Anoctamin

Overview
NameAnoctamin
Smed IDSMED30002957
Length (bp)3039
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Anoctamin (SMED30002957) t-SNE clustered cells

Violin plots show distribution of expression levels for Anoctamin (SMED30002957) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Anoctamin (SMED30002957) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Anoctamin (SMED30002957) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002957

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30002957SMESG000033732.1 dd_Smed_v4_4608_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002957SMESG000033732.1 dd_Smed_v4_4608_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Anoctamin vs. Ensembl Human
Match: ANO4 (anoctamin 4 [Source:HGNC Symbol;Acc:HGNC:23837])

HSP 1 Score: 382.489 bits (981), Expect = 1.217e-116
Identity = 302/939 (32.16%), Postives = 465/939 (49.52%), Query Frame = 2
Query:  137 EKEKNNKGMFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIR----KSIMNAGVDYNYIXXXXXXXXXXXX--XXXXXSIDNKRLKPIAQG--YTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGK-----YKKENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISERNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRN---LLRLQLTYVMSKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGS--DSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICY----QDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLG--------GFVDFSLSFMNTTEFNISSSISNE---------THCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELE 2836
            E+ K+N G++F D   RID++LVY++   S  +  KR  F  ++  EGL++E            +S   NSD        ++FVK+HA W+ L RYAE M +R    + I      Y ++ +   +          +   +D + L  + +   YT PFS+Q+ + F I  N+  FF    RS IV++IL+R  Y                                       E G N   G+ +L++   +E AF LHE     K     +  EN R LLY+ WA+    +++QPLD +R YFGE +  YFAWLG+YT  LFP A  G+ V +Y + T+    + +E+ +  +I MCPV   +  C   +LS   V   +  L DNGATV  A  ++VW  +FLE W+R++  +A+ W++ D E E+E +RP++ A   K    + N ISGK EP+ +F  +     +++ S I F I + +A + GI + + +  +     +  L    S+++T      I+   I++L  +Y +VA+ LT+LE  RT+S+++NS T K+++ +F+N  SS FYI F        PG+     +  + + C    CL+DL MQ+  I+V KQ  +N +    P     I+ +  +R      K R  H P                          E KI +    +D  L       LF EYLEMI+QFGF TIF+  FPLAPLLA++NN++EIR DA KFVT +RRP+A R KDIGIW  IL  I  + V +NA +IA  + +I R++Y   +      G        G+V+ SLS    ++F   S   ++          +C Y  +R PP  +   P  YT  FW +LAA++AF+ +FE  V     +   +IP++P + R  M+RE  +  E + + ELE
Sbjct:   68 ERNKSN-GLYFRDGKCRIDYILVYRK---SNPQTEKREVFERNIRAEGLQME-----------KESSLINSD--------IIFVKLHAPWEVLGRYAEQMNVRMPFRRKIYYLPRRYKFMSRIDKQISRFRRWLPKKPMRLDKETLPDLEENDCYTAPFSQQRIHHFIIH-NKETFFNNATRSRIVHHILQRIKY---------------------------------------EEGKN-KIGLNRLLTNGSYEAAFPLHEGSYRSKNSIRTHGAENHRHLLYECWASWGVWYKYQPLDLVRRYFGEKIGLYFAWLGWYTGMLFPAAFIGLFVFLYGVTTLDHSQVSKEVCQATDIIMCPV--CDKYCPFMRLSDSCVYAKVTHLFDNGATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLIDWEEEEEEIRPQFEAKYSKK--ERMNPISGKPEPYQAF-TDKCSRLIVSASGIFFMICVVIAAVFGIVIYRVVTVSTFAAFKWALIRNNSQVATTGTAVCINFCIIMLLNVLYEKVALLLTNLEQPRTESEWENSFTLKMFLFQFVNLNSSTFYIAFFLGRFTGHPGAYLRLINRWRLEECHPSGCLIDLCMQMGIIMVLKQTWNNFMELGYP----LIQNWWTRR------KVRQEHGP--------------------------ERKISFPQWEKDYNLQPMNAYGLFDEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPLASRAKDIGIWYGILEGIGILSVITNAFVIAITSDFIPRLVYAYKYGPCAGQGEAGQKCMVGYVNASLSVFRISDFENRSEPESDGSEFSGTPLKYCRYRDYRDPPHSL--VPYGYTLQFWHVLAARLAFIIVFEHLVFCIKHLISYLIPDLPKDLRDRMRREKYLIQEMMYEAELE 899          
BLAST of Anoctamin vs. Ensembl Human
Match: ANO4 (anoctamin 4 [Source:HGNC Symbol;Acc:HGNC:23837])

HSP 1 Score: 382.104 bits (980), Expect = 2.709e-116
Identity = 302/939 (32.16%), Postives = 465/939 (49.52%), Query Frame = 2
Query:  137 EKEKNNKGMFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIR----KSIMNAGVDYNYIXXXXXXXXXXXX--XXXXXSIDNKRLKPIAQG--YTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGK-----YKKENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISERNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRN---LLRLQLTYVMSKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGS--DSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICY----QDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLG--------GFVDFSLSFMNTTEFNISSSISNE---------THCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELE 2836
            E+ K+N G++F D   RID++LVY++   S  +  KR  F  ++  EGL++E            +S   NSD        ++FVK+HA W+ L RYAE M +R    + I      Y ++ +   +          +   +D + L  + +   YT PFS+Q+ + F I  N+  FF    RS IV++IL+R  Y                                       E G N   G+ +L++   +E AF LHE     K     +  EN R LLY+ WA+    +++QPLD +R YFGE +  YFAWLG+YT  LFP A  G+ V +Y + T+    + +E+ +  +I MCPV   +  C   +LS   V   +  L DNGATV  A  ++VW  +FLE W+R++  +A+ W++ D E E+E +RP++ A   K    + N ISGK EP+ +F  +     +++ S I F I + +A + GI + + +  +     +  L    S+++T      I+   I++L  +Y +VA+ LT+LE  RT+S+++NS T K+++ +F+N  SS FYI F        PG+     +  + + C    CL+DL MQ+  I+V KQ  +N +    P     I+ +  +R      K R  H P                          E KI +    +D  L       LF EYLEMI+QFGF TIF+  FPLAPLLA++NN++EIR DA KFVT +RRP+A R KDIGIW  IL  I  + V +NA +IA  + +I R++Y   +      G        G+V+ SLS    ++F   S   ++          +C Y  +R PP  +   P  YT  FW +LAA++AF+ +FE  V     +   +IP++P + R  M+RE  +  E + + ELE
Sbjct:  103 ERNKSN-GLYFRDGKCRIDYILVYRK---SNPQTEKREVFERNIRAEGLQME-----------KESSLINSD--------IIFVKLHAPWEVLGRYAEQMNVRMPFRRKIYYLPRRYKFMSRIDKQISRFRRWLPKKPMRLDKETLPDLEENDCYTAPFSQQRIHHFIIH-NKETFFNNATRSRIVHHILQRIKY---------------------------------------EEGKN-KIGLNRLLTNGSYEAAFPLHEGSYRSKNSIRTHGAENHRHLLYECWASWGVWYKYQPLDLVRRYFGEKIGLYFAWLGWYTGMLFPAAFIGLFVFLYGVTTLDHSQVSKEVCQATDIIMCPV--CDKYCPFMRLSDSCVYAKVTHLFDNGATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLIDWEEEEEEIRPQFEAKYSKK--ERMNPISGKPEPYQAF-TDKCSRLIVSASGIFFMICVVIAAVFGIVIYRVVTVSTFAAFKWALIRNNSQVATTGTAVCINFCIIMLLNVLYEKVALLLTNLEQPRTESEWENSFTLKMFLFQFVNLNSSTFYIAFFLGRFTGHPGAYLRLINRWRLEECHPSGCLIDLCMQMGIIMVLKQTWNNFMELGYP----LIQNWWTRR------KVRQEHGP--------------------------ERKISFPQWEKDYNLQPMNAYGLFDEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPLASRAKDIGIWYGILEGIGILSVITNAFVIAITSDFIPRLVYAYKYGPCAGQGEAGQKCMVGYVNASLSVFRISDFENRSEPESDGSEFSGTPLKYCRYRDYRDPPHSL--VPYGYTLQFWHVLAARLAFIIVFEHLVFCIKHLISYLIPDLPKDLRDRMRREKYLIQEMMYEAELE 934          
BLAST of Anoctamin vs. Ensembl Human
Match: ANO1 (anoctamin 1 [Source:HGNC Symbol;Acc:HGNC:21625])

HSP 1 Score: 376.326 bits (965), Expect = 3.456e-115
Identity = 269/891 (30.19%), Postives = 448/891 (50.28%), Query Frame = 2
Query:  227 EEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIRKSI--MNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYKKENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEI-SERNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAA-LLEKNYISQFNKISGKEEPFISF-WKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRNLLRLQLTYVMS---KLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGSDS--FSMIKPQGCLTGDCLLDLSMQLIFILVGKQII-SNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLGGFVDFSLSFMNTTEFNISSSISNETH-------CSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELEEHR 2845
            ++KR +R  +  +L++ GLE+E                    D   +   + FVKIHA W+ LCR AE +K++     M    +   + +                +   R + + +  +YPFS++K +LFD+  ++  FF    RS IV  ILKR                                             +  + GI  L++  V+  A+ LH+   NG+  + N R LLY+ WA     +++QP+D +R YFGE +  YFAWLG YT  L P ++ G+ V +Y  AT+  +I   E+  +R+NITMCP+   + +C  WK+S+         L DN ATV  +  +++W   F+E W+RKQ  L +RW++   E E++  R EY A +LEK   S   +   KE   +   W++  P  +  + +I+F I +T A + G+ + +  +   L +  +  +    +++  A   +I+L+ II+L  VY  +A WLT +E  +T+  ++  +  K ++L+F+N+Y+ +FY+ F       +PG     F   + + C  G CL++L +QL  I++GKQ+I +N+    IP++              K I+   + + +  D+E    EC         VK +   ++ Y     +   P     EY+EMIIQFGF+T+F+  FPLAPL A++NN++EIR DAKKFVT  RRPVA R KDIGIW +IL  I K+ V  NA +I+F + +I R++Y+ ++S+N  + GFV+ +LS  N ++F   ++ ++          C Y  +R PPW  +   +S    FW +LAA++AFV +F+  V         +IP+IP +    + +E  +  E  ++ E ++ +
Sbjct:    6 DDKRFRREEYEGNLLEAGLELE-------------------RDEDTKIHGVGFVKIHAPWNVLCREAEFLKLKMPTKKMYHINETRGLLKKINSVLQKITDPIQPKVAEHRPQTMKR-LSYPFSREKQHLFDLS-DKDSFFDSKTRSTIVYEILKRTTCTK----------------------------------------AKYSMGITSLLANGVYAAAYPLHDGDYNGENVEFNDRKLLYEEWARYGVFYKYQPIDLVRKYFGEKIGLYFAWLGVYTQMLIPASIVGIIVFLYGCATMDENIPSMEMCDQRHNITMCPL--CDKTCSYWKMSSACATARASHLFDNPATVFFSVFMALWAATFMEHWKRKQMRLNYRWDLTGFEEEEDHPRAEYEARVLEK---SLKKESRNKETDKVKLTWRDRFPAYLTNLVSIIFMIAVTFAIVLGVIIYRISMAAALAMNSSPSVRSNIRVTVTATAVIINLVVIILLDEVYGCIARWLTKIEVPKTEKSFEERLIFKAFLLKFVNSYTPIFYVAFFKGRFVGRPGDYVYIFRSFRMEECAPGGCLMELCIQLSIIMLGKQLIQNNLFEIGIPKM-------------KKLIRYLKLKQQSPPDHE----EC---------VKRKQRYEVDYNLEPFAGLTP-----EYMEMIIQFGFVTLFVASFPLAPLFALLNNIIEIRLDAKKFVTELRRPVAVRAKDIGIWYNILRGIGKLAVIINAFVISFTSDFIPRLVYLYMYSKNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKYDISKD--FWAVLAARLAFVIVFQNLVMFMSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQ 797          
BLAST of Anoctamin vs. Ensembl Human
Match: ANO4 (anoctamin 4 [Source:HGNC Symbol;Acc:HGNC:23837])

HSP 1 Score: 381.719 bits (979), Expect = 9.753e-115
Identity = 302/939 (32.16%), Postives = 465/939 (49.52%), Query Frame = 2
Query:  137 EKEKNNKGMFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIR----KSIMNAGVDYNYIXXXXXXXXXXXX--XXXXXSIDNKRLKPIAQG--YTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGK-----YKKENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISERNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRN---LLRLQLTYVMSKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGS--DSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICY----QDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLG--------GFVDFSLSFMNTTEFNISSSISNE---------THCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELE 2836
            E+ K+N G++F D   RID++LVY++   S  +  KR  F  ++  EGL++E            +S   NSD        ++FVK+HA W+ L RYAE M +R    + I      Y ++ +   +          +   +D + L  + +   YT PFS+Q+ + F I  N+  FF    RS IV++IL+R  Y                                       E G N   G+ +L++   +E AF LHE     K     +  EN R LLY+ WA+    +++QPLD +R YFGE +  YFAWLG+YT  LFP A  G+ V +Y + T+    + +E+ +  +I MCPV   +  C   +LS   V   +  L DNGATV  A  ++VW  +FLE W+R++  +A+ W++ D E E+E +RP++ A   K    + N ISGK EP+ +F  +     +++ S I F I + +A + GI + + +  +     +  L    S+++T      I+   I++L  +Y +VA+ LT+LE  RT+S+++NS T K+++ +F+N  SS FYI F        PG+     +  + + C    CL+DL MQ+  I+V KQ  +N +    P     I+ +  +R      K R  H P                          E KI +    +D  L       LF EYLEMI+QFGF TIF+  FPLAPLLA++NN++EIR DA KFVT +RRP+A R KDIGIW  IL  I  + V +NA +IA  + +I R++Y   +      G        G+V+ SLS    ++F   S   ++          +C Y  +R PP  +   P  YT  FW +LAA++AF+ +FE  V     +   +IP++P + R  M+RE  +  E + + ELE
Sbjct:  269 ERNKSN-GLYFRDGKCRIDYILVYRK---SNPQTEKREVFERNIRAEGLQME-----------KESSLINSD--------IIFVKLHAPWEVLGRYAEQMNVRMPFRRKIYYLPRRYKFMSRIDKQISRFRRWLPKKPMRLDKETLPDLEENDCYTAPFSQQRIHHFIIH-NKETFFNNATRSRIVHHILQRIKY---------------------------------------EEGKN-KIGLNRLLTNGSYEAAFPLHEGSYRSKNSIRTHGAENHRHLLYECWASWGVWYKYQPLDLVRRYFGEKIGLYFAWLGWYTGMLFPAAFIGLFVFLYGVTTLDHSQVSKEVCQATDIIMCPV--CDKYCPFMRLSDSCVYAKVTHLFDNGATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLIDWEEEEEEIRPQFEAKYSKK--ERMNPISGKPEPYQAF-TDKCSRLIVSASGIFFMICVVIAAVFGIVIYRVVTVSTFAAFKWALIRNNSQVATTGTAVCINFCIIMLLNVLYEKVALLLTNLEQPRTESEWENSFTLKMFLFQFVNLNSSTFYIAFFLGRFTGHPGAYLRLINRWRLEECHPSGCLIDLCMQMGIIMVLKQTWNNFMELGYPL----IQNWWTRR------KVRQEHGP--------------------------ERKISFPQWEKDYNLQPMNAYGLFDEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPLASRAKDIGIWYGILEGIGILSVITNAFVIAITSDFIPRLVYAYKYGPCAGQGEAGQKCMVGYVNASLSVFRISDFENRSEPESDGSEFSGTPLKYCRYRDYRDPPHSL--VPYGYTLQFWHVLAARLAFIIVFEHLVFCIKHLISYLIPDLPKDLRDRMRREKYLIQEMMYEAELE 1100          
BLAST of Anoctamin vs. Ensembl Human
Match: ANO2 (anoctamin 2 [Source:HGNC Symbol;Acc:HGNC:1183])

HSP 1 Score: 374.015 bits (959), Expect = 8.844e-113
Identity = 278/880 (31.59%), Postives = 438/880 (49.77%), Query Frame = 2
Query:  320 NIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIRKSI------MNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYKKENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISERNN-ITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVED----EPLRPEYAALLEKNYISQFNKIS-----------GKEEPFISF-WKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRNLLRL-QLTYVMSKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGS-----DSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQII-SNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLGGFVDFSLSFMNTTEFNISSSISNE------THCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELEEHRNI 2851
            N+ ++  E   D+  +S+  +FV+IHA W  L R AE +KI+         + AG      F +  +K       R+    N ++K +    +YPFS++K YL++I   +  FF    RS IV+ ILKR                              S +N+++             GI  LI+  ++E A+ LH+   +      N R LLY+ WA     ++ QP+D IR YFGE +  YFAWLG YT +L P ++ GV V +Y  ATI  DI  +E+ ++ N  TMCP+   + SC+ W LS+         L DN ATV  +  +++W  +FLE W+R Q  L + W++  +E E+    E  RPEY   + +  + + N+ +           G E+      WK+  P  ++  ++ILF I LT + + G+ V +      L L + T    +++  A   +I+L+ I+IL  +Y  VA WLT +E  +T+  ++  +  K ++L+F+N YS +FY+ F       +PGS     D + M   + C  G CL++L +QL  I++GKQ+I +NI    +P+L    +                            E E  +  TD    K   +  + Y     +   P     EY+EMIIQFGF+T+F+  FPLAP+ A++NN++E+R DAKKFVT  RRP A R KDIGIW DIL+ I K  V SNA +IA  + +I R++Y   +S N  L GFV+ +LSF N ++    +   N         C +  +R PPW  +  P  ++  +W +L+A++AFV +F+  V     +   +IP+IP +    +K+E ++  +F LK   EEH  +
Sbjct:  165 NLMEAGLELEKDLENKSQGSIFVRIHAPWQVLAREAEFLKIKVPTKKEMYEIKAGGSIAKKFSAALQKLSSHLQPRVPEHSNNKMKNL----SYPFSREKMYLYNI-QEKDTFFDNATRSRIVHEILKRTAC---------------------------SRANNTM-------------GINSLIANNIYEAAYPLHDGEYDSPEDDMNDRKLLYQEWARYGVFYKFQPIDLIRKYFGEKIGLYFAWLGLYTSFLIPSSVIGVIVFLYGCATIEEDIPSREMCDQQNAFTMCPL--CDKSCDYWNLSSACGTAQASHLFDNPATVFFSIFMALWATMFLENWKRLQMRLGYFWDLTGIEEEEVSSQEHSRPEYETKVREKMLKESNQSAVQKLETNTTECGDEDDEDKLTWKDRFPGYLMNFASILFMIALTFSIVFGVIVYRITTAAALSLNKATRSNVRVTVTATAVIINLVVILILDEIYGAVAKWLTKIEVPKTEQTFEERLILKAFLLKFVNAYSPIFYVAFFKGRFVGRPGSYVYVFDGYRM---EECAPGGCLMELCIQLSIIMLGKQLIQNNIFEIGVPKLKKLFR------------------------KLKDETEAGE--TDSAHSKHPEQWDLDYSLEPYTGLTP-----EYMEMIIQFGFVTLFVASFPLAPVFALLNNVIEVRLDAKKFVTELRRPDAVRTKDIGIWFDILSGIGKFSVISNAFVIAITSDFIPRLVYQYSYSHNGTLHGFVNHTLSFFNVSQLKEGTQPENSQFDQEVQFCRFKDYREPPWAPN--PYEFSKQYWFILSARLAFVIIFQNLVMFLSVLVDWMIPDIPTDISDQIKKEKSLLVDFFLK---EEHEKL 958          
BLAST of Anoctamin vs. Ensembl Celegans
Match: anoh-1 (Anoctamin [Source:UniProtKB/TrEMBL;Acc:C0P286])

