GKT C+EC P
Sbjct:   25 LVMWNFKEITVIDLDTIDVSNLNRQFLFRKENVGKSKALTAKESVLKFNPNVNIKAIHDDVMSNKYNADFF-----------KTFDIVLNALDNKAARNYVNRMCLKSNIPLIEGGTM--GYRGQVQVILKGKTACYECYP 152          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Planmine SMEST
Match: SMESG000073442.1 (SMESG000073442.1)

HSP 1 Score: 56.6102 bits (135), Expect = 1.890e-9
Identity = 39/137 (28.47%), Postives = 65/137 (47.45%), Query Frame = 3
Query:  342 LVRCGIGKLILFDYDKVELANMNRLF-FQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGGINNQPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKTPCFE 749
            LV   + ++ + D D +++ N+NR F F+    G SK   AK ++   NP+V ++A N ++        F           +  DIVL  +DN  AR  +++ C   N   I+ G       G +Q++  GKT C+E
Sbjct:   25 LVMRNLKEIAVIDLDTIDVGNLNRQFLFRKKNVGKSKALTAKESVLKFNPNVNLKAINDDVMSNKYNADFF----------KTFDIVLKALDNKAARNYVSRMCLRSNNQLIKGGTM--GYRGQVQVILKGKTACYE 149          
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Planmine SMEST
Match: SMESG000021287.1 (SMESG000021287.1)

HSP 1 Score: 53.5286 bits (127), Expect = 2.623e-7
Identity = 37/130 (28.46%), Postives = 68/130 (52.31%), Query Frame = 3
Query:  360 GKLILFDYDKVELANMNRLF-FQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNITLINNFEHFLGRLNQGGINN---QPIDIVLSCVDNFEARMTINKACNELNQIWIESGVSENAVSGHIQLMHPGKT 737
            GK+++ D D +E +N+NR F F+ +     K    + ++  INP++ IEAH          ++F+G   +   ++   Q ID+ L+ +DN ++R  ++  C    +  IESG    +  GH+Q++ P  T
Sbjct:  542 GKIVITDNDLIEKSNLNRQFLFKAHHIKQPKSLVCRQSVLEINPNMSIEAH----------QNFVGIATENIYSDNFFQQIDVCLNALDNIDSRKYMDNRCVINEKYLIESGTM--STKGHVQVIIPHLT 659          
The following BLAST results are available for this feature:
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UBA53.488e-13969.58ubiquitin like modifier activating enzyme 5 [Sourc... [more]
UBA57.085e-13960.74ubiquitin like modifier activating enzyme 5 [Sourc... [more]
UBA51.388e-13869.58ubiquitin like modifier activating enzyme 5 [Sourc... [more]
UBA59.679e-12757.26ubiquitin like modifier activating enzyme 5 [Sourc... [more]
UBA59.679e-12757.26ubiquitin like modifier activating enzyme 5 [Sourc... [more]
back to top
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
uba-54.588e-15062.26Ubiquitin-like modifier-activating enzyme 5 [Sour... [more]
uba-54.588e-15062.26Ubiquitin-like modifier-activating enzyme 5 [Sour... [more]
moc-34.934e-1130.81Adenylyltransferase and sulfurtransferase MOCS3 Mo... [more]
uba-21.009e-828.57SUMO-activating enzyme subunit uba-2 [Source:UniP... [more]
uba-11.849e-731.21UBA (Human ubiquitin) related [Source:UniProtKB/T... [more]
back to top
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Uba53.310e-15663.61gene:FBgn0030305 transcript:FBtr0073505[more]
Uba27.932e-1432.14gene:FBgn0029113 transcript:FBtr0076734[more]
Uba46.237e-1230.94gene:FBgn0032054 transcript:FBtr0079683[more]
Uba46.237e-1230.94gene:FBgn0032054 transcript:FBtr0333414[more]
Uba46.237e-1230.94gene:FBgn0032054 transcript:FBtr0333413[more]
back to top
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
uba55.434e-15363.41ubiquitin-like modifier activating enzyme 5 [Sourc... [more]
uba55.076e-15163.24ubiquitin-like modifier activating enzyme 5 [Sourc... [more]
uba25.625e-1027.89ubiquitin-like modifier activating enzyme 2 [Sourc... [more]
uba25.734e-1027.89ubiquitin-like modifier activating enzyme 2 [Sourc... [more]
uba26.357e-1027.89ubiquitin-like modifier activating enzyme 2 [Sourc... [more]
back to top