HSP 1 Score: 140.969 bits (354), Expect = 6.727e-34
Identity = 167/673 (24.81%), Postives = 297/673 (44.13%), Query Frame = 2
Query:  584 PFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYKK--ENMRVLLYKHWATLTNI-------------FRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIY----NLATIPRDI----IIQEISERNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKE---EPFISFWKNTLPIQML-TISTILFSIVLTLACLTGITVTKT-IIRNLLRLQLTYVMSKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGSDSFSMIK--PQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMI----YIIVHSR 2500
            PF ++   LF    +   FFT  +R  +   IL +     +      L  E++         + +    D  T+ +  +      G++ L+   V+E AF+LH       Y K  +N  V  Y  + +   +             ++ QPL+ IR YFGE +A+YFAW G +   L+P  +FG+ V IY    ++++ P D     ++  I +  N+      C  G      L    V  + +   D       A  +S+W  +F+++W+R    L+++WN  D     EP RPE+     K      + I+G++    P ++ +     I+ML +   + FS+++ +  L  +T+ K  ++ N    +       LS A + S+++ ++ + L ++YS +   L   E+HRT+S+++NS+  K++  + +N Y+S+FY+ F  P +     +  F +       CL   C   L++QL+   + K       +  +P     +K +R++   S+   R               VE  D   D   V ++  LK    D +L          E  E II FG   +F   FPLAPLLA+I   +++R DA + +   R+P+      IGIW+ ILT +    V +NA ++AF + +    +    Y  V +R
Sbjct:  134 PFQRKHGSLFLNYHDEKSFFTSSQRGYLTYQILTKIDISKD------LKGERL--------GESQDEPTDPSTSSITSDEQLRRKGLSWLLMSDVYEEAFVLHAPSKEEPYFKAMQNGSVKAYNEFISEIELDPRRSLSLNWERWYKFQPLNKIRDYFGEQIAYYFAWQGTFLTLLWPAVIFGLVVFIYGFIDSISSAPLDWNHCKVVNFIGQTENVA-----C--GMRNGVTLFFSMVTQWFMSSFDTKMNAFFAVFMSIWGSVFVQIWKRNNSVLSYQWNSDDFHA-IEPDRPEFRGSKVKE-----DPITGEDIWISPALARY-----IKMLASFVFVSFSMLVVVISLMLVTLLKIWMVYNFQCTKEYTFHCWLSAAFLPSILNTLSAMGLGAIYSNLVSRLNSWENHRTESEHNNSLIVKIFAFQMVNTYTSLFYVAFIRPESHGLQPNGLFGLGTEFKDTCLDDTCSSLLALQLLTHTLIKPFPKFFKDVVLPYF---VKLFRLRMYTSRTEAR---------------VEIED--DDQANVLVREWLKPSAGDFVLW---------EMNEKIILFGTTMMFASLFPLAPLLALIIGFVDMRIDAHRLIWFNRKPIPIITNGIGIWLPILTFLQYCAVFTNAFIVAFTSGFCSTFLADGAYCTVQNR 745          
BLAST of Anoctamin vs. Ensembl Celegans
Match: anoh-1 (Anoctamin [Source:UniProtKB/TrEMBL;Acc:C0P286])

HSP 1 Score: 140.584 bits (353), Expect = 7.976e-34
Identity = 167/673 (24.81%), Postives = 297/673 (44.13%), Query Frame = 2
Query:  584 PFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYKK--ENMRVLLYKHWATLTNI-------------FRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIY----NLATIPRDI----IIQEISERNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKE---EPFISFWKNTLPIQML-TISTILFSIVLTLACLTGITVTKT-IIRNLLRLQLTYVMSKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGSDSFSMIK--PQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMI----YIIVHSR 2500
            PF ++   LF    +   FFT  +R  +   IL +     +      L  E++         + +    D  T+ +  +      G++ L+   V+E AF+LH       Y K  +N  V  Y  + +   +             ++ QPL+ IR YFGE +A+YFAW G +   L+P  +FG+ V IY    ++++ P D     ++  I +  N+      C  G      L    V  + +   D       A  +S+W  +F+++W+R    L+++WN  D     EP RPE+     K      + I+G++    P ++ +     I+ML +   + FS+++ +  L  +T+ K  ++ N    +       LS A + S+++ ++ + L ++YS +   L   E+HRT+S+++NS+  K++  + +N Y+S+FY+ F  P +     +  F +       CL   C   L++QL+   + K       +  +P     +K +R++   S+   R               VE  D   D   V ++  LK    D +L          E  E II FG   +F   FPLAPLLA+I   +++R DA + +   R+P+      IGIW+ ILT +    V +NA ++AF + +    +    Y  V +R
Sbjct:  116 PFQRKHGSLFLNYHDEKSFFTSSQRGYLTYQILTKIDISKD------LKGERL--------GESQDEPTDPSTSSITSDEQLRRKGLSWLLMSDVYEEAFVLHAPSKEEPYFKAMQNGSVKAYNEFISEIELDPRRSLSLNWERWYKFQPLNKIRDYFGEQIAYYFAWQGTFLTLLWPAVIFGLVVFIYGFIDSISSAPLDWNHCKVVNFIGQTENVA-----C--GMRNGVTLFFSMVTQWFMSSFDTKMNAFFAVFMSIWGSVFVQIWKRNNSVLSYQWNSDDFHA-IEPDRPEFRGSKVKE-----DPITGEDIWISPALARY-----IKMLASFVFVSFSMLVVVISLMLVTLLKIWMVYNFQCTKEYTFHCWLSAAFLPSILNTLSAMGLGAIYSNLVSRLNSWENHRTESEHNNSLIVKIFAFQMVNTYTSLFYVAFIRPESHGLQPNGLFGLGTEFKDTCLDDTCSSLLALQLLTHTLIKPFPKFFKDVVLPYF---VKLFRLRMYTSRTEAR---------------VEIED--DDQANVLVREWLKPSAGDFVLW---------EMNEKIILFGTTMMFASLFPLAPLLALIIGFVDMRIDAHRLIWFNRKPIPIITNGIGIWLPILTFLQYCAVFTNAFIVAFTSGFCSTFLADGAYCTVQNR 727          
BLAST of Anoctamin vs. Ensembl Celegans
Match: anoh-2 (Anoctamin [Source:UniProtKB/TrEMBL;Acc:H2L2L3])

HSP 1 Score: 128.642 bits (322), Expect = 5.525e-30
Identity = 152/600 (25.33%), Postives = 250/600 (41.67%), Query Frame = 2
Query:  842 IAKLISEKVFETAFILHEKFSNGKYKKENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISERNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRNLLRLQLTYVMSKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGSDSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIK----EYRIKRADSKFIKRRSVHR------------------------------PTITDYEISEVE-----------------CSDIYTDCNGVKLQ----SELKICYQDNI-LSDPE--------PRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIA 2449
            + +LIS  V +    LH    N ++ K      L + W    +    QP+D ++ YFG  +A YFAWLG  T  L+  +L G+   ++ L                                +K S G  Q  L +LI +   V+ A    +W  ++LE W+R Q  LAF+W  +D   +D  L+    A  + +Y++  N +SG+ EPF   WK+T+   ++T       +V   A +  I   + +         ++++S L    +  +   + I+I   +Y R+A+ L DLE++RT  +Y++ +  K+ + +F+  + S+FYI F     K                        L   L  +L+ +Q+  NI+   +P +   +K     Y++ R+ S    RR V                                PT  + E+ + +                  S I+ +   +K +     E K C   N  L+  E         RPL  ++LEM IQFG++ +F   FPLA + A+INNL+EIR DA K     +RP  +RVKDIG W   +  +  + V  N  LI 
Sbjct:  234 VPRLISMNVVQNVSALH----NTEFLKH-----LQQKWVFSID---EQPIDQVKDYFGTEIAMYFAWLGHMTTALWFPSLLGIL--MWFLGGF----------------------------KYKNSPGDKQ-DLYQLISDICFVLFAFFNCIWSTIYLEWWKRVQAELAFKWGTYD-ATQDSYLQDPRPA-FQGDYLAP-NPVSGRLEPFYPAWKHTVMRYVITYPITFLCVVGMFAAMLAIFTVQDLAD--FYFGDSWMLSWLCYFPM--IFYALMIVISDKIYRRLALILNDLENYRTDDEYEDFLITKIVLFQFVTAFGSLFYIAFVLRDMK-----------------------RLQETLATLLITRQVTQNIMETVVPFMIEKLKLSSLTYKMTRSMSDGTLRRHVENVRNKRQNSVEQEEEEKSPRTPTTSFFTLGSPTTPETEVRQRKPNSDGTLATGDFKQLRTLSSIFREDFSLKTERLPLPEFKPCTDSNPELTQAELESVMSVYARPL-DDFLEMFIQFGYVLLFSPAFPLAAVCALINNLIEIRVDAFKLCNTVQRPFGRRVKDIGAWQKAMEILGILGVIVNCALIG 759          
BLAST of Anoctamin vs. Ensembl Celegans
Match: anoh-2 (Anoctamin [Source:UniProtKB/TrEMBL;Acc:H2L2L3])

HSP 1 Score: 128.257 bits (321), Expect = 7.083e-30
Identity = 152/600 (25.33%), Postives = 250/600 (41.67%), Query Frame = 2
Query:  842 IAKLISEKVFETAFILHEKFSNGKYKKENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISERNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRNLLRLQLTYVMSKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGSDSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIK----EYRIKRADSKFIKRRSVHR------------------------------PTITDYEISEVE-----------------CSDIYTDCNGVKLQ----SELKICYQDNI-LSDPE--------PRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIA 2449
            + +LIS  V +    LH    N ++ K      L + W    +    QP+D ++ YFG  +A YFAWLG  T  L+  +L G+   ++ L                                +K S G  Q  L +LI +   V+ A    +W  ++LE W+R Q  LAF+W  +D   +D  L+    A  + +Y++  N +SG+ EPF   WK+T+   ++T       +V   A +  I   + +         ++++S L    +  +   + I+I   +Y R+A+ L DLE++RT  +Y++ +  K+ + +F+  + S+FYI F     K                        L   L  +L+ +Q+  NI+   +P +   +K     Y++ R+ S    RR V                                PT  + E+ + +                  S I+ +   +K +     E K C   N  L+  E         RPL  ++LEM IQFG++ +F   FPLA + A+INNL+EIR DA K     +RP  +RVKDIG W   +  +  + V  N  LI 
Sbjct:  178 VPRLISMNVVQNVSALH----NTEFLKH-----LQQKWVFSID---EQPIDQVKDYFGTEIAMYFAWLGHMTTALWFPSLLGIL--MWFLGGF----------------------------KYKNSPGDKQ-DLYQLISDICFVLFAFFNCIWSTIYLEWWKRVQAELAFKWGTYD-ATQDSYLQDPRPA-FQGDYLAP-NPVSGRLEPFYPAWKHTVMRYVITYPITFLCVVGMFAAMLAIFTVQDLAD--FYFGDSWMLSWLCYFPM--IFYALMIVISDKIYRRLALILNDLENYRTDDEYEDFLITKIVLFQFVTAFGSLFYIAFVLRDMK-----------------------RLQETLATLLITRQVTQNIMETVVPFMIEKLKLSSLTYKMTRSMSDGTLRRHVENVRNKRQNSVEQEEEEKSPRTPTTSFFTLGSPTTPETEVRQRKPNSDGTLATGDFKQLRTLSSIFREDFSLKTERLPLPEFKPCTDSNPELTQAELESVMSVYARPL-DDFLEMFIQFGYVLLFSPAFPLAAVCALINNLIEIRVDAFKLCNTVQRPFGRRVKDIGAWQKAMEILGILGVIVNCALIG 703          
BLAST of Anoctamin vs. Ensembl Fly
Match: subdued (gene:FBgn0038721 transcript:FBtr0083806)

HSP 1 Score: 414.846 bits (1065), Expect = 3.994e-129
Identity = 310/967 (32.06%), Postives = 494/967 (51.09%), Query Frame = 2
Query:  104 RSFYQQQTLNNEKEKNNKGMFFTDRVRRIDFVLVYQ---QLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIRKSIMN----AGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYKKEN-MRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEI--SERNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRNLLRLQLTYVMSK----LSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGS-DSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLGGFVDFSLS----FMNTTEFNISSSISNETHCSYIGFRYPPWDVHNEPMSYT--PVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELEEHRNIYEANNLAKSLKKTIINY---RQKLNKPNSK 2932
            R FYQ+  +N         +FF D VR IDFVL Y+         E   KR  F  +LI +GLE+E                      + +   + FVKIHA  + L RYAEI+K+R  +      + V+ +        K V   F R   +D +     A  +T  +S+ K YLFDI   +  FFT   RS IV +IL R+ + +                                     +N  ++ FGI +LI+E V+  A+ LH+    G+  +   MR LLYKHWA++   +R+QPLD I+ YFG  +  YFAWLG+YT+ L   ++ GV   +Y+  ++   + +++I  S   NITMCP+ C    C  W L        +  LIDN +TV  A  +S W  LFLE+W+R    +  RW++   +V +E  RP+Y A LE    ++ + ++  +EP + FW+  LP  + + S +L  I L    L  + V +  +   L++  + + +     L+TA+  + ++L  + IL  +Y+ +A +LT+LE  RTQ+Q+D+S+T K+Y+L+F+N Y+S+FYI F        PG  +     + + C +G CL +L +QL  I+VGKQ  + I+   +P     +   ++       + R   + P                   N  K + E  +  +D  L D   R LF EYLEM++Q+GF+TIF+  FPLAP  A++NN++E+R DAKK +T ++RPV+QRV+DIG+W  IL  I K+ V +N  +IAF +  I R++Y    ++   L G+++F+LS      + T ++++  +SN T C Y  FR PP    + P  YT   +F+ +LA ++ FV +FE FV+L + +    IP++  E R  ++RE  +TNE I  I+ E HR  +E    + S+ +T ++       + +PN+K
Sbjct:   24 REFYQRGEINT-------SLFFEDCVRSIDFVLAYRINAHEPTELENTEKRRVFEANLISQGLEVE----------------------SSQKDQIWFVKIHAPLEVLRRYAEILKLRMPMKEIPGMSVVNRSTKSVFSSLKHVFQFFLRNIYVDEEIFPKRAHRFTAIYSRDKEYLFDI--RQDCFFTTAVRSRIVEFILDRQRFPA-------------------------------------KNQHDMAFGIERLIAEGVYSAAYPLHD----GEITETGTMRALLYKHWASVPKWYRYQPLDDIKEYFGVKIGLYFAWLGYYTYMLLLASIVGVICFLYSWFSLKNYVPVKDICQSGNTNITMCPL-C--DWCNFWDLKETCNYAKVTYLIDNPSTVFFAVFMSFWATLFLELWKRYSAEITHRWDLTGFDVHEEHPRPQYLARLEHIPPTRVDYVTNIKEPTVPFWRMKLPATVFSFSVVLLLIALAFVALLAVVVYRMSMLAALKVGASPMTTSSAIVLATAS-AAFVNLCLLYILNYMYNHLAEYLTELEMWRTQTQFDDSLTLKIYLLQFVNYYASIFYIAFFKGKFVGHPGEYNKLFDYRQEECSSGGCLTELCIQLAIIMVGKQAFNTILEVYLPMFWRKVLAIQVG------LSRLFNNTP-------------------NPDKAKDERWM--RDFKLLDWGARGLFPEYLEMVLQYGFVTIFVAAFPLAPFFALLNNILEMRLDAKKLLTHHKRPVSQRVRDIGVWYRILDCIGKLSVITNGFIIAFTSDMIPRLVYRHYVNKQGTLDGYLNFTLSEFKVIDSPTLYSLAGDLSNITTCRYTDFRLPP----SSPEKYTLSSMFYIILACRLGFVVVFENFVALVMILVRWCIPDMSVELRDQIRREVYVTNEII--IDQEAHRARFERAKRSSSVLQTPVDQDMDAASIQEPNAK 881          
BLAST of Anoctamin vs. Ensembl Fly
Match: subdued (gene:FBgn0038721 transcript:FBtr0334921)

HSP 1 Score: 414.846 bits (1065), Expect = 3.994e-129
Identity = 310/967 (32.06%), Postives = 494/967 (51.09%), Query Frame = 2
Query:  104 RSFYQQQTLNNEKEKNNKGMFFTDRVRRIDFVLVYQ---QLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIRKSIMN----AGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYKKEN-MRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEI--SERNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRNLLRLQLTYVMSK----LSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGS-DSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLGGFVDFSLS----FMNTTEFNISSSISNETHCSYIGFRYPPWDVHNEPMSYT--PVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELEEHRNIYEANNLAKSLKKTIINY---RQKLNKPNSK 2932
            R FYQ+  +N         +FF D VR IDFVL Y+         E   KR  F  +LI +GLE+E                      + +   + FVKIHA  + L RYAEI+K+R  +      + V+ +        K V   F R   +D +     A  +T  +S+ K YLFDI   +  FFT   RS IV +IL R+ + +                                     +N  ++ FGI +LI+E V+  A+ LH+    G+  +   MR LLYKHWA++   +R+QPLD I+ YFG  +  YFAWLG+YT+ L   ++ GV   +Y+  ++   + +++I  S   NITMCP+ C    C  W L        +  LIDN +TV  A  +S W  LFLE+W+R    +  RW++   +V +E  RP+Y A LE    ++ + ++  +EP + FW+  LP  + + S +L  I L    L  + V +  +   L++  + + +     L+TA+  + ++L  + IL  +Y+ +A +LT+LE  RTQ+Q+D+S+T K+Y+L+F+N Y+S+FYI F        PG  +     + + C +G CL +L +QL  I+VGKQ  + I+   +P     +   ++       + R   + P                   N  K + E  +  +D  L D   R LF EYLEM++Q+GF+TIF+  FPLAP  A++NN++E+R DAKK +T ++RPV+QRV+DIG+W  IL  I K+ V +N  +IAF +  I R++Y    ++   L G+++F+LS      + T ++++  +SN T C Y  FR PP    + P  YT   +F+ +LA ++ FV +FE FV+L + +    IP++  E R  ++RE  +TNE I  I+ E HR  +E    + S+ +T ++       + +PN+K
Sbjct:   24 REFYQRGEINT-------SLFFEDCVRSIDFVLAYRINAHEPTELENTEKRRVFEANLISQGLEVE----------------------SSQKDQIWFVKIHAPLEVLRRYAEILKLRMPMKEIPGMSVVNRSTKSVFSSLKHVFQFFLRNIYVDEEIFPKRAHRFTAIYSRDKEYLFDI--RQDCFFTTAVRSRIVEFILDRQRFPA-------------------------------------KNQHDMAFGIERLIAEGVYSAAYPLHD----GEITETGTMRALLYKHWASVPKWYRYQPLDDIKEYFGVKIGLYFAWLGYYTYMLLLASIVGVICFLYSWFSLKNYVPVKDICQSGNTNITMCPL-C--DWCNFWDLKETCNYAKVTYLIDNPSTVFFAVFMSFWATLFLELWKRYSAEITHRWDLTGFDVHEEHPRPQYLARLEHIPPTRVDYVTNIKEPTVPFWRMKLPATVFSFSVVLLLIALAFVALLAVVVYRMSMLAALKVGASPMTTSSAIVLATAS-AAFVNLCLLYILNYMYNHLAEYLTELEMWRTQTQFDDSLTLKIYLLQFVNYYASIFYIAFFKGKFVGHPGEYNKLFDYRQEECSSGGCLTELCIQLAIIMVGKQAFNTILEVYLPMFWRKVLAIQVG------LSRLFNNTP-------------------NPDKAKDERWM--RDFKLLDWGARGLFPEYLEMVLQYGFVTIFVAAFPLAPFFALLNNILEMRLDAKKLLTHHKRPVSQRVRDIGVWYRILDCIGKLSVITNGFIIAFTSDMIPRLVYRHYVNKQGTLDGYLNFTLSEFKVIDSPTLYSLAGDLSNITTCRYTDFRLPP----SSPEKYTLSSMFYIILACRLGFVVVFENFVALVMILVRWCIPDMSVELRDQIRREVYVTNEII--IDQEAHRARFERAKRSSSVLQTPVDQDMDAASIQEPNAK 881          
BLAST of Anoctamin vs. Ensembl Fly
Match: subdued (gene:FBgn0038721 transcript:FBtr0083805)

HSP 1 Score: 414.461 bits (1064), Expect = 1.480e-127
Identity = 310/967 (32.06%), Postives = 494/967 (51.09%), Query Frame = 2
Query:  104 RSFYQQQTLNNEKEKNNKGMFFTDRVRRIDFVLVYQ---QLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIRKSIMN----AGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYKKEN-MRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEI--SERNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRNLLRLQLTYVMSK----LSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGS-DSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLGGFVDFSLS----FMNTTEFNISSSISNETHCSYIGFRYPPWDVHNEPMSYT--PVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELEEHRNIYEANNLAKSLKKTIINY---RQKLNKPNSK 2932
            R FYQ+  +N         +FF D VR IDFVL Y+         E   KR  F  +LI +GLE+E                      + +   + FVKIHA  + L RYAEI+K+R  +      + V+ +        K V   F R   +D +     A  +T  +S+ K YLFDI   +  FFT   RS IV +IL R+ + +                                     +N  ++ FGI +LI+E V+  A+ LH    +G+  +   MR LLYKHWA++   +R+QPLD I+ YFG  +  YFAWLG+YT+ L   ++ GV   +Y+  ++   + +++I  S   NITMCP+ C    C  W L        +  LIDN +TV  A  +S W  LFLE+W+R    +  RW++   +V +E  RP+Y A LE    ++ + ++  +EP + FW+  LP  + + S +L  I L    L  + V +  +   L++  + + +     L+TA+  + ++L  + IL  +Y+ +A +LT+LE  RTQ+Q+D+S+T K+Y+L+F+N Y+S+FYI F        PG  +     + + C +G CL +L +QL  I+VGKQ  + I+   +P     +   ++       + R   + P                   N  K + E  +  +D  L D   R LF EYLEM++Q+GF+TIF+  FPLAP  A++NN++E+R DAKK +T ++RPV+QRV+DIG+W  IL  I K+ V +N  +IAF +  I R++Y    ++   L G+++F+LS      + T ++++  +SN T C Y  FR PP    + P  YT   +F+ +LA ++ FV +FE FV+L + +    IP++  E R  ++RE  +TNE I  I+ E HR  +E    + S+ +T ++       + +PN+K
Sbjct:  173 REFYQRGEINT-------SLFFEDCVRSIDFVLAYRINAHEPTELENTEKRRVFEANLISQGLEVE----------------------SSQKDQIWFVKIHAPLEVLRRYAEILKLRMPMKEIPGMSVVNRSTKSVFSSLKHVFQFFLRNIYVDEEIFPKRAHRFTAIYSRDKEYLFDI--RQDCFFTTAVRSRIVEFILDRQRFPA-------------------------------------KNQHDMAFGIERLIAEGVYSAAYPLH----DGEITETGTMRALLYKHWASVPKWYRYQPLDDIKEYFGVKIGLYFAWLGYYTYMLLLASIVGVICFLYSWFSLKNYVPVKDICQSGNTNITMCPL-C--DWCNFWDLKETCNYAKVTYLIDNPSTVFFAVFMSFWATLFLELWKRYSAEITHRWDLTGFDVHEEHPRPQYLARLEHIPPTRVDYVTNIKEPTVPFWRMKLPATVFSFSVVLLLIALAFVALLAVVVYRMSMLAALKVGASPMTTSSAIVLATAS-AAFVNLCLLYILNYMYNHLAEYLTELEMWRTQTQFDDSLTLKIYLLQFVNYYASIFYIAFFKGKFVGHPGEYNKLFDYRQEECSSGGCLTELCIQLAIIMVGKQAFNTILEVYLPMFWRKVLAIQVG------LSRLFNNTP-------------------NPDKAKDERWM--RDFKLLDWGARGLFPEYLEMVLQYGFVTIFVAAFPLAPFFALLNNILEMRLDAKKLLTHHKRPVSQRVRDIGVWYRILDCIGKLSVITNGFIIAFTSDMIPRLVYRHYVNKQGTLDGYLNFTLSEFKVIDSPTLYSLAGDLSNITTCRYTDFRLPP----SSPEKYTLSSMFYIILACRLGFVVVFENFVALVMILVRWCIPDMSVELRDQIRREVYVTNEII--IDQEAHRARFERAKRSSSVLQTPVDQDMDAASIQEPNAK 1030          
BLAST of Anoctamin vs. Ensembl Fly
Match: subdued (gene:FBgn0038721 transcript:FBtr0334922)

HSP 1 Score: 407.142 bits (1045), Expect = 6.693e-126
Identity = 309/992 (31.15%), Postives = 495/992 (49.90%), Query Frame = 2
Query:  104 RSFYQQQTLNNEKEKNNKGMFFTDRVRRIDFVLVYQ---QLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIR----KSIMNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPI-------------------------AQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYKKEN-MRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEI--SERNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRNLLRLQLTYVMSK----LSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGS-DSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLGGFVDFSLS----FMNTTEFNISSSISNETHCSYIGFRYPPWDVHNEPMSYT--PVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELEEHRNIYEANNLAKSLKKTIINY---RQKLNKPNSK 2932
            R FYQ+  +N         +FF D VR IDFVL Y+         E   KR  F  +LI +GLE+E                      + +   + FVKIHA  + L RYAEI+K+R    +S+ N  +      +         +     S+ N+  K +                         A  +T  +S+ K YLFDI   +  FFT   RS IV +IL R+ + +                                     +N  ++ FGI +LI+E V+  A+ LH+    G+  +   MR LLYKHWA++   +R+QPLD I+ YFG  +  YFAWLG+YT+ L   ++ GV   +Y+  ++   + +++I  S   NITMCP+ C    C  W L        +  LIDN +TV  A  +S W  LFLE+W+R    +  RW++   +V +E  RP+Y A LE    ++ + ++  +EP + FW+  LP  + + S +L  I L    L  + V +  +   L++  + + +     L+TA+  + ++L  + IL  +Y+ +A +LT+LE  RTQ+Q+D+S+T K+Y+L+F+N Y+S+FYI F        PG  +     + + C +G CL +L +QL  I+VGKQ  + I+   +P     +   ++       + R   + P                   N  K + E  +  +D  L D   R LF EYLEM++Q+GF+TIF+  FPLAP  A++NN++E+R DAKK +T ++RPV+QRV+DIG+W  IL  I K+ V +N  +IAF +  I R++Y    ++   L G+++F+LS      + T ++++  +SN T C Y  FR PP    + P  YT   +F+ +LA ++ FV +FE FV+L + +    IP++  E R  ++RE  +TNE I  I+ E HR  +E    + S+ +T ++       + +PN+K
Sbjct:   24 REFYQRGEINT-------SLFFEDCVRSIDFVLAYRINAHEPTELENTEKRRVFEANLISQGLEVE----------------------SSQKDQIWFVKIHAPLEVLRRYAEILKLRMPMKESLCNLRIS-ERSNRLRNAAHYLTNKIPGMSVVNRSTKSVFSSLKHVFQFFLRNIYVDEEIFPKRAHRFTAIYSRDKEYLFDI--RQDCFFTTAVRSRIVEFILDRQRFPA-------------------------------------KNQHDMAFGIERLIAEGVYSAAYPLHD----GEITETGTMRALLYKHWASVPKWYRYQPLDDIKEYFGVKIGLYFAWLGYYTYMLLLASIVGVICFLYSWFSLKNYVPVKDICQSGNTNITMCPL-C--DWCNFWDLKETCNYAKVTYLIDNPSTVFFAVFMSFWATLFLELWKRYSAEITHRWDLTGFDVHEEHPRPQYLARLEHIPPTRVDYVTNIKEPTVPFWRMKLPATVFSFSVVLLLIALAFVALLAVVVYRMSMLAALKVGASPMTTSSAIVLATAS-AAFVNLCLLYILNYMYNHLAEYLTELEMWRTQTQFDDSLTLKIYLLQFVNYYASIFYIAFFKGKFVGHPGEYNKLFDYRQEECSSGGCLTELCIQLAIIMVGKQAFNTILEVYLPMFWRKVLAIQVG------LSRLFNNTP-------------------NPDKAKDERWM--RDFKLLDWGARGLFPEYLEMVLQYGFVTIFVAAFPLAPFFALLNNILEMRLDAKKLLTHHKRPVSQRVRDIGVWYRILDCIGKLSVITNGFIIAFTSDMIPRLVYRHYVNKQGTLDGYLNFTLSEFKVIDSPTLYSLAGDLSNITTCRYTDFRLPP----SSPEKYTLSSMFYIILACRLGFVVVFENFVALVMILVRWCIPDMSVELRDQIRREVYVTNEII--IDQEAHRARFERAKRSSSVLQTPVDQDMDAASIQEPNAK 905          
BLAST of Anoctamin vs. Ensembl Fly
Match: subdued (gene:FBgn0038721 transcript:FBtr0302492)

HSP 1 Score: 406.757 bits (1044), Expect = 1.724e-124
Identity = 309/992 (31.15%), Postives = 495/992 (49.90%), Query Frame = 2
Query:  104 RSFYQQQTLNNEKEKNNKGMFFTDRVRRIDFVLVYQ---QLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIR----KSIMNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPI-------------------------AQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYKKEN-MRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEI--SERNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRNLLRLQLTYVMSK----LSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGS-DSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLGGFVDFSLS----FMNTTEFNISSSISNETHCSYIGFRYPPWDVHNEPMSYT--PVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELEEHRNIYEANNLAKSLKKTIINY---RQKLNKPNSK 2932
            R FYQ+  +N         +FF D VR IDFVL Y+         E   KR  F  +LI +GLE+E                      + +   + FVKIHA  + L RYAEI+K+R    +S+ N  +      +         +     S+ N+  K +                         A  +T  +S+ K YLFDI   +  FFT   RS IV +IL R+ + +                                     +N  ++ FGI +LI+E V+  A+ LH+    G+  +   MR LLYKHWA++   +R+QPLD I+ YFG  +  YFAWLG+YT+ L   ++ GV   +Y+  ++   + +++I  S   NITMCP+ C    C  W L        +  LIDN +TV  A  +S W  LFLE+W+R    +  RW++   +V +E  RP+Y A LE    ++ + ++  +EP + FW+  LP  + + S +L  I L    L  + V +  +   L++  + + +     L+TA+  + ++L  + IL  +Y+ +A +LT+LE  RTQ+Q+D+S+T K+Y+L+F+N Y+S+FYI F        PG  +     + + C +G CL +L +QL  I+VGKQ  + I+   +P     +   ++       + R   + P                   N  K + E  +  +D  L D   R LF EYLEM++Q+GF+TIF+  FPLAP  A++NN++E+R DAKK +T ++RPV+QRV+DIG+W  IL  I K+ V +N  +IAF +  I R++Y    ++   L G+++F+LS      + T ++++  +SN T C Y  FR PP    + P  YT   +F+ +LA ++ FV +FE FV+L + +    IP++  E R  ++RE  +TNE I  I+ E HR  +E    + S+ +T ++       + +PN+K
Sbjct:  173 REFYQRGEINT-------SLFFEDCVRSIDFVLAYRINAHEPTELENTEKRRVFEANLISQGLEVE----------------------SSQKDQIWFVKIHAPLEVLRRYAEILKLRMPMKESLCNLRIS-ERSNRLRNAAHYLTNKIPGMSVVNRSTKSVFSSLKHVFQFFLRNIYVDEEIFPKRAHRFTAIYSRDKEYLFDI--RQDCFFTTAVRSRIVEFILDRQRFPA-------------------------------------KNQHDMAFGIERLIAEGVYSAAYPLHD----GEITETGTMRALLYKHWASVPKWYRYQPLDDIKEYFGVKIGLYFAWLGYYTYMLLLASIVGVICFLYSWFSLKNYVPVKDICQSGNTNITMCPL-C--DWCNFWDLKETCNYAKVTYLIDNPSTVFFAVFMSFWATLFLELWKRYSAEITHRWDLTGFDVHEEHPRPQYLARLEHIPPTRVDYVTNIKEPTVPFWRMKLPATVFSFSVVLLLIALAFVALLAVVVYRMSMLAALKVGASPMTTSSAIVLATAS-AAFVNLCLLYILNYMYNHLAEYLTELEMWRTQTQFDDSLTLKIYLLQFVNYYASIFYIAFFKGKFVGHPGEYNKLFDYRQEECSSGGCLTELCIQLAIIMVGKQAFNTILEVYLPMFWRKVLAIQVG------LSRLFNNTP-------------------NPDKAKDERWM--RDFKLLDWGARGLFPEYLEMVLQYGFVTIFVAAFPLAPFFALLNNILEMRLDAKKLLTHHKRPVSQRVRDIGVWYRILDCIGKLSVITNGFIIAFTSDMIPRLVYRHYVNKQGTLDGYLNFTLSEFKVIDSPTLYSLAGDLSNITTCRYTDFRLPP----SSPEKYTLSSMFYIILACRLGFVVVFENFVALVMILVRWCIPDMSVELRDQIRREVYVTNEII--IDQEAHRARFERAKRSSSVLQTPVDQDMDAASIQEPNAK 1054          
BLAST of Anoctamin vs. Ensembl Zebrafish
Match: ano3 (anoctamin 3 [Source:ZFIN;Acc:ZDB-GENE-111031-3])

HSP 1 Score: 406.371 bits (1043), Expect = 3.600e-125
Identity = 304/927 (32.79%), Postives = 453/927 (48.87%), Query Frame = 2
Query:  158 GMFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIR-------------KSIMNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQG--YTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYK-----KENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISERNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTI-IRNLLRLQLTYVMS--KLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPG--SDSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLG--------GFVDFSLSFMNTTEFNISSSISNETHCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELEE 2839
            G+ F D  +RID++LVY++   S  +  KR +F  +L  EGL +E            +    NSD        ++FVKIHA WDTLC+YAE M IR             K  M +     +       +   +       +D + L  + +   YT PF + + + F I  NR  FF+   RS IV+++L+R  Y                                       E+G +   GI +L+    +E AF  HE     ++       +N R LLY+ WA     +++QPLD IR YFGE +  YFAWLG+YT  L P AL G+ V +Y L T+    + +EI E N   MCP+   EG+C SW LS   V   +  L DNG TV  A  +++W  +FLE W+R++  L + W++ D E E+E LRP++ A   +    + N ISGK EPF     + L   M+++S I F I L L  +  + V + I +   +  Q  +V    + +T+  G  I+ + I+ L  VY +VA  LT+LEH RT+S+++NS   K+++ +F+N  SS FYI F       +PG  +  F+  + + C    CL+DL +Q+  I+V KQI +N +    P L +     ++KRA  +                                  + EL    +D  L       L  EYLEM++QFGF TIF+  FPLAPLLA++NN++EIR DA KFVT +RRP+  R  DIGIW  +L  I  + V +NA +IA  + YI R +Y I +    D G        G+++ SLS  +  E   + S  N+ +C Y  +R PPW    EP  +T  FW +LAA++AF+ +FE  V         +IP++P +    M+RE  +  E + + ELE 
Sbjct:  154 GLMFRDGKKRIDYILVYKK---SSPQVEKRCTFERNLRAEGLMLE-----------KEPSLTNSD--------IMFVKIHAPWDTLCKYAEQMNIRMPFRKKCYFTDWKKKAMGSRFQLRF------RQLKSWLPRNPMKLDKEALPDLVETDCYTAPFCRARMHHFTI-NNRETFFSNSTRSRIVHHVLQRTKY---------------------------------------EDGKS-KMGINRLLGNSTYEAAFPPHEGCYKSRHPIKTHGAQNHRHLLYERWARWGIWYKYQPLDLIRRYFGEKIGLYFAWLGWYTGMLIPAALVGLFVFLYGLFTMDSSQVSKEICEANTTVMCPM--CEGNCSSWTLSDSCVYAKVTHLFDNGGTVFFAIFMAIWATVFLEFWKRRRAELTYDWDLIDWEEEEEELRPQFEAKYSRK--ERVNPISGKPEPFQPL-TDKLSRLMVSVSGIFFMISLVLTAVFAVVVFRLIAMEKFVSFQWEFVKKNWQFATSGTGVCINFMIIMSLNVVYEKVAYLLTNLEHPRTESEWENSFALKMFLFQFVNLNSSTFYIAFFLGRFAGRPGDYNKLFNRWRMEECHPSGCLIDLCLQMGVIMVLKQIWNNFMELGYPLLQNWWSRRKMKRAGEQ-------------------------------SNSKEELPQWDRDWNLQPMNAHGLVDEYLEMVLQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPMPARATDIGIWHGVLEGIGVVAVITNAFVIAITSDYIPRFVYAIKYGPCVDKGYRHEKCLRGYLNNSLSVFDMGELR-NGSYENQ-YCRYRDYRAPPWS--PEPYEFTLQFWHVLAARLAFIIVFEHLVFGIKTFIAHMIPDMPKDLCDRMRREKYLMQEMVYEAELEH 971          
BLAST of Anoctamin vs. Ensembl Zebrafish
Match: ano5b (anoctamin 5b [Source:ZFIN;Acc:ZDB-GENE-061215-108])

HSP 1 Score: 377.867 bits (969), Expect = 3.002e-115
Identity = 283/939 (30.14%), Postives = 465/939 (49.52%), Query Frame = 2
Query:  143 EKNNKGMFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIRKSIMNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQGYTYPFSKQK--YYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYKK---ENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISE---RNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPL--RPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGI------------TVTKTIIRNLLRLQLTYVMSKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGSDSF-----SMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFD--LGGFVDFSLSFMNTT---EFNISSSISNE--------THCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELEE 2839
            ++N   +FF D VRRIDFVL Y    + ++K  +R  F  +L   GLE+E ++               SDD     +   ++KIHA W+ L  YA+++KI+       V +         +         F +    ++P    +T PF K K  ++L D   ++  FF P  R+ IV YIL R                       P + + R   + +              GI +L++   + +A+ LH+     K +    E+ R  LY++WA     ++ QPL+ I+ Y+GE +  YFAWLGFYT  LF  A+ GV   +Y + +   +I  +EI +      I MCP+   +  C  WKL++  +  +   L DN  TV  A  + +WV LFLE W+R+Q  L + W++ D E E + L  RPEY    +K    + N+I+ + EP++ F  +      L+ +T+LF   L +AC+ G+            +V K    + ++L  + +  +L+T+   S I+ + I+IL  +Y  VA+W+TD+E  +T  +Y+N +T K+++ +F+N YSS FY+ F        PG+ S+     S ++ + C  G CL++L+ QL+ ++ GKQ++ N+    +P     ++ +   R      K RS    T + +E                          QD+ L +     LF EYLEM+IQFGFIT+F+  FPLAPLLA+ NN++E+R DA KF T +RRP+A + ++IG W +IL  +A + V +NA ++AF +  I R++Y+  +    +  + G++  SLS  N +   E N+  +  N         T C Y  +RYPP   H    ++T  FW +LAAK+AF+ + E  V +       +IP++P E +  +KRE  +  E++   E+E+
Sbjct:   51 DQNRDSVFFKDGVRRIDFVLSYVDDKEGDKKAERRREFEANLEKAGLELETED------------KSESDD-----RKTHYLKIHAPWEVLATYADVLKIK-------VPFKVSDIPKAREVPLEWLSHPFRLPENIMRPEPDYFTAPFDKSKVDFFLID---DKDTFFPPSTRNRIVYYILTRC----------------------PYYKEDRKEKDKT--------------GINRLLNNGTYTSAYPLHDCRYWKKAQDMQCESERYHLYRYWARFLCFYKEQPLNLIKKYYGEKIGIYFAWLGFYTEMLFYAAVMGVICFVYGVLSYEDNITSKEICDPKIGGMIVMCPL--CDKKCSYWKLNSTCLSSWQSHLFDNEGTVFFAMFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQIRPEYE---QKCTGRRLNRITQEMEPYLPF-PSKCARFCLSGATVLFWTCLIVACIMGVIAYRLAVYAAFASVMKDSSTSKIQLVGSLITPQLATSVTASCINFVIILILNFLYEHVAIWITDMEIPKTHLEYENKLTMKMFMFQFVNYYSSCFYVAFFKGKFVGYPGNYSYMFGKWSTLRNEECAPGGCLIELTTQLLIVMAGKQMVGNVQEALLPL----VRNWWSSR------KGRSHPESTYSRWE--------------------------QDHDLQNFSQFGLFYEYLEMVIQFGFITLFVASFPLAPLLALFNNILEVRVDAWKFTTQFRRPMAAKARNIGAWEEILNVVAIMSVVTNAFIMAFTSDMIPRLVYLYAYHPGIEANMTGYITNSLSIYNISQIPEDNLPEAGENPSWFNSSTITTCRYRDYRYPP--GHLRQYTHTMQFWHILAAKLAFIIIMEHVVFVVKFFVAWLIPDVPSEVKARIKRERFLVQEYLHNYEVEK 882          
BLAST of Anoctamin vs. Ensembl Zebrafish
Match: ano5a (anoctamin 5a [Source:ZFIN;Acc:ZDB-GENE-091013-2])

HSP 1 Score: 373.244 bits (957), Expect = 5.600e-114
Identity = 286/954 (29.98%), Postives = 464/954 (48.64%), Query Frame = 2
Query:  101 ERSFYQQQTLNNEKEKNNKGMFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIRKSIMNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYKKENM---RVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISER---NNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDE--PLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGI------------TVTKTIIRNLLRLQLTYVMSKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGSDSF-----SMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRN--FDLGGFVDFSLSFMNTTEFNISS-----------SISNETHCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELEEHRN 2848
            E S    Q+  ++++++   ++F D VRRIDFVL Y    D E+K+++R  F  +L   GLE+E +                 D    E     F+KIH  W+ L  YA+++KI+       +  N       ++      F  F + +  + P    +T  F K K   F I  ++   F    R+ IV Y+L R  Y +  K                   DK+                    GI +L++   + +AF LH+     + + +N    R  LYK+WA  ++ ++ QPL+ IR Y+GE +  YFAWLGFYT  L   A+ G+   IY +AT   +I  +EI        I MCP+   +  C  WKLS      +   L DN ATV  A  + +WV LFLE W+R+Q  L + W++ D E E +   LRPEY +   K    + N+++ + EP++    +     +L+ +T+LF I L +A + G+            ++ K    N L +    +  + +T+   S I+ + I++L  +Y RVA+ +TD+E  +T  +Y+N +T K+++ +F+N YSS FY+ F        PG+ ++     S ++ + C  G CL++L+ QL+ ++VGKQ+  NI    +P L             + ++ R + + P              +Y+               QD+ L +     LF EYLEM+IQFGFIT+F+  FPLAPLLA++NN++E+R DA KF T +RRPVA +   IG W +IL  IA   V +NA +++F +  I R++Y  VH+      + G++  SLS  N +EF   +           +  N T C Y  +RYPP   H +  ++   FW +LAAK+AF+ + E  V +       +IP++P + +  +KRE  +  E++   E+E+ +N
Sbjct:   13 EHSLQLFQSRVDKQQQSKDSVYFRDGVRRIDFVLSYIDDKDGEKKQDRRKVFEANLQKAGLEVETE-----------------DKSESEDGKTYFLKIHVPWEVLATYADVLKIKVPFKANDIPEN-------KEIPMGWLFTPFRLPDHVMNPEPDFFTSTFDKSKIDFFLIE-DKETLFPASTRNRIVYYLLSRIPYSTEDK-------------------DKK--------------------GIKRLLNNGTYTSAFPLHDCRYWTRSRDDNCESERYSLYKNWARFSSFYKEQPLNLIRKYYGEKIGIYFAWLGFYTEMLSYAAVVGLLCFIYGVATFDENIWSREICNETIGGQIVMCPL--CDKKCGYWKLSTTCSSSWQSYLFDNAATVFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQLRPEYES---KCTNRRLNRVTQEMEPYLPL-TSKCARSILSGATVLFWISLIIASIIGVIAYRLAVFAAFASIMKDSPTNKLEIVGNLITPQFATSVTASCINFVIIMVLNFLYERVAIKITDMEVPKTHVEYENKLTIKMFLFQFVNYYSSCFYVAFFKGKFVGYPGNYAYMFGPWSGLRNEECEPGGCLIELTTQLVIVMVGKQVWGNIQEALVPWL------------RNWWVSRSARNHP------------ESLYSRWE------------QDHDLQNLGQLGLFYEYLEMVIQFGFITLFVASFPLAPLLALMNNILEVRVDAWKFTTQFRRPVAAKAHSIGAWEEILNMIAVFSVVTNAFIVSFTSDMIPRLVYQYVHNTGNAASMSGYITHSLSIYNISEFPPENRPDDDENPDWFNAGNYTTCRYRDYRYPP--GHEKQYTHNMDFWHILAAKLAFIIIMEHVVFVVKFFVAWLIPDVPSDVKARVKRERYLIQEYLHDYEVEKLKN 858          
BLAST of Anoctamin vs. Ensembl Zebrafish
Match: ano5a (anoctamin 5a [Source:ZFIN;Acc:ZDB-GENE-091013-2])