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fam110c3.082e-15563.24family with sequence similarity 110 member C [Sour... [more]
fam110c6.815e-13458.65family with sequence similarity 110 member C [Sour... [more]
fam110c7.853e-13363.58family with sequence similarity 110 member C [Sour... [more]
arf43.454e-828.78ADP ribosylation factor 4 [Source:Xenbase;Acc:XB-G... [more]
arf47.807e-828.99ADP ribosylation factor 4 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Uba53.639e-14760.48ubiquitin-like modifier activating enzyme 5 [Sourc... [more]
Uba52.941e-1774.63ubiquitin-like modifier activating enzyme 5 [Sourc... [more]
Uba54.259e-1774.63ubiquitin-like modifier activating enzyme 5 [Sourc... [more]
Uba52.042e-1675.81ubiquitin-like modifier activating enzyme 5 [Sourc... [more]
Uba28.008e-1129.93ubiquitin-like modifier activating enzyme 2 [Sourc... [more]
back to top
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B4PYA4|UBA5_DROYA7.194e-15663.78Ubiquitin-like modifier-activating enzyme 5 OS=Dro... [more]
sp|B4IK21|UBA5_DROSE8.126e-15663.78Ubiquitin-like modifier-activating enzyme 5 OS=Dro... [more]
sp|Q9VYY3|UBA5_DROME3.318e-15563.61Ubiquitin-like modifier-activating enzyme 5 OS=Dro... [more]
sp|B4R345|UBA5_DROSI8.113e-15563.51Ubiquitin-like modifier-activating enzyme 5 OS=Dro... [more]
sp|Q6GLG7|UBA5_XENTR1.633e-15463.24Ubiquitin-like modifier-activating enzyme 5 OS=Xen... [more]
back to top
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4V3SEK91.715e-16663.90ThiF domain-containing protein OS=Opisthorchis fel... [more]
A0A419PZS43.301e-16663.38Ubiquitin-like modifier-activating enzyme 5 OS=Clo... [more]
G7YDE83.931e-16663.38Ubiquitin-like modifier-activating enzyme 5 OS=Clo... [more]
A0A074YX311.135e-16362.44ThiF domain-containing protein OS=Opisthorchis viv... [more]
A0A131YTP34.106e-16165.04Ubiquitin-like modifier-activating enzyme 5 OS=Rhi... [more]
back to top
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
uba57.151e-14360.57ubiquitin like modifier activating enzyme 5 [Sourc... [more]
uba26.129e-927.21ubiquitin like modifier activating enzyme 2 [Sourc... [more]
uba13.628e-726.57ubiquitin like modifier activating enzyme 1 [Sourc... [more]
uba14.273e-726.57ubiquitin like modifier activating enzyme 1 [Sourc... [more]
back to top
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
uba54.468e-11573.99ubiquitin-like modifier activating enzyme 5 [Sourc... [more]
back to top
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
UBA22.210e-931.34Subunit of heterodimeric nuclear SUMO activating e... [more]
back to top
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO372751.399e-12376.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO464541.269e-1131.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO485288.322e-1127.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387752.782e-726.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO293063.733e-628.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
uba51.197e-15163.76ubiquitin like modifier activating enzyme 5 [Sourc... [more]
uba51.813e-13669.79ubiquitin like modifier activating enzyme 5 [Sourc... [more]
mocs32.012e-826.01molybdenum cofactor synthesis 3 [Source:NCBI gene;... [more]
uba22.016e-829.37ubiquitin like modifier activating enzyme 2 [Sourc... [more]
back to top
BLAST of Ubiquitin-like modifier-activating enzyme 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020505.10.000e+099.75SMESG000020505.1[more]
SMESG000001644.17.686e-1225.42SMESG000001644.1[more]
SMESG000047759.14.040e-1131.91SMESG000047759.1[more]