HSP 1 Score: 372.859 bits (956), Expect = 1.976e-113
Identity = 283/943 (30.01%), Postives = 459/943 (48.67%), Query Frame = 2
Query:  134 NEKEKNNKGMFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIRKSIMNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYKKENM---RVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISER---NNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDE--PLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGI------------TVTKTIIRNLLRLQLTYVMSKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGSDSF-----SMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRN--FDLGGFVDFSLSFMNTTEFNISS-----------SISNETHCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELEEHRN 2848
            ++++++   ++F D VRRIDFVL Y    D E+K+++R  F  +L   GLE+E +                 D    E     F+KIH  W+ L  YA+++KI+       +  N       ++      F  F + +  + P    +T  F K K   F I  ++   F    R+ IV Y+L R  Y +  K                   DK+                    GI +L++   + +AF LH+     + + +N    R  LYK+WA  ++ ++ QPL+ IR Y+GE +  YFAWLGFYT  L   A+ G+   IY +AT   +I  +EI        I MCP+   +  C  WKLS      +   L DN ATV  A  + +WV LFLE W+R+Q  L + W++ D E E +   LRPEY +   K    + N+++ + EP++    +     +L+ +T+LF I L +A + G+            ++ K    N L +    +  + +T+   S I+ + I++L  +Y RVA+ +TD+E  +T  +Y+N +T K+++ +F+N YSS FY+ F        PG+ ++     S ++ + C  G CL++L+ QL+ ++VGKQ+  NI    +P L             + ++ R + + P                        +S      QD+ L +     LF EYLEM+IQFGFIT+F+  FPLAPLLA++NN++E+R DA KF T +RRPVA +   IG W +IL  IA   V +NA +++F +  I R++Y  VH+      + G++  SLS  N +EF   +           +  N T C Y  +RYPP   H +  ++   FW +LAAK+AF+ + E  V +       +IP++P + +  +KRE  +  E++   E+E+ +N
Sbjct:   47 DKQQQSKDSVYFRDGVRRIDFVLSYIDDKDGEKKQDRRKVFEANLQKAGLEVETE-----------------DKSESEDGKTYFLKIHVPWEVLATYADVLKIKVPFKANDIPEN-------KEIPMGWLFTPFRLPDHVMNPEPDFFTSTFDKSKIDFFLIE-DKETLFPASTRNRIVYYLLSRIPYSTEDK-------------------DKK--------------------GIKRLLNNGTYTSAFPLHDCRYWTRSRDDNCESERYSLYKNWARFSSFYKEQPLNLIRKYYGEKIGIYFAWLGFYTEMLSYAAVVGLLCFIYGVATFDENIWSREICNETIGGQIVMCPL--CDKKCGYWKLSTTCSSSWQSYLFDNAATVFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQLRPEYES---KCTNRRLNRVTQEMEPYLPL-TSKCARSILSGATVLFWISLIIASIIGVIAYRLAVFAAFASIMKDSPTNKLEIVGNLITPQFATSVTASCINFVIIMVLNFLYERVAIKITDMEVPKTHVEYENKLTIKMFLFQFVNYYSSCFYVAFFKGKFVGYPGNYAYMFGPWSGLRNEECEPGGCLIELTTQLVIVMVGKQVWGNIQEALVPWL------------RNWWVSRSARNHP------------------------ESLYSRWEQDHDLQNLGQLGLFYEYLEMVIQFGFITLFVASFPLAPLLALMNNILEVRVDAWKFTTQFRRPVAAKAHSIGAWEEILNMIAVFSVVTNAFIVSFTSDMIPRLVYQYVHNTGNAASMSGYITHSLSIYNISEFPPENRPDDDENPDWFNAGNYTTCRYRDYRYPP--GHEKQYTHNMDFWHILAAKLAFIIIMEHVVFVVKFFVAWLIPDVPSDVKARVKRERYLIQEYLHDYEVEKLKN 881          
BLAST of Anoctamin vs. Ensembl Zebrafish
Match: ano11 (anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245])

HSP 1 Score: 364.77 bits (935), Expect = 1.368e-110
Identity = 273/834 (32.73%), Postives = 420/834 (50.36%), Query Frame = 2
Query:  371 KNLVFVKIHASWDTLCRYAEIMKIRKSIMNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYK---------KENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISERNNI-TMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRNLLRLQLTYVMSKLSTAAIG-------XXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGS-DSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTI--TDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLGGFVDFSLSFMNTTEFNISSSISNETHCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNE 2812
            K + ++K+HA WD L  YAE + +R + + A    ++   +   + +        S+ N+   P+   YT  F K K   F    +R  +FT  +R  IV  IL R  Y                         KR+                   G+A+L+ +  F  AF LHE    G +K         + N R +LY +WA+     ++QPLDHIR YFGE +A YFAWLGFYT WL P AL G CV +  + T+  +   +EI E   +  MCP+ C   +C+ W +S       +  L D+  TV  +  +S+W   FLE W+RK  TLA  W+  D   ++EP RPE+AA+       + N ++G +EP+  F +     +MLT S +   IV+ L  +    VT  I R+++ + +    S +     G       +L++L  I+++  VY+ +A  LT  E HRTQ+QY+++ T K++I +F+N YSS FY+ F        PG   +   ++ + C  G CL++L+ QL  I+VGKQ+I+NI  F IP+    IK +R KRA +   K +    P     DYE+           C G                       LF EYLE+++QFGFITIF+  FPLAPL A++NN +E+R DA KFV  YRRPVA+R + IG+W  IL  ++ + V  NA LIAF + ++ R++Y   +  N DL G+V+F+L++ +   +N SS     T C Y  FR       +E   Y  V+W++LA ++ F+  FE  V   +++   ++P+IP+  ++ +KRE  +  +
Sbjct:  153 KTIHYLKLHAPWDVLVYYAEELCLR-APLQAQPHPDFNTSARVLQKLWVPNIMKDSVPNR---PV-DYYTCAFRKSKMEKFLGSDDRENYFTSTQRHRIVYEILARTAYGRR----------------------KRAE-----------------VGVARLLRDGAFTGAFPLHE----GPFKLPSCDTQPDQLNKRQVLYHYWASWLKWCKYQPLDHIREYFGEKIALYFAWLGFYTAWLLPAALVGTCVFVSGILTMGSNTPAKEICESGGLYLMCPL-C--ETCKPWNMSDICPMAKVGYLFDHPGTVFFSVFMSLWAVTFLEYWKRKNATLAHHWDCMDFHEDEEPPRPEFAAMAPA---MEENPVTGVKEPY--FPEKARISRMLTGSMV---IVIMLCVVMIFLVTVIIYRSIVSVMMFETGSSVLRTQAGNIANISSTLVNLALILLMGQVYTALAEQLTKWEMHRTQTQYEDAFTFKVFIFQFVNFYSSPFYVAFFKGRFVGYPGHYGTLFGMRNEDCGPGGCLIELAEQLCIIMVGKQLINNIQEFVIPK----IKAWRQKRALASVKKAQKTQEPERWEQDYEL---------IPCEG-----------------------LFDEYLEIVLQFGFITIFVAAFPLAPLFALLNNWVEVRLDAHKFVCEYRRPVAERAQHIGVWFIILEALSHVSVVVNAFLIAFTSDFLPRLLY--QYKFNNDLHGYVNFTLAY-SPPSYNHSS----HTVCRYKAFR-------DENGKYKLVYWELLAVRLGFIIAFEHVVFFVLRVIDWMVPDIPESLQLKIKRERYLAKQ 877          
BLAST of Anoctamin vs. Ensembl Xenopus
Match: ANO4 (major histocompatibility complex class I-related gene protein-like [Source:Xenbase;Acc:XB-GENE-5756215])

HSP 1 Score: 387.497 bits (994), Expect = 1.540e-119
Identity = 297/913 (32.53%), Postives = 463/913 (50.71%), Query Frame = 2
Query:  158 GMFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIRKSIMNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQG--YTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHE-----KFSNGKYKKENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISERNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRN---LLRLQLTYVMSKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGS--DSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLG--------GFVDFSLSFMNTTEFNISSSISNETHCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELE 2836
            G+FF D  RRID++LVY++     EKR     F  ++  EGL +E            +S   NSD        ++FVK+HA W+ L RYAE+M +R          +  ++    +F      +   +D +++  + +   YT PFS+Q+ + F I  N+  FF    R+ IV++IL+R  Y                                       E G N   G+ +L++   +E AF LHE     K S   +  EN R LL++ WA+    +++QPLD +R YFGE +  YFAWLG+YT  LFP A+ G+ V +Y + T+    + +EI +  NITMCP+   +  C   +LS   +   +  L DN ATV  A  ++VW  +FLE W+R++  +A+ W++ D E E+E +RP++ A   K    + N ISGK EP+ +F  +     +++ S I F I + +A + GI + + +  +     +  L    S+++T      I+   I++L  +Y RVA++LT+LE  RT+S+++NS T K+++ +F+N  SS FYI F       +PG+     +  + + C    CL+DL +Q+  I+V KQ  +N +    P     I+ +  +R      K R  H                      G+  ++ L    +D  L    P  LF+EYLEMI+QFGF TIF+  FPLAPLLA++NN++EIR DA KF+T +RRP+A R KDIGIW  IL  I  + V +NA +IA  + +I R++Y   +      G        G+V+ SLS    T+F    + SN +H        PP     EP +YT  FW +LAA++AF+ +FE  V     +   +IP++P + R  M+RE  +  E + + ELE
Sbjct:   13 GLFFNDGKRRIDYILVYRKTSLQSEKRE---IFERNIRAEGLHLE-----------KESSIVNSD--------IIFVKLHAPWEVLGRYAELMNVRMPFRRKIYYLHRRYKFMSSRFRGLLPKKPMRLDKEKIPDLEENDCYTAPFSQQRIHHFIIN-NKDTFFNNATRTRIVHHILQRVKY---------------------------------------EEGKN-KIGLNRLLTNCTYEAAFPLHEGSYRSKNSIKTHGAENHRHLLFECWASWGVWYKYQPLDLVRRYFGEKIGLYFAWLGWYTGMLFPAAIVGLFVFLYGMFTLDSCQVSREICQATNITMCPL--CDKYCPYMRLSDSCIYAKVTHLFDNSATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLIDWEEEEEEIRPQFEAKYSKK--ERVNPISGKPEPYQAF-ADKCSRLVVSASGIFFMICVVIAAVFGIVIYRVVTVSTFAAFKWALIRNNSQVATTGTAVCINFCIIMLLNVLYERVALFLTNLEQPRTESEWENSFTLKMFLFQFVNLNSSTFYIAFFLGRFTGRPGAYLRLINKWRLEECHPSGCLIDLCLQMGIIMVLKQTWNNFMELGYP----LIQNWWTRR------KLRQEH----------------------GIHGKTALPQWEKDYNLQPINPYGLFEEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFITQWRRPLASRAKDIGIWYGILEGIGILSVITNAFVIAVTSDFIPRLVYAYKYGPCAGQGRAGEKCMVGYVNASLSVFLVTDF---ENHSNSSH--------PP--SAPEPYAYTLQFWHVLAARLAFIIVFEHLVFFIKHLISYLIPDLPKDLRDRMRREKYLIQEMMYEAELE 812          
BLAST of Anoctamin vs. Ensembl Xenopus
Match: ANO4 (major histocompatibility complex class I-related gene protein-like [Source:Xenbase;Acc:XB-GENE-5756215])

HSP 1 Score: 379.407 bits (973), Expect = 1.610e-116
Identity = 298/916 (32.53%), Postives = 461/916 (50.33%), Query Frame = 2
Query:  125 TLNNEKEKN-NKGMFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIRKSIMNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQG--YTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHE-----KFSNGKYKKENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISERNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTI-IRNLLRLQLTYVMSKLSTAAIGXXXXX-XXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGS--DSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLGGFVDFSLSFMNTTEFNISSSISNETHCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELE 2836
            +  N  EKN   G+FF D  RRID++LVY++     EKR     F  ++  EGL +E            +S   NSD        ++FVK+HA W+ L RYAE+M +R       + Y +    F  +F      +   +D +++  + +   YT PFS+Q+ + F I  N+  FF    R+ IV++IL+R  Y                                       E G N   G+ +L++   +E AF LHE     K S   +  EN R LL++ WA+    +++QPLD +R YFGE +  YFAWLG+YT  LFP A+ G+ V +Y + T+    + +EI +  NITMCP+   +  C   +LS   +   +  L DN ATV  A  ++VW  +FLE W+R++  +A+ W++ D E E+E +RP++ A   K    + N ISGK EP+ +F  +     +++ S I F I + +A + GI + + + +      +   + +    A  G+ + +   II+L ++Y RVA++LT+LE  RT+S+++NS T K+++ +F+N  SS FYI F       +PG+     +  + + C    CL+DL +Q+  I+V KQ  +N +    P     I+ +  +R      K R  H                      G+  ++ L    +D  L    P  LF+EYLEMI+QFGF TIF+  FPLAPLLA++NN++EIR DA KF+T +RRP+A R KDIGIW  IL  I  + V +NA +IA  + +I R++Y   +      G             E  I S  S      Y  +R PP     EP +YT  FW +LAA++AF+ +FE  V     +   +IP++P + R  M+RE  +  E + + ELE
Sbjct:   12 SWTNAPEKNKTSGLFFNDGKRRIDYILVYRKTSLQSEKRE---IFERNIRAEGLHLE-----------KESSIVNSD--------IIFVKLHAPWEVLGRYAELMNVRMPFRRK-IYYLHRRYKFMSRFRGLLPKKPMRLDKEKIPDLEENDCYTAPFSQQRIHHFIIN-NKDTFFNNATRTRIVHHILQRVKY---------------------------------------EEGKN-KIGLNRLLTNCTYEAAFPLHEGSYRSKNSIKTHGAENHRHLLFECWASWGVWYKYQPLDLVRRYFGEKIGLYFAWLGWYTGMLFPAAIVGLFVFLYGMFTLDSCQVSREICQATNITMCPL--CDKYCPYMRLSDSCIYAKVTHLFDNSATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLIDWEEEEEEIRPQFEAKYSKK--ERVNPISGKPEPYQAF-ADKCSRLVVSASGIFFMICVVIAAVFGIVIYRVVTVSTFAAFKWALIRNNSQVATTGTAVCINFCIIMLLNLYERVALFLTNLEQPRTESEWENSFTLKMFLFQFVNLNSSTFYIAFFLGRFTGRPGAYLRLINKWRLEECHPSGCLIDLCLQMGIIMVLKQTWNNFMELGYP----LIQNWWTRR------KLRQEH----------------------GIHGKTALPQWEKDYNLQPINPYGLFEEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFITQWRRPLASRAKDIGIWYGILEGIGILSVITNAFVIAVTSDFIPRLVYAYKYGPCAGQG----------RAGEKLIISFSSR-----YRDYRDPP--SAPEPYAYTLQFWHVLAARLAFIIVFEHLVFFIKHLISYLIPDLPKDLRDRMRREKYLIQEMMYEAELE 809          
BLAST of Anoctamin vs. Ensembl Xenopus
Match: ANO3 (anoctamin 3 [Source:NCBI gene;Acc:100495805])

HSP 1 Score: 373.629 bits (958), Expect = 1.103e-113
Identity = 285/916 (31.11%), Postives = 448/916 (48.91%), Query Frame = 2
Query:  158 GMFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIRKSIMNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQG--YTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGY---KSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYKKENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISERNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTI-IRNLLRLQLTYVMS--KLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGF--AHPYTKVKPGSDSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRA----DSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLG--------GFVDFSLSFMNTTEFNISSSISNETHCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELEE 2839
            G+FF D ++RID++LVY++   S  +  KR +F ++L  EGL +E ++          ++  N         +++FVKIH  WDTLC+YAE M IR          ++  ++       +       +D + L  + +   YT PFS+ + + F I  N+  FF+   RS IV+++L+R  Y   KS    ++   N+  L+ L  +    +S       + ++ +G+                                +N R LLY+ WA     +++QPLD IR YFGE +  YFAWLG+YT  L P AL G+ V +Y L T+    + +EI E N   MCP+   E +C   +L+   +   +  L DNG TV  A  +++W  +FLE W+R++  L + W++ D E E+E LRP++ A   +  + + N I+GK EPF  F  + L   M+++S I F I L L  +  + V + + +         ++    + +T+  G  I+ + I+ L  V   +  +L  LEH RT S+++NS   K+++ +F+N  SS+FYI F     +   K G          GC    CL+DL +Q+  I+V KQ+ +N +    P L +     +IK +    ++KF         T+  +E                          +D  L       L +EYLEM+IQFGF TIF+  FPLAPLLA++NN++EIR DA KFVT +RRP+  R  DIGIW  IL  I  + V +NA +IA  + YI R +Y   +    D G        G+V+ SLS  +  E     S     +C Y  +R PPW   + P  +T  FW +LAA++AF+ +FE  V         +IP++P +    M+RE  +  E + + ELE 
Sbjct:   86 GLFFKDGMKRIDYILVYKK---SSAQLEKRSTFEKNLRAEGLMLEREH----------AITNN---------DIMFVKIHCPWDTLCKYAERMNIRMPFRKKCYYTDWRSKTMGRLLKSWLPRNPMKLDKEALPDLEETDCYTAPFSRARMHHFTIN-NKDTFFSNSTRSRIVHHVLQRTKYEDGKSKMGMVNEWVNDVELIYL--LQGSYKSR------HPIKTHGA--------------------------------QNHRHLLYERWARWGMWYKYQPLDLIRRYFGEKIGLYFAWLGWYTGMLIPAALVGLFVFLYGLFTMDSSQVSKEICEANETIMCPM--CEKNCSLQRLNESCIYAKVTHLFDNGGTVFFAIFMAIWATVFLEFWKRRRAVLTYDWDLIDWEDEEEELRPQFEAKYSQ--LERVNPITGKPEPFQPF-SDKLSRLMVSVSGIFFMISLVLTAVFAVVVYRLVAMEQFASFNWHFIKKYWQFATSGTGVCINFMIIMSLNVV---IYAFLFFLEHPRTDSEWENSFALKMFLFQFVNLNSSIFYIAFFLGRSWVNNKGG----------GCHPSGCLIDLCLQMGVIMVLKQMWNNFMELGYPLLQNWWSRRKIKNSGQMVENKF---------TLPQWE--------------------------KDWNLQPMNAHGLMEEYLEMVIQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPMPARATDIGIWYGILEGIGVLAVITNAFVIAITSDYIPRFVYAFKYGPCLDEGYRHEKCLQGYVNSSLSIFDLKELGQGYS----GYCRYRDYREPPWS--SNPYEFTLQFWHVLAARLAFIIVFEHLVFGIKSFIAYLIPDMPKDLCDRMRREKYLVQEMMYEAELEH 879          
BLAST of Anoctamin vs. Ensembl Xenopus
Match: znf367 (zinc finger protein 367 [Source:Xenbase;Acc:XB-GENE-986040])

HSP 1 Score: 367.081 bits (941), Expect = 1.104e-110
Identity = 279/900 (31.00%), Postives = 445/900 (49.44%), Query Frame = 2
Query:  227 EEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIRKSI-----MNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYKKE---NMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISE-RNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLE-----VEDEPLRPEY-AALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRNLLRLQL---TYVMSKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGS-----DSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQII-SNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEP-RPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLGGFVDFSLSFMNTTEFNISSSISNETH-------CSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIE 2830
            ++KR +R  +  +LI+ GLE+E                    D   +   + FVKIHA W+ LCR AE MK++        +N          SF +K  +    ++  +  + +KP+    +YPFS++K +LFD+  ++  FF    RS IV  ILKR                                             +  + GI  L++  V+  A+ LH    +G Y+ E   N R LL   WA+ +  +++QP+D +R YFGE +  YFAWLG YT  L P ++ G+ V +Y  AT+  DI   E+ + R NITMCP+   + +C  WK+S+         L DN ATV  +  +++W   F+E W+R+Q  L +RW++   E     V+D P R EY A +L+K+   ++     ++E     W++  P  +  +  I+F I +T A + G+ + +      L +     T    +++  A   +I+L+ I+IL  VY  +A WLT +E  +T   ++  +  K ++L+F+N Y+ +FY+ F       +PG       SF M   + C  G CL++L +QL  I++GKQ+I +N+    IP++   I+  + KR   K             D+E                    + K  Y+++   D EP   L  EY+EMIIQFGF+T+F+  FPLAPL A++NN++EIR DAKKF+T  RRPVA R KDIGIW +I+  + K+ V  NA +I+F + +I R++Y+ ++S +  + GFV+ +LS+ N T+F   +  S           C Y  +R  PW  H   ++    +W +LAA++AFV +F+  V         IIP+IP +    + RE  +  E  LK E
Sbjct:  117 DDKRFRREEYEGNLIETGLELE-------------------RDEETKQHGVGFVKIHAPWNVLCREAEFMKLKMPTKKFYQINQTPGLMQKLSSFIQKISEPIQPKVAGLRPQTVKPL----SYPFSREKQHLFDMS-DKDSFFDSKTRSSIVYEILKR----------------------------------------TTCTKAKYSMGITSLLANGVYSAAYPLH----DGDYESEAEANDRKLLCDEWASYSVFYKYQPIDLVRKYFGEKIGLYFAWLGVYTQMLIPASIVGIIVFLYGCATVDEDIPSMEMCDNRYNITMCPL--CDRTCNYWKMSSACGTARASHLFDNPATVFFSVFMALWAASFMEHWKRRQMRLNYRWDLTGFEEEEGMVKDHP-RAEYEAKVLQKSLKKEYRHKETEKEKLT--WRDRFPAYLTNVVGIIFMIGVTFAIVFGVIMYRISTAAALAMSSNPNTRANVRVTVTATAVIINLVVILILDEVYGAIARWLTQIEVPKTDQTFEERLIFKAFLLKFVNAYTPIFYVAFFKGRIVGRPGDYYYIFQSFRM---EECAPGGCLMELCIQLSIIMLGKQLIQNNLFEIGIPKMKKLIRYLKSKRQSYK-------------DHE-----------------EHLKKKQRYEEDY--DLEPFAGLTPEYMEMIIQFGFVTLFVASFPLAPLFALLNNIIEIRLDAKKFITELRRPVAVRAKDIGIWYNIIRGLGKLAVIINAFVISFTSDFIPRLVYLYMYSPDGTMHGFVNHTLSYFNVTDFKPGTEPSEPVDLGYKVELCRYKDYREAPWSPHKYDINKD--YWAVLAARLAFVIVFQNLVMFMSDFVDWIIPDIPKDISEQIHREKVLMVEVFLKEE 906          
BLAST of Anoctamin vs. Ensembl Xenopus
Match: znf367 (zinc finger protein 367 [Source:Xenbase;Acc:XB-GENE-986040])

HSP 1 Score: 360.918 bits (925), Expect = 1.188e-108
Identity = 275/895 (30.73%), Postives = 441/895 (49.27%), Query Frame = 2
Query:  227 EEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIRKSI-----MNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYKKENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISE-RNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNV---HDLEVEDEPLRPEY-AALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRNLLRLQL---TYVMSKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGS-----DSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQII-SNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEP-RPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLGGFVDFSLSFMNTTEFNISSSISNETH-------CSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIE 2830
            ++KR +R  +  +LI+ GLE+E                    D   +   + FVKIHA W+ LCR AE MK++        +N          SF +K  +    ++  +  + +KP+    +YPFS++K +LFD+  ++  FF    RS IV  ILKR                                             +  + GI  L++  V+  A+ LH+          +M  LL   WA+ +  +++QP+D +R YFGE +  YFAWLG YT  L P ++ G+ V +Y  AT+  DI   E+ + R NITMCP+   + +C  WK+S+         L DN ATV  +  +++W   F+E W+R+Q  L +RW++    + EV D P R EY A +L+K+   ++     ++E     W++  P  +  +  I+F I +T A + G+ + +      L +     T    +++  A   +I+L+ I+IL  VY  +A WLT +E  +T   ++  +  K ++L+F+N Y+ +FY+ F       +PG       SF M   + C  G CL++L +QL  I++GKQ+I +N+    IP++   I+  + KR   K             D+E                    + K  Y+++   D EP   L  EY+EMIIQFGF+T+F+  FPLAPL A++NN++EIR DAKKF+T  RRPVA R KDIGIW +I+  + K+ V  NA +I+F + +I R++Y+ ++S +  + GFV+ +LS+ N T+F   +  S           C Y  +R  PW  H   ++    +W +LAA++AFV +F+  V         IIP+IP +    + RE  +  E  LK E
Sbjct:  106 DDKRFRREEYEGNLIETGLELE-------------------RDEETKQHGVGFVKIHAPWNVLCREAEFMKLKMPTKKFYQINQTPGLMQKLSSFIQKISEPIQPKVAGLRPQTVKPL----SYPFSREKQHLFDMS-DKDSFFDSKTRSSIVYEILKR----------------------------------------TTCTKAKYSMGITSLLANGVYSAAYPLHDV---------SMTQLLCDEWASYSVFYKYQPIDLVRKYFGEKIGLYFAWLGVYTQMLIPASIVGIIVFLYGCATVDEDIPSMEMCDNRYNITMCPL--CDRTCNYWKMSSACGTARASHLFDNPATVFFSVFMALWAASFMEHWKRRQMRLNYRWDLTGFEEEEVSDHP-RAEYEAKVLQKSLKKEYRHKETEKEKLT--WRDRFPAYLTNVVGIIFMIGVTFAIVFGVIMYRISTAAALAMSSNPNTRANVRVTVTATAVIINLVVILILDEVYGAIARWLTQIEVPKTDQTFEERLIFKAFLLKFVNAYTPIFYVAFFKGRIVGRPGDYYYIFQSFRM---EECAPGGCLMELCIQLSIIMLGKQLIQNNLFEIGIPKMKKLIRYLKSKRQSYK-------------DHE-----------------EHLKKKQRYEEDY--DLEPFAGLTPEYMEMIIQFGFVTLFVASFPLAPLFALLNNIIEIRLDAKKFITELRRPVAVRAKDIGIWYNIIRGLGKLAVIINAFVISFTSDFIPRLVYLYMYSPDGTMHGFVNHTLSYFNVTDFKPGTEPSEPVDLGYKVELCRYKDYREAPWSPHKYDINKD--YWAVLAARLAFVIVFQNLVMFMSDFVDWIIPDIPKDISEQIHREKVLMVEVFLKEE 885          
BLAST of Anoctamin vs. Ensembl Mouse
Match: Ano4 (anoctamin 4 [Source:MGI Symbol;Acc:MGI:2443344])

HSP 1 Score: 379.407 bits (973), Expect = 8.712e-116
Identity = 298/939 (31.74%), Postives = 464/939 (49.41%), Query Frame = 2
Query:  137 EKEKNNKGMFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIR----KSIMNAGVDYNYIXXXXXXXXXXXX--XXXXXSIDNKRLKPIAQG--YTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYKKEN---------MRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISERNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRN---LLRLQLTYVMSKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGS--DSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLG--------GFVDFSLSFMNTTEFNISSSISNE---------THCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELE 2836
            E+ K+N G++F D   RID++LVY++   S  +  KR  F  ++  EGL++E            +S   NSD        ++FVK+HA W+ L RYAE M +R    + I      Y ++ +   +          +   +D + L  + +   YT PFS+Q+ + F I  N+  FF    RS IV++IL+R  Y                                       E G N   G+ +L++   +E AF LHE    G Y+ +N          R LLY+ WA+    +++QPLD +R YFGE +  YFAWLG+YT  LFP A  G+ V +Y + T+    + +E+ +  +I MCPV   +  C   +LS   V   +  L DNGATV  A  ++VW  +FLE W+R++  +A+ W++ D E E+E +RP++ A   K    + N ISGK EP+ +F  +     +++ S I F I + +A + GI + + +  +     +  L    S+++T      I+   I++L  +Y +VA+ LT+LE  RT+S+++NS T K+++ +F+N  SS FYI F        PG+     +  + + C    CL+DL MQ+  I+V KQ  +N +    P +               +  RR V +   T+ +I+  +    Y                    L       LF EYLEMI+QFGF TIF+  FPLAPLLA++NN++EIR DA KFVT +RRP+A R KDIGIW  IL  I  + V +NA +IA  + +I R++Y   +      G        G+V+ SLS    ++F   S   ++          +C Y  +R PP  +   P  YT  FW +LAA++AF+ +FE  V     +   +IP++P + R  M+RE  +  E + + ELE
Sbjct:   68 ERNKSN-GLYFRDGKCRIDYILVYRK---SNPQTEKREVFERNIRAEGLQME-----------KESSLINSD--------IIFVKLHAPWEVLGRYAEQMNVRMPFRRKIYYLPRRYKFMSRIDKQISRFRRWLPKKPMRLDKETLPDLEENDCYTAPFSQQRIHHFIIH-NKDTFFNNATRSRIVHHILQRIKY---------------------------------------EEGKN-KIGLNRLLTNGSYEAAFPLHE----GSYRSKNSIKTHGAVNHRHLLYECWASWGVWYKYQPLDLVRRYFGEKIGLYFAWLGWYTGMLFPAAFIGLFVFLYGVTTLDHCQVSKEVCQATDIIMCPV--CDKYCPFMRLSDSCVYAKVTHLFDNGATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLIDWEEEEEEIRPQFEAKYSKK--ERMNPISGKPEPYQAF-TDKCSRLIVSASGIFFMICVVIAAVFGIVIYRVVTVSTFAAFKWALIRNNSQVATTGTAVCINFCIIMLLNVLYEKVALLLTNLEQPRTESEWENSFTLKMFLFQFVNLNSSTFYIAFFLGRFTGHPGAYLRLINRWRLEECHPSGCLIDLCMQMGIIMVLKQTWNNFMELGYPLI-------------QNWWTRRKVRQEHGTERKINFPQWEKDYN-------------------LQPMNAYGLFDEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPLASRAKDIGIWYGILEGIGILSVITNAFVIAITSDFIPRLVYAYKYGPCAGQGEAGQKCMVGYVNASLSVFRISDFENRSEPESDGSEFSGTPLKYCRYRDYRDPPHSL--APYGYTLQFWHVLAARLAFIIVFEHLVFCIKHLISYLIPDLPKDLRDRMRREKYLIQEMMYEAELE 899          
BLAST of Anoctamin vs. Ensembl Mouse
Match: Ano4 (anoctamin 4 [Source:MGI Symbol;Acc:MGI:2443344])

HSP 1 Score: 379.407 bits (973), Expect = 8.712e-116
Identity = 298/939 (31.74%), Postives = 464/939 (49.41%), Query Frame = 2
Query:  137 EKEKNNKGMFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIR----KSIMNAGVDYNYIXXXXXXXXXXXX--XXXXXSIDNKRLKPIAQG--YTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYKKEN---------MRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISERNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRN---LLRLQLTYVMSKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGS--DSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLG--------GFVDFSLSFMNTTEFNISSSISNE---------THCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELE 2836
            E+ K+N G++F D   RID++LVY++   S  +  KR  F  ++  EGL++E            +S   NSD        ++FVK+HA W+ L RYAE M +R    + I      Y ++ +   +          +   +D + L  + +   YT PFS+Q+ + F I  N+  FF    RS IV++IL+R  Y                                       E G N   G+ +L++   +E AF LHE    G Y+ +N          R LLY+ WA+    +++QPLD +R YFGE +  YFAWLG+YT  LFP A  G+ V +Y + T+    + +E+ +  +I MCPV   +  C   +LS   V   +  L DNGATV  A  ++VW  +FLE W+R++  +A+ W++ D E E+E +RP++ A   K    + N ISGK EP+ +F  +     +++ S I F I + +A + GI + + +  +     +  L    S+++T      I+   I++L  +Y +VA+ LT+LE  RT+S+++NS T K+++ +F+N  SS FYI F        PG+     +  + + C    CL+DL MQ+  I+V KQ  +N +    P +               +  RR V +   T+ +I+  +    Y                    L       LF EYLEMI+QFGF TIF+  FPLAPLLA++NN++EIR DA KFVT +RRP+A R KDIGIW  IL  I  + V +NA +IA  + +I R++Y   +      G        G+V+ SLS    ++F   S   ++          +C Y  +R PP  +   P  YT  FW +LAA++AF+ +FE  V     +   +IP++P + R  M+RE  +  E + + ELE
Sbjct:   68 ERNKSN-GLYFRDGKCRIDYILVYRK---SNPQTEKREVFERNIRAEGLQME-----------KESSLINSD--------IIFVKLHAPWEVLGRYAEQMNVRMPFRRKIYYLPRRYKFMSRIDKQISRFRRWLPKKPMRLDKETLPDLEENDCYTAPFSQQRIHHFIIH-NKDTFFNNATRSRIVHHILQRIKY---------------------------------------EEGKN-KIGLNRLLTNGSYEAAFPLHE----GSYRSKNSIKTHGAVNHRHLLYECWASWGVWYKYQPLDLVRRYFGEKIGLYFAWLGWYTGMLFPAAFIGLFVFLYGVTTLDHCQVSKEVCQATDIIMCPV--CDKYCPFMRLSDSCVYAKVTHLFDNGATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLIDWEEEEEEIRPQFEAKYSKK--ERMNPISGKPEPYQAF-TDKCSRLIVSASGIFFMICVVIAAVFGIVIYRVVTVSTFAAFKWALIRNNSQVATTGTAVCINFCIIMLLNVLYEKVALLLTNLEQPRTESEWENSFTLKMFLFQFVNLNSSTFYIAFFLGRFTGHPGAYLRLINRWRLEECHPSGCLIDLCMQMGIIMVLKQTWNNFMELGYPLI-------------QNWWTRRKVRQEHGTERKINFPQWEKDYN-------------------LQPMNAYGLFDEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPLASRAKDIGIWYGILEGIGILSVITNAFVIAITSDFIPRLVYAYKYGPCAGQGEAGQKCMVGYVNASLSVFRISDFENRSEPESDGSEFSGTPLKYCRYRDYRDPPHSL--APYGYTLQFWHVLAARLAFIIVFEHLVFCIKHLISYLIPDLPKDLRDRMRREKYLIQEMMYEAELE 899          
BLAST of Anoctamin vs. Ensembl Mouse
Match: Ano1 (anoctamin 1, calcium activated chloride channel [Source:MGI Symbol;Acc:MGI:2142149])

HSP 1 Score: 379.407 bits (973), Expect = 2.277e-115
Identity = 281/948 (29.64%), Postives = 460/948 (48.52%), Query Frame = 2
Query:  158 GMFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRII--------------------------------------NIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIR---KSIMNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYKKENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEI-SERNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAA-LLEKNYISQFNKISGKEEPFISF-WKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRNLLRLQLTYVMS---KLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGSDS--FSMIKPQGCLTGDCLLDLSMQLIFILVGKQII-SNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLGGFVDFSLSFMNTTEFNISSSISNETH-------CSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIE 2830
            G++F D  R++D++LVY          +KR S   +L   GL+ ++  +G R +                                      N+ ++  E  +D   +   + FVKIHA W  LCR AE +K++   K + +       +           D  +    +++      +  +YPFS++K +LFD+  +R  FF    RS IV  ILKR                                             +  + GI  L++  V+  A+ LH+    G   + N R LLY+ WA+    +++QP+D +R YFGE V  YFAWLG YT  L P ++ GV V +Y  AT+  +I   E+  +R NITMCP+   + +C  WK+S+         L DN ATV  +  +++W   F+E W+RKQ  L +RW++   E E++  R EY A +LEK   S   +   KE   +   W++  P     + +I+F I +T A + G+ + +      L +  +  +    +++  A   +I+L+ II+L  VY  +A WLT +E  +T+  ++  +T K ++L+F+N+Y+ +FY+ F       +PG     F   + + C  G CL++L +QL  I++GKQ+I +N+    IP++              KFI+   + R + +D E               VK +   ++ +     +   P     EY+EMIIQFGF+T+F+  FPLAPL A++NN++EIR DAKKFVT  RRPVA R KDIGIW +IL  + K+ V  NA +I+F + +I R++Y+ ++S+N  + GFV+ +LS  N ++F   ++ ++          C Y  +R PPW  H   +S    FW +LAA++AFV +F+  V         +IP+IP +    + +E  +  E  ++ E
Sbjct:   52 GLYFRDGKRKVDYILVYH---------HKRASGSRTLARRGLQNDMV-LGTRSVRQDQPLPGKGSPVDAGSPEVPMDYHEDDKRFRREEYEGNLLEAGLELENDEDTKIHGVGFVKIHAPWHVLCREAEFLKLKMPTKKVYHISETRGLLKTINSVLQKITDPIQPKVAEHR--PQTTKRLSYPFSREKQHLFDL-TDRDSFFDSKTRSTIVYEILKRTTCTK----------------------------------------AKYSMGITSLLANGVYSAAYPLHDGDYEGDNVEFNDRKLLYEEWASYGVFYKYQPIDLVRKYFGEKVGLYFAWLGAYTQMLIPASIVGVIVFLYGCATVDENIPSMEMCDQRYNITMCPL--CDKTCSYWKMSSACATARASHLFDNPATVFFSVFMALWAATFMEHWKRKQMRLNYRWDLTGFEEEEDHPRAEYEARVLEK---SLRKESRNKETDKVKLTWRDRFPAYFTNLVSIIFMIAVTFAIVLGVIIYRISTAAALAMNSSPSVRSNIRVTVTATAVIINLVVIILLDEVYGCIARWLTKIEVPKTEKSFEERLTFKAFLLKFVNSYTPIFYVAFFKGRFVGRPGDYVYIFRSFRMEECAPGGCLMELCIQLSIIMLGKQLIQNNLFEIGIPKM-------------KKFIRYLKLRRQSPSDRE-------------EYVKRKQRYEVDFNLEPFAGLTP-----EYMEMIIQFGFVTLFVASFPLAPLFALLNNIIEIRLDAKKFVTELRRPVAIRAKDIGIWYNILRGVGKLAVIINAFVISFTSDFIPRLVYLYMYSQNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSEHKYDISKD--FWAVLAARLAFVIVFQNLVMFMSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREE 908          
BLAST of Anoctamin vs. Ensembl Mouse
Match: Ano4 (anoctamin 4 [Source:MGI Symbol;Acc:MGI:2443344])