SMESG000073442.11.890e-928.47SMESG000073442.1[more]
SMESG000021287.12.623e-728.46SMESG000021287.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002972 ID=SMED30002972|Name=Ubiquitin-like modifier-activating enzyme 5|organism=Schmidtea mediterranea sexual|type=transcript|length=1370bp
TTGTATTCAAAATTTATTATGCCACATTGACAAAAAATATTTTTAATTCT
AATTAACTTAAATTTGCAAAAATGAGCAATTACAATAATGTTTCAAGAGA
GGAATTACTCGAAATTATTAAATCACTAGAATTAAAAAATAAAGAAAATG
AAATTAACAGAGATATGGACAATAAACGAAGTAAAATTGACGAAATGAGT
GCAGAAGTTGTTGATTCCAATCCTTACAGTAGACTCATGGCTTTGCAGAG
GATGGGGATTGTTGAAAATTATTCAAAAATAAGAGATAAATCTGTTGCAG
TAGTTGGAGTTGGTGGAGTGGGTTCTGTAACTGCAGAAATGTTAGTTCGA
TGCGGAATCGGAAAGTTAATATTATTCGATTATGATAAAGTTGAATTAGC
TAATATGAATCGCTTATTTTTTCAACCCTACCAATCTGGTATGTCTAAAG
TGGAAGCAGCAAAATCAACTCTCGAATTTATTAATCCCGATGTGAAAATT
GAAGCTCATAATTACAATATCACATTAATAAATAATTTCGAGCATTTTCT
CGGTCGATTAAATCAAGGTGGAATTAATAACCAACCAATTGATATTGTTC
TAAGTTGTGTTGACAATTTTGAGGCTCGCATGACAATAAATAAAGCTTGC
AATGAATTGAATCAAATTTGGATTGAATCAGGAGTTAGTGAAAACGCAGT
TTCCGGACATATACAGTTAATGCATCCTGGCAAAACTCCATGCTTTGAAT
GTCTTCCACCTTTAATTGTCGCTTCCGGTGTCGACGAGAAGACTTTGAAA
CGTGATGGAGTCTGTGCGGCATCCTTACCGACTACTATGGCAATAGTTTC
TGGATTTCTGGTACAAAATACTTTGAAATACCTTCTGGAATTCGGTACCG
TTTCGGAATTTATCGGTTACGGAGCGATACAAGATAATTTTTATAAAGTT
TCATTGAAACCGAATCCAGAATGTGGAGATCGATTTTGTCTGAAACGTCA
ATCGGAATATCAGGAATTCATGAGGAACAATATCAGCATTTCAAATGCAG
AAGTTGTCAAGGAGGAAATTGTCCATGAAGATAATGAATTCCAAATCGAA
TTGGTATCGGATGAAGAGGACTCATTGCCGGCTGTTGGTCAACCGAGTCT
CGGTGATGGAGTAAAATTGGCCTACAATCCAGTGAAATCCAGAAAGGAAA
ATGAGGAATTTGTCCATAAAACCGATCTGTCGTTGGATGAGCTGATGAAA
CAAATGAAGAATTTATGAGAGCTTATTTTATTTTATTTCCTATCGTAAAT
TGTGATGTTTTCTGTTTTCGTTCCAATGAGAATAGGATTTTGATGAATAA
TAAAATTGTCTTGAAAAAAA
back to top

protein sequence of SMED30002972-orf-1

>SMED30002972-orf-1 ID=SMED30002972-orf-1|Name=SMED30002972-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=399bp
MSNYNNVSREELLEIIKSLELKNKENEINRDMDNKRSKIDEMSAEVVDSN
PYSRLMALQRMGIVENYSKIRDKSVAVVGVGGVGSVTAEMLVRCGIGKLI
LFDYDKVELANMNRLFFQPYQSGMSKVEAAKSTLEFINPDVKIEAHNYNI
TLINNFEHFLGRLNQGGINNQPIDIVLSCVDNFEARMTINKACNELNQIW
IESGVSENAVSGHIQLMHPGKTPCFECLPPLIVASGVDEKTLKRDGVCAA
SLPTTMAIVSGFLVQNTLKYLLEFGTVSEFIGYGAIQDNFYKVSLKPNPE
CGDRFCLKRQSEYQEFMRNNISISNAEVVKEEIVHEDNEFQIELVSDEED
SLPAVGQPSLGDGVKLAYNPVKSRKENEEFVHKTDLSLDELMKQMKNL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR035985Ubiquitin-activating_enz
IPR000594ThiF_NAD_FAD-bd
IPR016040NAD(P)-bd_dom
IPR029752D-isomer_DH_CS1
Vocabulary: molecular function
TermDefinition
GO:0008641small protein activating enzyme activity
GO:0000166nucleotide binding
GO:0005524ATP binding
GO:0046872metal ion binding
GO:0071566UFM1 activating enzyme activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0071569protein ufmylation
GO:1990592protein K69-linked ufmylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 69..327
e-value: 6.5E-80
score: 270.1
NoneNo IPR availablePANTHERPTHR10953UBIQUITIN-ACTIVATING ENZYME E1coord: 28..397
NoneNo IPR availablePANTHERPTHR10953:SF9UBIQUITIN-LIKE MODIFIER-ACTIVATING ENZYME 5coord: 28..397
NoneNo IPR availableCDDcd00757ThiF_MoeB_HesA_familycoord: 51..295
e-value: 1.924E-63
score: 201.167
IPR000594THIF-type NAD/FAD binding foldPFAMPF00899ThiFcoord: 52..299
e-value: 1.2E-49
score: 168.9
IPR029752D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding domain conserved site 1PROSITEPS00065D_2_HYDROXYACID_DH_1coord: 75..103
IPR035985Ubiquitin-activating enzymeSUPERFAMILYSSF69572Activating enzymes of the ubiquitin-like proteinscoord: 34..314