HSP 1 Score: 379.407 bits (973), Expect = 2.496e-115
Identity = 298/935 (31.87%), Postives = 463/935 (49.52%), Query Frame = 2
Query:  137 EKEKNNKGMFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIR----KSIMNAGVDYNYIXXXXXXXXXXXX--XXXXXSIDNKRLKPIAQG--YTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHE-----KFSNGKYKKENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISERNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRN---LLRLQLTYVMSKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGS--DSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLG--------GFVDFSLSFMNTTEFNISSSISNE---------THCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELE 2836
            E+ K+N G++F D   RID++LVY++   S  +  KR  F  ++  EGL++E            +S   NSD        ++FVK+HA W+ L RYAE M +R    + I      Y ++ +   +          +   +D + L  + +   YT PFS+Q+ + F I  N+  FF    RS IV++IL+R  Y                                       E G N   G+ +L++   +E AF LHE     K S   +   N R LLY+ WA+    +++QPLD +R YFGE +  YFAWLG+YT  LFP A  G+ V +Y + T+    + +E+ +  +I MCPV   +  C   +LS   V   +  L DNGATV  A  ++VW  +FLE W+R++  +A+ W++ D E E+E +RP++ A   K    + N ISGK EP+ +F  +     +++ S I F I + +A + GI + + +  +     +  L    S+++T      I+   I++L  +Y +VA+ LT+LE  RT+S+++NS T K+++ +F+N  SS FYI F        PG+     +  + + C    CL+DL MQ+  I+V KQ  +N +    P +               +  RR V +   T+ +I+  +    Y                    L       LF EYLEMI+QFGF TIF+  FPLAPLLA++NN++EIR DA KFVT +RRP+A R KDIGIW  IL  I  + V +NA +IA  + +I R++Y   +      G        G+V+ SLS    ++F   S   ++          +C Y  +R PP  +   P  YT  FW +LAA++AF+ +FE  V     +   +IP++P + R  M+RE  +  E + + ELE
Sbjct:  103 ERNKSN-GLYFRDGKCRIDYILVYRK---SNPQTEKREVFERNIRAEGLQME-----------KESSLINSD--------IIFVKLHAPWEVLGRYAEQMNVRMPFRRKIYYLPRRYKFMSRIDKQISRFRRWLPKKPMRLDKETLPDLEENDCYTAPFSQQRIHHFIIH-NKDTFFNNATRSRIVHHILQRIKY---------------------------------------EEGKN-KIGLNRLLTNGSYEAAFPLHEGSYRSKNSIKTHGAVNHRHLLYECWASWGVWYKYQPLDLVRRYFGEKIGLYFAWLGWYTGMLFPAAFIGLFVFLYGVTTLDHCQVSKEVCQATDIIMCPV--CDKYCPFMRLSDSCVYAKVTHLFDNGATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLIDWEEEEEEIRPQFEAKYSKK--ERMNPISGKPEPYQAF-TDKCSRLIVSASGIFFMICVVIAAVFGIVIYRVVTVSTFAAFKWALIRNNSQVATTGTAVCINFCIIMLLNVLYEKVALLLTNLEQPRTESEWENSFTLKMFLFQFVNLNSSTFYIAFFLGRFTGHPGAYLRLINRWRLEECHPSGCLIDLCMQMGIIMVLKQTWNNFMELGYPLI-------------QNWWTRRKVRQEHGTERKINFPQWEKDYN-------------------LQPMNAYGLFDEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPLASRAKDIGIWYGILEGIGILSVITNAFVIAITSDFIPRLVYAYKYGPCAGQGEAGQKCMVGYVNASLSVFRISDFENRSEPESDGSEFSGTPLKYCRYRDYRDPPHSL--APYGYTLQFWHVLAARLAFIIVFEHLVFCIKHLISYLIPDLPKDLRDRMRREKYLIQEMMYEAELE 934          
BLAST of Anoctamin vs. Ensembl Mouse
Match: Ano1 (anoctamin 1, calcium activated chloride channel [Source:MGI Symbol;Acc:MGI:2142149])

HSP 1 Score: 379.022 bits (972), Expect = 9.036e-115
Identity = 281/948 (29.64%), Postives = 460/948 (48.52%), Query Frame = 2
Query:  158 GMFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRII--------------------------------------NIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIR---KSIMNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYKKENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEI-SERNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAA-LLEKNYISQFNKISGKEEPFISF-WKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRNLLRLQLTYVMS---KLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGSDS--FSMIKPQGCLTGDCLLDLSMQLIFILVGKQII-SNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLGGFVDFSLSFMNTTEFNISSSISNETH-------CSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIE 2830
            G++F D  R++D++LVY          +KR S   +L   GL+ ++  +G R +                                      N+ ++  E  +D   +   + FVKIHA W  LCR AE +K++   K + +       +           D  +    +++      +  +YPFS++K +LFD+  +R  FF    RS IV  ILKR                                             +  + GI  L++  V+  A+ LH+    G   + N R LLY+ WA+    +++QP+D +R YFGE V  YFAWLG YT  L P ++ GV V +Y  AT+  +I   E+  +R NITMCP+   + +C  WK+S+         L DN ATV  +  +++W   F+E W+RKQ  L +RW++   E E++  R EY A +LEK   S   +   KE   +   W++  P     + +I+F I +T A + G+ + +      L +  +  +    +++  A   +I+L+ II+L  VY  +A WLT +E  +T+  ++  +T K ++L+F+N+Y+ +FY+ F       +PG     F   + + C  G CL++L +QL  I++GKQ+I +N+    IP++              KFI+   + R + +D E               VK +   ++ +     +   P     EY+EMIIQFGF+T+F+  FPLAPL A++NN++EIR DAKKFVT  RRPVA R KDIGIW +IL  + K+ V  NA +I+F + +I R++Y+ ++S+N  + GFV+ +LS  N ++F   ++ ++          C Y  +R PPW  H   +S    FW +LAA++AFV +F+  V         +IP+IP +    + +E  +  E  ++ E
Sbjct:  110 GLYFRDGKRKVDYILVYH---------HKRASGSRTLARRGLQNDMV-LGTRSVRQDQPLPGKGSPVDAGSPEVPMDYHEDDKRFRREEYEGNLLEAGLELENDEDTKIHGVGFVKIHAPWHVLCREAEFLKLKMPTKKVYHISETRGLLKTINSVLQKITDPIQPKVAEHR--PQTTKRLSYPFSREKQHLFDL-TDRDSFFDSKTRSTIVYEILKRTTCTK----------------------------------------AKYSMGITSLLANGVYSAAYPLHDGDYEGDNVEFNDRKLLYEEWASYGVFYKYQPIDLVRKYFGEKVGLYFAWLGAYTQMLIPASIVGVIVFLYGCATVDENIPSMEMCDQRYNITMCPL--CDKTCSYWKMSSACATARASHLFDNPATVFFSVFMALWAATFMEHWKRKQMRLNYRWDLTGFEEEEDHPRAEYEARVLEK---SLRKESRNKETDKVKLTWRDRFPAYFTNLVSIIFMIAVTFAIVLGVIIYRISTAAALAMNSSPSVRSNIRVTVTATAVIINLVVIILLDEVYGCIARWLTKIEVPKTEKSFEERLTFKAFLLKFVNSYTPIFYVAFFKGRFVGRPGDYVYIFRSFRMEECAPGGCLMELCIQLSIIMLGKQLIQNNLFEIGIPKM-------------KKFIRYLKLRRQSPSDRE-------------EYVKRKQRYEVDFNLEPFAGLTP-----EYMEMIIQFGFVTLFVASFPLAPLFALLNNIIEIRLDAKKFVTELRRPVAIRAKDIGIWYNILRGVGKLAVIINAFVISFTSDFIPRLVYLYMYSQNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSEHKYDISKD--FWAVLAARLAFVIVFQNLVMFMSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREE 966          
BLAST of Anoctamin vs. UniProt/SwissProt
Match: sp|Q32M45|ANO4_HUMAN (Anoctamin-4 OS=Homo sapiens OX=9606 GN=ANO4 PE=2 SV=1)

HSP 1 Score: 382.104 bits (980), Expect = 1.301e-115
Identity = 302/939 (32.16%), Postives = 465/939 (49.52%), Query Frame = 2
Query:  137 EKEKNNKGMFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIR----KSIMNAGVDYNYIXXXXXXXXXXXX--XXXXXSIDNKRLKPIAQG--YTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGK-----YKKENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISERNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRN---LLRLQLTYVMSKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGS--DSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICY----QDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLG--------GFVDFSLSFMNTTEFNISSSISNE---------THCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELE 2836
            E+ K+N G++F D   RID++LVY++   S  +  KR  F  ++  EGL++E            +S   NSD        ++FVK+HA W+ L RYAE M +R    + I      Y ++ +   +          +   +D + L  + +   YT PFS+Q+ + F I  N+  FF    RS IV++IL+R  Y                                       E G N   G+ +L++   +E AF LHE     K     +  EN R LLY+ WA+    +++QPLD +R YFGE +  YFAWLG+YT  LFP A  G+ V +Y + T+    + +E+ +  +I MCPV   +  C   +LS   V   +  L DNGATV  A  ++VW  +FLE W+R++  +A+ W++ D E E+E +RP++ A   K    + N ISGK EP+ +F  +     +++ S I F I + +A + GI + + +  +     +  L    S+++T      I+   I++L  +Y +VA+ LT+LE  RT+S+++NS T K+++ +F+N  SS FYI F        PG+     +  + + C    CL+DL MQ+  I+V KQ  +N +    P     I+ +  +R      K R  H P                          E KI +    +D  L       LF EYLEMI+QFGF TIF+  FPLAPLLA++NN++EIR DA KFVT +RRP+A R KDIGIW  IL  I  + V +NA +IA  + +I R++Y   +      G        G+V+ SLS    ++F   S   ++          +C Y  +R PP  +   P  YT  FW +LAA++AF+ +FE  V     +   +IP++P + R  M+RE  +  E + + ELE
Sbjct:  103 ERNKSN-GLYFRDGKCRIDYILVYRK---SNPQTEKREVFERNIRAEGLQME-----------KESSLINSD--------IIFVKLHAPWEVLGRYAEQMNVRMPFRRKIYYLPRRYKFMSRIDKQISRFRRWLPKKPMRLDKETLPDLEENDCYTAPFSQQRIHHFIIH-NKETFFNNATRSRIVHHILQRIKY---------------------------------------EEGKN-KIGLNRLLTNGSYEAAFPLHEGSYRSKNSIRTHGAENHRHLLYECWASWGVWYKYQPLDLVRRYFGEKIGLYFAWLGWYTGMLFPAAFIGLFVFLYGVTTLDHSQVSKEVCQATDIIMCPV--CDKYCPFMRLSDSCVYAKVTHLFDNGATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLIDWEEEEEEIRPQFEAKYSKK--ERMNPISGKPEPYQAF-TDKCSRLIVSASGIFFMICVVIAAVFGIVIYRVVTVSTFAAFKWALIRNNSQVATTGTAVCINFCIIMLLNVLYEKVALLLTNLEQPRTESEWENSFTLKMFLFQFVNLNSSTFYIAFFLGRFTGHPGAYLRLINRWRLEECHPSGCLIDLCMQMGIIMVLKQTWNNFMELGYP----LIQNWWTRR------KVRQEHGP--------------------------ERKISFPQWEKDYNLQPMNAYGLFDEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPLASRAKDIGIWYGILEGIGILSVITNAFVIAITSDFIPRLVYAYKYGPCAGQGEAGQKCMVGYVNASLSVFRISDFENRSEPESDGSEFSGTPLKYCRYRDYRDPPHSL--VPYGYTLQFWHVLAARLAFIIVFEHLVFCIKHLISYLIPDLPKDLRDRMRREKYLIQEMMYEAELE 934          
BLAST of Anoctamin vs. UniProt/SwissProt
Match: sp|Q8C5H1|ANO4_MOUSE (Anoctamin-4 OS=Mus musculus OX=10090 GN=Ano4 PE=1 SV=2)

HSP 1 Score: 379.407 bits (973), Expect = 1.746e-114
Identity = 298/935 (31.87%), Postives = 463/935 (49.52%), Query Frame = 2
Query:  137 EKEKNNKGMFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIR----KSIMNAGVDYNYIXXXXXXXXXXXX--XXXXXSIDNKRLKPIAQG--YTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHE-----KFSNGKYKKENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISERNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRN---LLRLQLTYVMSKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGS--DSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLG--------GFVDFSLSFMNTTEFNISSSISNE---------THCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELE 2836
            E+ K+N G++F D   RID++LVY++   S  +  KR  F  ++  EGL++E            +S   NSD        ++FVK+HA W+ L RYAE M +R    + I      Y ++ +   +          +   +D + L  + +   YT PFS+Q+ + F I  N+  FF    RS IV++IL+R  Y                                       E G N   G+ +L++   +E AF LHE     K S   +   N R LLY+ WA+    +++QPLD +R YFGE +  YFAWLG+YT  LFP A  G+ V +Y + T+    + +E+ +  +I MCPV   +  C   +LS   V   +  L DNGATV  A  ++VW  +FLE W+R++  +A+ W++ D E E+E +RP++ A   K    + N ISGK EP+ +F  +     +++ S I F I + +A + GI + + +  +     +  L    S+++T      I+   I++L  +Y +VA+ LT+LE  RT+S+++NS T K+++ +F+N  SS FYI F        PG+     +  + + C    CL+DL MQ+  I+V KQ  +N +    P +               +  RR V +   T+ +I+  +    Y                    L       LF EYLEMI+QFGF TIF+  FPLAPLLA++NN++EIR DA KFVT +RRP+A R KDIGIW  IL  I  + V +NA +IA  + +I R++Y   +      G        G+V+ SLS    ++F   S   ++          +C Y  +R PP  +   P  YT  FW +LAA++AF+ +FE  V     +   +IP++P + R  M+RE  +  E + + ELE
Sbjct:  103 ERNKSN-GLYFRDGKCRIDYILVYRK---SNPQTEKREVFERNIRAEGLQME-----------KESSLINSD--------IIFVKLHAPWEVLGRYAEQMNVRMPFRRKIYYLPRRYKFMSRIDKQISRFRRWLPKKPMRLDKETLPDLEENDCYTAPFSQQRIHHFIIH-NKDTFFNNATRSRIVHHILQRIKY---------------------------------------EEGKN-KIGLNRLLTNGSYEAAFPLHEGSYRSKNSIKTHGAVNHRHLLYECWASWGVWYKYQPLDLVRRYFGEKIGLYFAWLGWYTGMLFPAAFIGLFVFLYGVTTLDHCQVSKEVCQATDIIMCPV--CDKYCPFMRLSDSCVYAKVTHLFDNGATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLIDWEEEEEEIRPQFEAKYSKK--ERMNPISGKPEPYQAF-TDKCSRLIVSASGIFFMICVVIAAVFGIVIYRVVTVSTFAAFKWALIRNNSQVATTGTAVCINFCIIMLLNVLYEKVALLLTNLEQPRTESEWENSFTLKMFLFQFVNLNSSTFYIAFFLGRFTGHPGAYLRLINRWRLEECHPSGCLIDLCMQMGIIMVLKQTWNNFMELGYPLI-------------QNWWTRRKVRQEHGTERKINFPQWEKDYN-------------------LQPMNAYGLFDEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPLASRAKDIGIWYGILEGIGILSVITNAFVIAITSDFIPRLVYAYKYGPCAGQGEAGQKCMVGYVNASLSVFRISDFENRSEPESDGSEFSGTPLKYCRYRDYRDPPHSL--APYGYTLQFWHVLAARLAFIIVFEHLVFCIKHLISYLIPDLPKDLRDRMRREKYLIQEMMYEAELE 934          
BLAST of Anoctamin vs. UniProt/SwissProt
Match: sp|A6QLE6|ANO4_BOVIN (Anoctamin-4 OS=Bos taurus OX=9913 GN=ANO4 PE=2 SV=1)

HSP 1 Score: 377.096 bits (967), Expect = 5.721e-114
Identity = 303/943 (32.13%), Postives = 465/943 (49.31%), Query Frame = 2
Query:  137 EKEKNNKGMFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIR----KSIMNAGVDYNYIXXXXXXXXXXXX--XXXXXSIDNKRLKPIAQG--YTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYKKEN---------MRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISERNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRN---LLRLQLTYVMSKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGS--DSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICY----QDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLG--------GFVDFSLSFMNTTEFNISSSISNE---------THCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELE 2836
            EK K N G++F D   RID++LVY++   S  +  KR  F  ++  EGL++E            +S   NSD        ++FVK+HA W+ L RYAE M +R    + I      Y ++ +   +          +   +D + L  + +   YT PFS+Q+ + F I  N+  FF    RS IV++IL+R  Y                                       E G N   G+ +L++   +E AF LHE    G Y+ +N          R LLY+ WA+    +++QPLD +R YFGE +  YFAWLG+YT  LFP A  G+ V +Y + T+    + +E+ +  +I MCPV   +  C   +LS   V   +  L DNGATV  A  ++VW  +FLE W+R++  +A+ W++ D E E+E +RP++ A   K    + N ISGK EP+ +F  +     +++ S I F I + +A + GI + + +  +     +  L    S+++T      I+   I++L  +Y +VA+ LT+LE  RT+S+++NS T K+++ +F+N  SS FYI F        PG+     +  + + C    CL+DL MQ+  I+V KQ  +N +    P     I+ +  +R      K R  H P                          E KI +    +D  L       LF EYLEMI+QFGF TIF+  FPLAPLLA++NN++EIR DA KFVT +RRP+A R KDIGIW  IL  I  + V +NA +IA  + +I R++Y   +      G        G+V+ SLS    ++F   S   ++          +C Y  +R PP  +   P  YT  FW +LAA++AF+ +FE  V     +   +IP++P + R  M+RE  +  E + + ELE
Sbjct:   68 EKNKLN-GLYFRDGKCRIDYILVYRK---SNPQMEKREVFERNIRAEGLQME-----------KESSLINSD--------IIFVKLHAPWEVLGRYAEQMNVRMPFRRKIYYLPRRYKFMSRIDKQISRFRRWLPKKPMRLDKETLPDLEENDCYTAPFSQQRIHHFIIH-NKDTFFNNATRSRIVHHILQRIKY---------------------------------------EEGKN-KIGLNRLLTNGSYEAAFPLHE----GSYRSKNSIRTHGAVNHRHLLYECWASWGVWYKYQPLDLVRRYFGEKIGLYFAWLGWYTGMLFPAAFIGLFVFLYGVITLDHCQVSKEVCQATDIIMCPV--CDKYCPFMRLSDSCVYAKVTHLFDNGATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLIDWEEEEEEIRPQFEAKYSKK--ERMNPISGKPEPYQAF-ADKCSRLIVSASGIFFMICVVIAAVFGIVIYRVVTVSTFAAFKWALIRNNSQVATTGTAVCINFCIIMLLNVLYEKVALLLTNLEQPRTESEWENSFTLKMFLFQFVNLNSSTFYIAFFLGRFTGHPGAYLRLINRWRLEECHPSGCLIDLCMQMGIIMVLKQTWNNFMELGYP----LIQNWWTRR------KVRQEHGP--------------------------ERKISFPQWEKDYNLQPMNAYGLFDEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPLASRAKDIGIWYGILEGIGILSVITNAFVIAITSDFIPRLVYAYKYGPCAGQGEAGQKCMVGYVNASLSVFRISDFENRSEPESDGSEFSGTPLKYCRYRDYRDPPHSL--VPYGYTLQFWHVLAARLAFIIVFEHLVFCIKHLISYLIPDLPKDLRDRMRREKYLIQEMMYEAELE 899          
BLAST of Anoctamin vs. UniProt/SwissProt
Match: sp|Q8BHY3|ANO1_MOUSE (Anoctamin-1 OS=Mus musculus OX=10090 GN=Ano1 PE=1 SV=2)

HSP 1 Score: 377.096 bits (967), Expect = 1.239e-113
Identity = 282/952 (29.62%), Postives = 461/952 (48.42%), Query Frame = 2
Query:  158 GMFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRII--------------------------------------NIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIR---KSIMNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYKKENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEI-SERNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPL----RPEYAA-LLEKNYISQFNKISGKEEPFISF-WKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRNLLRLQLTYVMS---KLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGSDS--FSMIKPQGCLTGDCLLDLSMQLIFILVGKQII-SNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLGGFVDFSLSFMNTTEFNISSSISNETH-------CSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIE 2830
            G++F D  R++D++LVY          +KR S   +L   GL+ ++  +G R +                                      N+ ++  E  +D   +   + FVKIHA W  LCR AE +K++   K + +       +           D  +    +++      +  +YPFS++K +LFD+  +R  FF    RS IV  ILKR                                             +  + GI  L++  V+  A+ LH+    G   + N R LLY+ WA+    +++QP+D +R YFGE V  YFAWLG YT  L P ++ GV V +Y  AT+  +I   E+  +R NITMCP+   + +C  WK+S+         L DN ATV  +  +++W   F+E W+RKQ  L +RW++   E E+E +    R EY A +LEK   S   +   KE   +   W++  P     + +I+F I +T A + G+ + +      L +  +  +    +++  A   +I+L+ II+L  VY  +A WLT +E  +T+  ++  +T K ++L+F+N+Y+ +FY+ F       +PG     F   + + C  G CL++L +QL  I++GKQ+I +N+    IP++              KFI+   + R + +D E               VK +   ++ +     +   P     EY+EMIIQFGF+T+F+  FPLAPL A++NN++EIR DAKKFVT  RRPVA R KDIGIW +IL  + K+ V  NA +I+F + +I R++Y+ ++S+N  + GFV+ +LS  N ++F   ++ ++          C Y  +R PPW  H   +S    FW +LAA++AFV +F+  V         +IP+IP +    + +E  +  E  ++ E
Sbjct:   52 GLYFRDGKRKVDYILVYH---------HKRASGSRTLARRGLQNDMV-LGTRSVRQDQPLPGKGSPVDAGSPEVPMDYHEDDKRFRREEYEGNLLEAGLELENDEDTKIHGVGFVKIHAPWHVLCREAEFLKLKMPTKKVYHISETRGLLKTINSVLQKITDPIQPKVAEHR--PQTTKRLSYPFSREKQHLFDL-TDRDSFFDSKTRSTIVYEILKRTTCTK----------------------------------------AKYSMGITSLLANGVYSAAYPLHDGDYEGDNVEFNDRKLLYEEWASYGVFYKYQPIDLVRKYFGEKVGLYFAWLGAYTQMLIPASIVGVIVFLYGCATVDENIPSMEMCDQRYNITMCPL--CDKTCSYWKMSSACATARASHLFDNPATVFFSVFMALWAATFMEHWKRKQMRLNYRWDLTGFEEEEEAVKDHPRAEYEARVLEK---SLRKESRNKETDKVKLTWRDRFPAYFTNLVSIIFMIAVTFAIVLGVIIYRISTAAALAMNSSPSVRSNIRVTVTATAVIINLVVIILLDEVYGCIARWLTKIEVPKTEKSFEERLTFKAFLLKFVNSYTPIFYVAFFKGRFVGRPGDYVYIFRSFRMEECAPGGCLMELCIQLSIIMLGKQLIQNNLFEIGIPKM-------------KKFIRYLKLRRQSPSDRE-------------EYVKRKQRYEVDFNLEPFAGLTP-----EYMEMIIQFGFVTLFVASFPLAPLFALLNNIIEIRLDAKKFVTELRRPVAIRAKDIGIWYNILRGVGKLAVIINAFVISFTSDFIPRLVYLYMYSQNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSEHKYDISKD--FWAVLAARLAFVIVFQNLVMFMSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREE 912          
BLAST of Anoctamin vs. UniProt/SwissProt
Match: sp|Q8CFW1|ANO2_MOUSE (Anoctamin-2 OS=Mus musculus OX=10090 GN=Ano2 PE=1 SV=2)

HSP 1 Score: 369.392 bits (947), Expect = 1.801e-110
Identity = 295/958 (30.79%), Postives = 458/958 (47.81%), Query Frame = 2
Query:  161 MFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGG----------------------RIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIRKSI-----MNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYKKENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISERNN-ITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEV----EDEPLRPEYAA-----LLEKNYISQFNKISGKEEPFISF------WKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRNLLRL-QLTYVMSKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGS-----DSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQII-SNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEP-RPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLGGFVDFSLSFMNTTEFNISSSISNE------THCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELEEHRNIYEAN 2863
            M F D  R++D+VL Y          +       ++I  G   + ++ GG                         N+  +  E   D+  +S+  VFV+IHA W  L R AE +KI+        + AG      F +  +        R+    N R+K +    +YPFS++K YL++I   +  FF    RS IV+ ILKR                              S +N+++             GI  LI+  ++E A+ LH+   +      N R LLY+ WA     ++ QP+D IR YFGE +  YFAWLG YT +L P ++ GV V +Y  ATI  DI  +E+ +  N  TMCP+ C + SC+ W LS+         L DN ATV  +  +++W  +FLE W+R Q  L + W++  +E       E  RPEY       LL+++  S   K+                WK+  P  ++  ++ILF I LT + + G+ V +      L L + T    +++  A   +I+L+ I+IL  +Y  VA WLT +E  +T+  ++  +  K ++L+F+N YS +FY+ F       +PGS     D + M   + C  G CL++L +QL  I++GKQ+I +NI    +P+L    ++                           E E  +   D +    Q +L     D+ L   EP   L  EY+EMIIQFGF+T+F+  FPLAP+ A++NN++E+R DAKKFVT  RRP A R KDIGIW DIL+ I K  V  NA +IA  + +I R++Y   +S N  L GFV+ +LSF N ++    +   N         C +  +R PPW  +  P  ++  +W +L+A++AFV +F+  V     +   +IP+IP +    +K+E ++  +F LK   EEH  +  A+
Sbjct:   90 MHFHDNQRKVDYVLAYHYRKRGAHLGHGSPGHSLAVISNGETGKERHGGGPGDVELGPLDALEEERREQRDEFEHNLMAAGLELEKDLESKSQGSVFVRIHAPWQVLAREAEFLKIKVPTKKMYEIKAGGSIAKKFSAILQTLSSPLQPRVPEHSNNRMKNL----SYPFSREKMYLYNI-QEKDTFFDNATRSRIVHEILKRTAC---------------------------SRANNTM-------------GINSLIANNIYEAAYPLHDGEYDSPGDDMNDRKLLYQEWARYGVFYKFQPIDLIRKYFGEKIGLYFAWLGLYTSFLIPSSVIGVIVFLYGCATIEEDIPSKEMCDHQNAFTMCPL-C-DKSCDYWNLSSACGTARASHLFDNPATVFFSIFMALWATMFLENWKRLQMRLGYFWDLTGIEEEEERSQEHSRPEYETKVREKLLKESGKSAVQKLEANSPEDDEDDEDKLTWKDRFPGYLMNFASILFMIALTFSIVFGVIVYRITTAAALSLNKATRSNVRVTVTATAVIINLVVILILDEIYGAVAKWLTKIEVPKTEQTFEERLILKAFLLKFVNAYSPIFYVAFFKGRFVGRPGSYVYVFDGYRM---EECAPGGCLMELCIQLSIIMLGKQLIQNNIFEIGVPKLKKLFRK------------------------LKDETEPGESDPDHSKRPEQWDL-----DHSL---EPYTGLTPEYMEMIIQFGFVTLFVASFPLAPVFALLNNVIEVRLDAKKFVTELRRPDAVRTKDIGIWFDILSGIGKFSVIINAFVIAVTSDFIPRLVYQYSYSHNGTLHGFVNHTLSFFNVSQLKEGTQPENSQFDQEVQFCRFKDYREPPWAPN--PYEFSKQYWSVLSARLAFVIIFQNLVMFLSVLVDWMIPDIPTDISDQIKKEKSLLVDFFLK---EEHEKVKLAD 960          
BLAST of Anoctamin vs. TrEMBL
Match: A0A5K4FF50 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 611.683 bits (1576), Expect = 0.000e+0
Identity = 351/841 (41.74%), Postives = 514/841 (61.12%), Query Frame = 2
Query:  374 NLVFVKIHASWDTLCRYAEIMKIRKSIMNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNL-------NFGIAKLISEKVFETAFILHEKFSNGKYKKE-NMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISE-RNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRNLLRLQLTYVMSKLSTAAI-----GXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGSDSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDI---YTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLGGFVDFSLSFMNTTEFNISSSISNETHCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELEEHR 2845
            NLVFVK+HASW+ +  YAE +K+RK +      +  +  +            +  +D   +KPI   YT+PFS  + YLFDIP N+ EFFT VER+L++++IL+R GYKS      +L N + L   EP  SD  ++ + +  N    N +N        N GI KLIS+ +F  A+ LHE   +     E N R+LL ++WA+   +F+ QP+ +IR YFGE VAFYFAWLGFYT WL PIA+ G+ V ++ L  +  D II E+ +   NI MCP+ C    C+ W L    ++  L+RL+D+  TV+ A V+S+W  +F EMW+RKQ +LA+RWNV+ LE  D+P RPE+ ALL K    + N ++G  EPFI FW+  +PI +++ ST+L +++LTLA L G+ + K +I+ +L      ++   STA +     GSL++L+TI  L  VY R+A  LTD+EHHRTQ +YDNS+T KLY+L+F+N YSS+FYI F    T   PGS+   +I+  GC  GDCL +L +QL+ I+VGKQI S I    +P L     ++R  +  S +      +  +I   E + V  S +   Y+  +G  +     +C  D  + DP  RPLF EYLEM+IQ+GFIT+F+  FPLAPL  ++NNL EIR DAKK V  YRRPV +RV+ IGIW+ I+T +A I +++NA +IAF T +IDR +Y   +S +  + GFV+F+LS+M+TT F++    +NET+C Y  +R PPW   +EP  +T +++ +LAAK  FV+ FET  ++   + +  +P++P   R  +  E+ ITN  IL  E+   +
Sbjct:  151 NLVFVKLHASWEAMTYYAEYLKMRKPLRQLAYGWKLVNPTPKTSVFKDFLKCL-RMDKNIIKPIDTCYTWPFSMNRQYLFDIPENKDEFFTAVERALVLDHILRRTGYKS-----EDLVNTEDL--YEPSISDIVTSHDLADENSGSSNQANSLYVMATKNLGITKLISDGIFSAAYPLHEPAGSTLAPTEFNNRILLQRYWASYKMLFKCQPISYIRYYFGEAVAFYFAWLGFYTAWLLPIAILGIIVFLFGLLDLKSDSIIHEVCDLGQNIYMCPL-CKSSKCKFWTLDTSCLRTKLMRLVDHEGTVLFAVVMSLWAVIFFEMWKRKQVSLAYRWNVYSLEPMDQPPRPEFMALLSKRCPRKVNSLTGYVEPFIPFWRRKVPIILVSFSTVLLTVILTLAFLVGVVLYKLVIKVILYRHHNPIVQ--STAGMIATMTGSLVNLVTIFFLKLVYDRMATKLTDIEHHRTQVEYDNSLTLKLYLLQFVNYYSSIFYIAFIQGPTSAVPGSEHI-LIQSTGCDQGDCLFELFIQLVIIMVGKQIFSFIQESLMPVLWKLFFKFRSMKRSSNYADHNH-NMNSINFNESNPVTTSLLPAKYSSLSGRNI-----LCRADFNMLDPGSRPLFNEYLEMMIQYGFITMFVPAFPLAPLFGLLNNLFEIRGDAKKLVNQYRRPVLERVQTIGIWLSIITVLASIAIRTNACIIAFTTQFIDRCVYRYTYSPDGTMKGFVNFTLSYMSTTRFDVP---TNETYCRYDSYRSPPWS--SEPYVFTSIYYHVLAAKFIFVFTFETIATILTNVIMAAVPDVPKRVRRKIFHESNITNAIILNAEVGNQQ 968          
BLAST of Anoctamin vs. TrEMBL
Match: A0A5K4FDS2 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 601.282 bits (1549), Expect = 0.000e+0
Identity = 352/862 (40.84%), Postives = 516/862 (59.86%), Query Frame = 2
Query:  374 NLVFVKIHASWDTLCRYAEIMKIRKSIMNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNL-------NFGIAKLISEKVFETAFILHE---KFSNGKYKKE-------------------NMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISE-RNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRNLLRLQLTYVMSKLSTAAI-----GXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGSDSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDI---YTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLGGFVDFSLSFMNTTEFNISSSISNETHCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELEEHR 2845
            NLVFVK+HASW+ +  YAE +K+RK +      +  +  +            +  +D   +KPI   YT+PFS  + YLFDIP N+ EFFT VER+L++++IL+R GYKS      +L N + L E  P  SD  ++ + +  N    N +N        N GI KLIS+ +F  A+ LHE   K S    ++                    N R+LL ++WA+   +F+ QP+ +IR YFGE VAFYFAWLGFYT WL PIA+ G+ V ++ L  +  D II E+ +   NI MCP+ C    C+ W L    ++  L+RL+D+  TV+ A V+S+W  +F EMW+RKQ +LA+RWNV+ LE  D+P RPE+ ALL K    + N ++G  EPFI FW+  +PI +++ ST+L +++LTLA L G+ + K +I+ +L      ++   STA +     GSL++L+TI  L  VY R+A  LTD+EHHRTQ +YDNS+T KLY+L+F+N YSS+FYI F    T   PGS+   +I+  GC  GDCL +L +QL+ I+VGKQI S I    +P L     ++R  +  S +      +  +I   E + V  S +   Y+  +G  +     +C  D  + DP  RPLF EYLEM+IQ+GFIT+F+  FPLAPL  ++NNL EIR DAKK V  YRRPV +RV+ IGIW+ I+T +A I +++NA +IAF T +IDR +Y   +S +  + GFV+F+LS+M+TT F++    +NET+C Y  +R PPW   +EP  +T +++ +LAAK  FV+ FET  ++   + +  +P++P   R  +  E+ ITN  IL  E+   +
Sbjct:  151 NLVFVKLHASWEAMTYYAEYLKMRKPLRQLAYGWKLVNPTPKTSVFKDFLKCL-RMDKNIIKPIDTCYTWPFSMNRQYLFDIPENKDEFFTAVERALVLDHILRRTGYKS-----EDLVNTEDLYE--PSISDIVTSHDLADENSGSSNQANSLYVMATKNLGITKLISDGIFSAAYPLHEPTKKLSLITLQQNIITPSCYGPAGSTLAPTEFNNRILLQRYWASYKMLFKCQPISYIRYYFGEAVAFYFAWLGFYTAWLLPIAILGIIVFLFGLLDLKSDSIIHEVCDLGQNIYMCPL-CKSSKCKFWTLDTSCLRTKLMRLVDHEGTVLFAVVMSLWAVIFFEMWKRKQVSLAYRWNVYSLEPMDQPPRPEFMALLSKRCPRKVNSLTGYVEPFIPFWRRKVPIILVSFSTVLLTVILTLAFLVGVVLYKLVIKVILYRHHNPIVQ--STAGMIATMTGSLVNLVTIFFLKLVYDRMATKLTDIEHHRTQVEYDNSLTLKLYLLQFVNYYSSIFYIAFIQGPTSAVPGSEHI-LIQSTGCDQGDCLFELFIQLVIIMVGKQIFSFIQESLMPVLWKLFFKFRSMKRSSNYADHNH-NMNSINFNESNPVTTSLLPAKYSSLSGRNI-----LCRADFNMLDPGSRPLFNEYLEMMIQYGFITMFVPAFPLAPLFGLLNNLFEIRGDAKKLVNQYRRPVLERVQTIGIWLSIITVLASIAIRTNACIIAFTTQFIDRCVYRYTYSPDGTMKGFVNFTLSYMSTTRFDVP---TNETYCRYDSYRSPPWS--SEPYVFTSIYYHVLAAKFIFVFTFETIATILTNVIMAAVPDVPKRVRRKIFHESNITNAIILNAEVGNQQ 989          
BLAST of Anoctamin vs. TrEMBL
Match: A0A5K4FBC0 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 600.127 bits (1546), Expect = 0.000e+0
Identity = 354/862 (41.07%), Postives = 516/862 (59.86%), Query Frame = 2
Query:  374 NLVFVKIHASWDTLCRYAEIMKIRKSIMNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNL-------NFGIAKLISEKVFETAFILHEKF----------------------SNGKYKKENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISE-RNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRNLLRLQLTYVMSKLSTAAI-----GXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGSDSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDI---YTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLGGFVDFSLSFMNTTEFNISSSISNETHCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELEEHR 2845
            NLVFVK+HASW+ +  YAE +K+RK +         +     +  V  DF +   +D   +KPI   YT+PFS  + YLFDIP N+ EFFT VER+L++++IL+R GYKS      +L N + L   EP  SD  ++ + +  N    N +N        N GI KLIS+ +F  A+ LHE                        S     + N R+LL ++WA+   +F+ QP+ +IR YFGE VAFYFAWLGFYT WL PIA+ G+ V ++ L  +  D II E+ +   NI MCP+ C    C+ W L    ++  L+RL+D+  TV+ A V+S+W  +F EMW+RKQ +LA+RWNV+ LE  D+P RPE+ ALL K    + N ++G  EPFI FW+  +PI +++ ST+L +++LTLA L G+ + K +I+ +L      ++   STA +     GSL++L+TI  L  VY R+A  LTD+EHHRTQ +YDNS+T KLY+L+F+N YSS+FYI F    T   PGS+   +I+  GC  GDCL +L +QL+ I+VGKQI S I    +P L     ++R  +  S +      +  +I   E + V  S +   Y+  +G  +     +C  D  + DP  RPLF EYLEM+IQ+GFIT+F+  FPLAPL  ++NNL EIR DAKK V  YRRPV +RV+ IGIW+ I+T +A I +++NA +IAF T +IDR +Y   +S +  + GFV+F+LS+M+TT F++    +NET+C Y  +R PPW   +EP  +T +++ +LAAK  FV+ FET  ++   + +  +P++P   R  +  E+ ITN  IL  E+   +
Sbjct:  151 NLVFVKLHASWEAMTYYAEYLKMRKPLRQ-------LVNPTPKTSVFKDFLKCLRMDKNIIKPIDTCYTWPFSMNRQYLFDIPENKDEFFTAVERALVLDHILRRTGYKS-----EDLVNTEDL--YEPSISDIVTSHDLADENSGSSNQANSLYVMATKNLGITKLISDGIFSAAYPLHEPTKKLSLITLQQNIITPSCYGPAGSTLAPTEFNNRILLQRYWASYKMLFKCQPISYIRYYFGEAVAFYFAWLGFYTAWLLPIAILGIIVFLFGLLDLKSDSIIHEVCDLGQNIYMCPL-CKSSKCKFWTLDTSCLRTKLMRLVDHEGTVLFAVVMSLWAVIFFEMWKRKQVSLAYRWNVYSLEPMDQPPRPEFMALLSKRCPRKVNSLTGYVEPFIPFWRRKVPIILVSFSTVLLTVILTLAFLVGVVLYKLVIKVILYRHHNPIVQ--STAGMIATMTGSLVNLVTIFFLKLVYDRMATKLTDIEHHRTQVEYDNSLTLKLYLLQFVNYYSSIFYIAFIQGPTSAVPGSEHI-LIQSTGCDQGDCLFELFIQLVIIMVGKQIFSFIQESLMPVLWKLFFKFRSMKRSSNYADHNH-NMNSINFNESNPVTTSLLPAKYSSLSGRNI-----LCRADFNMLDPGSRPLFNEYLEMMIQYGFITMFVPAFPLAPLFGLLNNLFEIRGDAKKLVNQYRRPVLERVQTIGIWLSIITVLASIAIRTNACIIAFTTQFIDRCVYRYTYSPDGTMKGFVNFTLSYMSTTRFDVP---TNETYCRYDSYRSPPWS--SEPYVFTSIYYHVLAAKFIFVFTFETIATILTNVIMAAVPDVPKRVRRKIFHESNITNAIILNAEVGNQQ 983          
BLAST of Anoctamin vs. TrEMBL
Match: A0A0X3P2Y5 (Anoctamin (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR128201 PE=3 SV=1)

HSP 1 Score: 586.645 bits (1511), Expect = 0.000e+0
Identity = 352/1008 (34.92%), Postives = 545/1008 (54.07%), Query Frame = 2
Query:  161 MFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIIN-----------------------------IADSVNENSDDITCES--------KNLVFVKIHASWDTLCRYAEIMKIRKSIMNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLV--ELEPIHSDKRSNSNDSITNEVE------ENGSNLNFGIAKLISEKVFETAFILHEKFSN---------------------------GKYKKE-NMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISERNN-ITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEK-NYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRNLLRLQ--------LTYVMSKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGSDSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTIT-------DYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLGGFVDFSLSFMNTTEFNISSS----ISNETHCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELEEHRNIYEANNLAKSLKKTIINY 2902
            MFF D  RRIDFV+ Y++  +S++K  KR +F+ +L  + +EIE+++  G I+                              + D++  N  + + ++        ++LVF+K+H +W TL R AE+++ RK +    +                D  R    D K +K +   YT PFS+ + YLF+IP +  EFFTP ERS+ V+++L+R G   +    SNL N +     +L P+ +    +    + +              ++ GI KL++E VF+ AF LHE   +                            K++ E NMR++L + WA L  +F++QPLD++RLYFGE VA YFAWLG YT WL PI +FG+ +       I  D  I+++ +R +   MCP   ++G C+ W L+       +  L+DNG TV  A ++++W  +F+E W+R Q  LA++WNV +LE  DEP RPE+ ALL+K  Y S+ N ++G+EEP I FW   +PI  +T + +LF +VL LACL G+   + +IR +L LQ        L  +++ ++++ I     L  I +L  VY RVAV +T+LE+HRTQS+YD+S+T KLY+L+F+N YSS+FYI F    T   PG DS + I+  GC  G+CL  L +QL  I+VGKQ ++ +   +IP +   IK    +R   K ++R++  R   +         E +         +    K  + +  C  +  L D   RPLF+EYLEM+IQ+GFIT+F+  FP+APL A++NN+ EIR+DA KF+ V RRPV +R K IGIW  IL  ++ I +++NA LIAF T +I+R++Y++ +S    + G+ +FSLS+M+   F    S    ++   +C Y   R  PWD   +P  Y P FW +LA K AFV+ FE    +   +    IP+IP    +  + EA + NE IL+ E+E+  +     +L  + +  I  Y
Sbjct:   40 MFFRDGKRRIDFVIAYKKGQNSDDKEAKRFAFLSALAAQMIEIEVEDCHGNILASTGPAGKESDHSAAKLRLIEQEESAAREAVYDAIETNESNKSIQALEQDILAIQDLVFIKLHIAWTTLTRVAEVLQFRKPLKQKHLQ-------RLSVNELTDCCRCLKPDPKEVKKLPTPYTAPFSRGRLYLFEIPKDYDEFFTPTERSVAVDFVLRRTGTARS----SNLDNTRKGAGSKLPPVDTVSEKDVEMEVKSGARPEDIKLATAGKVDLGIDKLLNEGVFQAAFPLHEPSVDMLHLLMTKEQDQLAEEHGLTGSDSPKARKHENEMNMRIMLTEQWANLRKMFKYQPLDYVRLYFGESVALYFAWLGLYTTWLLPIGIFGLVIFCLGAIDISDDTQIEDVCQRGSQYVMCPPCNVKG-CKFWYLNTSCFATKMTHLVDNGGTVAFAIIMALWATMFMERWKRYQNVLAYQWNVQNLEPVDEPPRPEFLALLDKRGYRSEINPVTGREEPVIPFWSRKVPILFITYAAVLFGVVLCLACLLGVIFYRLVIRVIL-LQNENAFVNSLAGIITTITSSCIN----LACIFVLKLVYDRVAVVMTNLENHRTQSEYDDSLTLKLYLLQFVNYYSSIFYIAFIQGTTAAIPGDDSVA-IRSSGCDGGNCLFQLFIQLAIIMVGKQFLNFVTENTIPPIKRFIKVLLARRTAKKKLERQAAIRAAASSAGGPYGSLEPNAPSVPSAAEELAAAKQIATMYNCRSNYTLIDAGSRPLFEEYLEMLIQYGFITMFVPAFPVAPLFALLNNMFEIRTDASKFLRVLRRPVIKREKTIGIWFSILDVLSSIAIRTNACLIAFTTGFINRLVYVLYYSPTASMAGYTNFSLSYMSADRFTAPRSNRDILNGSLYCRYPDLRQAPWD--PQPYEYLPAFWHILAIKFAFVFAFENVAIILTSMIATFIPDIPGRLSVVARHEARVINELILRGEIEDEEDKRAPEDLPPTTQPPIQFY 1027          
BLAST of Anoctamin vs. TrEMBL
Match: A0A0X3NPU4 (Anoctamin OS=Schistocephalus solidus OX=70667 GN=TR128201 PE=3 SV=1)

HSP 1 Score: 586.26 bits (1510), Expect = 0.000e+0
Identity = 354/1020 (34.71%), Postives = 550/1020 (53.92%), Query Frame = 2
Query:  161 MFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIIN-----------------------------IADSVNENSDDITCES--------KNLVFVKIHASWDTLCRYAEIMKIRKSIMNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLV--ELEPIHSDKRSNSNDSITNEVE------ENGSNLNFGIAKLISEKVFETAFILHEKFSN---------------------------GKYKKE-NMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISERNN-ITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEK-NYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRNLLRLQ--------LTYVMSKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGSDSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTIT-------DYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLGGFVDFSLSFMNTTEFNISSS----ISNETHCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELEEHRNIYEANNLAKSLKKTIINYRQKLNKPNSKQR 2938
            MFF D  RRIDFV+ Y++  +S++K  KR +F+ +L  + +EIE+++  G I+                              + D++  N  + + ++        ++LVF+K+H +W TL R AE+++ RK +    +                D  R    D K +K +   YT PFS+ + YLF+IP +  EFFTP ERS+ V+++L+R G   +    SNL N +     +L P+ +    +    + +              ++ GI KL++E VF+ AF LHE   +                            K++ E NMR++L + WA L  +F++QPLD++RLYFGE VA YFAWLG YT WL PI +FG+ +       I  D  I+++ +R +   MCP   ++G C+ W L+       +  L+DNG TV  A ++++W  +F+E W+R Q  LA++WNV +LE  DEP RPE+ ALL+K  Y S+ N ++G+EEP I FW   +PI  +T + +LF +VL LACL G+   + +IR +L LQ        L  +++ ++++ I     L  I +L  VY RVAV +T+LE+HRTQS+YD+S+T KLY+L+F+N YSS+FYI F    T   PG DS + I+  GC  G+CL  L +QL  I+VGKQ ++ +   +IP +   IK    +R   K ++R++  R   +         E +         +    K  + +  C  +  L D   RPLF+EYLEM+IQ+GFIT+F+  FP+APL A++NN+ EIR+DA KF+ V RRPV +R K IGIW  IL  ++ I +++NA LIAF T +I+R++Y++ +S    + G+ +FSLS+M+   F    S    ++   +C Y   R  PWD   +P  Y P FW +LA K AFV+ FE    +   +    IP+IP    +  + EA + NE IL+ E+E+  +     +L  + +  I  Y  +  + N + R
Sbjct:   40 MFFRDGKRRIDFVIAYKKGQNSDDKEAKRFAFLSALAAQMIEIEVEDCHGNILASTGPAGKESDHSAAKLRLIEQEESAAREAVYDAIETNESNKSIQALEQDILAIQDLVFIKLHIAWTTLTRVAEVLQFRKPLKQKHLQ-------RLSVNELTDCCRCLKPDPKEVKKLPTPYTAPFSRGRLYLFEIPKDYDEFFTPTERSVAVDFVLRRTGTARS----SNLDNTRKGAGSKLPPVDTVSEKDVEMEVKSGARPEDIKLATAGKVDLGIDKLLNEGVFQAAFPLHEPSVDMLHLLMTKEQDQLAEEHGLTGSDSPKARKHENEMNMRIMLTEQWANLRKMFKYQPLDYVRLYFGESVALYFAWLGLYTTWLLPIGIFGLVIFCLGAIDISDDTQIEDVCQRGSQYVMCPPCNVKG-CKFWYLNTSCFATKMTHLVDNGGTVAFAIIMALWATMFMERWKRYQNVLAYQWNVQNLEPVDEPPRPEFLALLDKRGYRSEINPVTGREEPVIPFWSRKVPILFITYAAVLFGVVLCLACLLGVIFYRLVIRVIL-LQNENAFVNSLAGIITTITSSCIN----LACIFVLKLVYDRVAVVMTNLENHRTQSEYDDSLTLKLYLLQFVNYYSSIFYIAFIQGTTAAIPGDDSVA-IRSSGCDGGNCLFQLFIQLAIIMVGKQFLNFVTENTIPPIKRFIKVLLARRTAKKKLERQAAIRAAASSAGGPYGSLEPNAPSVPSAAEELAAAKQIATMYNCRSNYTLIDAGSRPLFEEYLEMLIQYGFITMFVPAFPVAPLFALLNNMFEIRTDASKFLRVLRRPVIKREKTIGIWFSILDVLSSIAIRTNACLIAFTTGFINRLVYVLYYSPTASMAGYTNFSLSYMSADRFTAPRSNRDILNGSLYCRYPDLRQAPWD--PQPYEYLPAFWHILAIKFAFVFAFENVAIILTSMIATFIPDIPGRLSVVARHEARVINELILRGEIEDEEDKRAPEDLPPTTQPPIQFYNYEHPEYNEQYR 1039          
BLAST of Anoctamin vs. Ensembl Cavefish
Match: ano5b (anoctamin 5b [Source:ZFIN;Acc:ZDB-GENE-061215-108])

HSP 1 Score: 370.163 bits (949), Expect = 2.180e-112
Identity = 281/934 (30.09%), Postives = 454/934 (48.61%), Query Frame = 2
Query:  143 EKNNKGMFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIRKSIMNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYKK---ENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISE---RNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPL--RPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRNLL----------RLQL--TYVMSKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGSDSF---SMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVH--SRNFDLGGFVDFSLSFMNTTEFNISSSISNE----------THCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELEE 2839
            E+N   ++F D  RRIDFVL Y    D ++K  +R  F  +L   GL +E+++               SDD     +   ++KIHA W+ L  +A+++KI+       V +         +       R F +    +      +T PF K+K   F I  ++  FF P  R+ IV YIL                         P + + R   + +              GI +L+S   + +A+ LH+     K  +   E+ R  LYKHWA     ++ QPL+ IR Y+GE +  YFAWLGFYT  LF  A+ GV   +Y L +   +I  +EI +      I MCP+   +  C  WKL++  +  +   L DN  TV  A  + +WV LFLE W+R+Q  L + W++   E E + L  RPE+     K    + N I+ + EP++           ++ +T+LF   L +AC+ G+   +  +              ++QL  + +  +L+T+   S I+ + I+IL  +Y  VA+W+TD+E  +T  +Y+N +T K+++ +F+N YSS FY+ F        PG  ++   S ++ + C  G CL++L+ QL+ ++VGKQ++ NI    +P L    K + I R      K RS      + +E                          QD+ L       LF EYLEM+IQFGFIT+F+  FPLAPLLA+ NN++E+R DA KF T +RRPVA + ++IG W +IL  +A + V +NA ++AF +  I R++Y+  +       + G+++ SLS    ++  +++    E          T C Y  +RYPP   H+   ++T  FW +LAAK+AF+ + E  V +       +IP++P E +  +KRE  +  E++   E+E+
Sbjct:   65 EQNKDSVYFRDGKRRIDFVLSYVDDKDGDKKAERRRLFEANLEKTGLHLELED------------KSESDD-----RKTYYLKIHAPWEVLGTFADVLKIK-------VPFKASDIHKAREGSLNWLTRPFRLPPDIMSSEPDYFTAPFDKRKADFFLIK-DQETFFPPSTRNRIVYYILTHC----------------------PYYKEDRKEKDKT--------------GIKRLLSNSTYTSAYPLHDCRYWKKADQTLCESERYHLYKHWARFLCFYKEQPLNLIRKYYGEKIGIYFAWLGFYTEMLFFAAVVGVICFVYGLLSYDDNITSKEICDPTIGGKIVMCPL--CDKKCSYWKLNSTCLSSWQAHLFDNEGTVFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVHFEEEQQQLQMRPEFEL---KCTNKRLNPITQEMEPYLPLTSKCARF-FVSGATVLFWTCLIVACIMGVIAYRLAVYAAFARLMKDSPTSKIQLVGSLINPQLATSVTASCINFVIILILNFLYEHVAIWITDMEIPKTHLEYENKLTTKMFMFQFVNYYSSCFYVAFFKGKFVGYPGKYTYMFGSHLRNEECAPGGCLIELTTQLVIVMVGKQLVGNIQEALLPLL----KNWWISR------KGRSHPEGQYSRWE--------------------------QDHDLQSFSQFGLFYEYLEMVIQFGFITLFVASFPLAPLLALFNNILEVRLDAWKFTTQFRRPVAAKARNIGAWNEILNVVAILSVVTNAFIMAFTSDMIPRLVYLYAYHPGEEATMAGYINNSLSVYEISDLRVNNRPDEEENPAWFNANITTCRYRDYRYPP--GHHRQYTHTMQFWHILAAKMAFIIIMEHVVFVVKFFVAWLIPDVPSEVKARIKRERHLVQEYLHTYEVEK 893          
BLAST of Anoctamin vs. Ensembl Cavefish
Match: ano5a (anoctamin 5 [Source:NCBI gene;Acc:103044829])

HSP 1 Score: 367.851 bits (943), Expect = 6.635e-112
Identity = 291/942 (30.89%), Postives = 460/942 (48.83%), Query Frame = 2
Query:  134 NEKEKNNKGMFFTDRVRRIDFVLVYQQLLDSEE-KRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIRKSIMNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQGYTYPFSKQK--YYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYKK---ENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISERN---NITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDE--PLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGI------------TVTKTIIRNLLRLQLTYVMSKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGSDSF----SMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLG--GFVDFSLSFMNTTEFNISSSI-----------SNETHCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELEE 2839
            +++ ++   ++F D  RRIDFVL Y +  D E+ K+ +R  + E++   GLE+E++                 D    E     F+KIHA W+ L  YA+++KI+       +  N        +      F    + +  ++P    +T PF K K  ++L D   ++   F P  R+ IV YIL R  Y  +                + I+ DKR                    GI +L++   + +AF LH+     K +    E+ R  LY++WA     ++ QPL+ IR Y+GE +  YFAWLGFYT  LF  AL G+   IY  AT    I  +EI + +    I MCP+   +  C  WKL++     +   L DN ATV  A  + +WV LFLE W+R+Q  L + W++ D E E +   LRPEY     K    + NK++ + EP+     +      L+ +T+LF I L +A + G+            +V K    N + L  + +  +L+T+   S I+ + I+IL   Y RVA+W+TD+E  +T  +Y+N +T K+++ +F+N YSS FY+ F        PG  ++    S ++ + C  G CL++L+ QL+ ++ GKQ+  NI    +P L    K +   R      K RS      + +E                          QD  L +     LF EYLEM+IQFGFIT+F+  FPLAPLLA++NN++E+R DA K  T +RRPVA +   IG W +IL  IA   V +NA ++AF +  I R++Y+  +    +L   G+V+ SLS  N ++ +  ++            S  T C Y  +RYPP   H    S+T  FW +LAAK+AF+ + E  V +   +   +IP++P + +  +KRE  +  E++   E+++
Sbjct:   13 DKQHQSKDSVYFRDGKRRIDFVLSYIE--DKEDRKQERRKLYEENMQKAGLELELE-----------------DKTESEDGKTYFLKIHAPWEVLATYADVLKIKVPFKVNDIPEN-------REIPVSWLFTPLLLPDHVMRPDPDYFTSPFDKSKDDFFLID---DKETLFPPSTRNRIVYYILSRCFYNRD----------------DNINKDKR--------------------GIKRLLNNGTYTSAFPLHDCRYWTKSRDTHCESERYSLYRYWARFFRFYKEQPLNLIRKYYGEKIGIYFAWLGFYTEMLFYAALVGLICFIYGAATYDDVIWTKEICDDDIGGQIVMCPL--CDKKCGFWKLNSTCNSTWQSHLFDNTATVFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQLRPEYET---KCTSRRRNKVTQEMEPYFPV-TSKCARACLSGATVLFWISLIIASIIGVIAYRLAVFAALASVMKDSPTNKMELVGSLITPQLATSVTASCINFVIIMILNFFYERVAIWITDMEVPKTHLEYENKLTIKMFLFQFVNYYSSCFYVAFFKGKFVGYPGKYTYMFNGSGLRNEECDPGGCLIELTTQLVIVMTGKQVWGNIQEALLPWL----KNWWSSR------KARSHPESLYSRWE--------------------------QDYDLQNFSQFGLFYEYLEMVIQFGFITLFVASFPLAPLLALMNNILEVRVDAWKLTTQFRRPVAAKAHSIGAWDEILNMIAVFSVVTNAFIVAFTSDMIPRLVYLYAYHPGTELTMQGYVNNSLSIFNISQLHSDNTPDPGENPAWFNNSVITTCRYRDYRYPP--GHEYEYSHTMQFWHILAAKMAFIIIMEHVVFVVKFLVAWLIPDVPSDVQARVKRERYLVQEYLHNYEVDK 845          
BLAST of Anoctamin vs. Ensembl Cavefish
Match: ano5a (anoctamin 5 [Source:NCBI gene;Acc:103044829])

HSP 1 Score: 367.081 bits (941), Expect = 1.230e-111
Identity = 291/942 (30.89%), Postives = 460/942 (48.83%), Query Frame = 2
Query:  134 NEKEKNNKGMFFTDRVRRIDFVLVYQQLLDSEE-KRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIRKSIMNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQGYTYPFSKQK--YYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYKK---ENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISERN---NITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDE--PLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGI------------TVTKTIIRNLLRLQLTYVMSKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGSDSF----SMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLG--GFVDFSLSFMNTTEFNISSSI-----------SNETHCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELEE 2839
            +++ ++   ++F D  RRIDFVL Y +  D E+ K+ +R  + E++   GLE+E++                 D    E     F+KIHA W+ L  YA+++KI+       +  N        +      F    + +  ++P    +T PF K K  ++L D   ++   F P  R+ IV YIL R  Y  +                + I+ DKR                    GI +L++   + +AF LH+     K +    E+ R  LY++WA     ++ QPL+ IR Y+GE +  YFAWLGFYT  LF  AL G+   IY  AT    I  +EI + +    I MCP+   +  C  WKL++     +   L DN ATV  A  + +WV LFLE W+R+Q  L + W++ D E E +   LRPEY     K    + NK++ + EP+     +      L+ +T+LF I L +A + G+            +V K    N + L  + +  +L+T+   S I+ + I+IL   Y RVA+W+TD+E  +T  +Y+N +T K+++ +F+N YSS FY+ F        PG  ++    S ++ + C  G CL++L+ QL+ ++ GKQ+  NI    +P L    K +   R      K RS      + +E                          QD  L +     LF EYLEM+IQFGFIT+F+  FPLAPLLA++NN++E+R DA K  T +RRPVA +   IG W +IL  IA   V +NA ++AF +  I R++Y+  +    +L   G+V+ SLS  N ++ +  ++            S  T C Y  +RYPP   H    S+T  FW +LAAK+AF+ + E  V +   +   +IP++P + +  +KRE  +  E++   E+++
Sbjct:   18 DKQHQSKDSVYFRDGKRRIDFVLSYIE--DKEDRKQERRKLYEENMQKAGLELELE-----------------DKTESEDGKTYFLKIHAPWEVLATYADVLKIKVPFKVNDIPEN-------REIPVSWLFTPLLLPDHVMRPDPDYFTSPFDKSKDDFFLID---DKETLFPPSTRNRIVYYILSRCFYNRD----------------DNINKDKR--------------------GIKRLLNNGTYTSAFPLHDCRYWTKSRDTHCESERYSLYRYWARFFRFYKEQPLNLIRKYYGEKIGIYFAWLGFYTEMLFYAALVGLICFIYGAATYDDVIWTKEICDDDIGGQIVMCPL--CDKKCGFWKLNSTCNSTWQSHLFDNTATVFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQLRPEYET---KCTSRRRNKVTQEMEPYFPV-TSKCARACLSGATVLFWISLIIASIIGVIAYRLAVFAALASVMKDSPTNKMELVGSLITPQLATSVTASCINFVIIMILNFFYERVAIWITDMEVPKTHLEYENKLTIKMFLFQFVNYYSSCFYVAFFKGKFVGYPGKYTYMFNGSGLRNEECDPGGCLIELTTQLVIVMTGKQVWGNIQEALLPWL----KNWWSSR------KARSHPESLYSRWE--------------------------QDYDLQNFSQFGLFYEYLEMVIQFGFITLFVASFPLAPLLALMNNILEVRVDAWKLTTQFRRPVAAKAHSIGAWDEILNMIAVFSVVTNAFIVAFTSDMIPRLVYLYAYHPGTELTMQGYVNNSLSIFNISQLHSDNTPDPGENPAWFNNSVITTCRYRDYRYPP--GHEYEYSHTMQFWHILAAKMAFIIIMEHVVFVVKFLVAWLIPDVPSDVQARVKRERYLVQEYLHNYEVDK 850          
BLAST of Anoctamin vs. Ensembl Cavefish
Match: ano5a (anoctamin 5 [Source:NCBI gene;Acc:103044829])

HSP 1 Score: 367.466 bits (942), Expect = 1.546e-111
Identity = 291/942 (30.89%), Postives = 460/942 (48.83%), Query Frame = 2
Query:  134 NEKEKNNKGMFFTDRVRRIDFVLVYQQLLDSEE-KRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIRKSIMNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQGYTYPFSKQK--YYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYKK---ENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISERN---NITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDE--PLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGI------------TVTKTIIRNLLRLQLTYVMSKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGSDSF----SMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLG--GFVDFSLSFMNTTEFNISSSI-----------SNETHCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELEE 2839
            +++ ++   ++F D  RRIDFVL Y +  D E+ K+ +R  + E++   GLE+E++                 D    E     F+KIHA W+ L  YA+++KI+       +  N        +      F    + +  ++P    +T PF K K  ++L D   ++   F P  R+ IV YIL R  Y  +                + I+ DKR                    GI +L++   + +AF LH+     K +    E+ R  LY++WA     ++ QPL+ IR Y+GE +  YFAWLGFYT  LF  AL G+   IY  AT    I  +EI + +    I MCP+   +  C  WKL++     +   L DN ATV  A  + +WV LFLE W+R+Q  L + W++ D E E +   LRPEY     K    + NK++ + EP+     +      L+ +T+LF I L +A + G+            +V K    N + L  + +  +L+T+   S I+ + I+IL   Y RVA+W+TD+E  +T  +Y+N +T K+++ +F+N YSS FY+ F        PG  ++    S ++ + C  G CL++L+ QL+ ++ GKQ+  NI    +P L    K +   R      K RS      + +E                          QD  L +     LF EYLEM+IQFGFIT+F+  FPLAPLLA++NN++E+R DA K  T +RRPVA +   IG W +IL  IA   V +NA ++AF +  I R++Y+  +    +L   G+V+ SLS  N ++ +  ++            S  T C Y  +RYPP   H    S+T  FW +LAAK+AF+ + E  V +   +   +IP++P + +  +KRE  +  E++   E+++
Sbjct:   47 DKQHQSKDSVYFRDGKRRIDFVLSYIE--DKEDRKQERRKLYEENMQKAGLELELE-----------------DKTESEDGKTYFLKIHAPWEVLATYADVLKIKVPFKVNDIPEN-------REIPVSWLFTPLLLPDHVMRPDPDYFTSPFDKSKDDFFLID---DKETLFPPSTRNRIVYYILSRCFYNRD----------------DNINKDKR--------------------GIKRLLNNGTYTSAFPLHDCRYWTKSRDTHCESERYSLYRYWARFFRFYKEQPLNLIRKYYGEKIGIYFAWLGFYTEMLFYAALVGLICFIYGAATYDDVIWTKEICDDDIGGQIVMCPL--CDKKCGFWKLNSTCNSTWQSHLFDNTATVFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQLRPEYET---KCTSRRRNKVTQEMEPYFPV-TSKCARACLSGATVLFWISLIIASIIGVIAYRLAVFAALASVMKDSPTNKMELVGSLITPQLATSVTASCINFVIIMILNFFYERVAIWITDMEVPKTHLEYENKLTIKMFLFQFVNYYSSCFYVAFFKGKFVGYPGKYTYMFNGSGLRNEECDPGGCLIELTTQLVIVMTGKQVWGNIQEALLPWL----KNWWSSR------KARSHPESLYSRWE--------------------------QDYDLQNFSQFGLFYEYLEMVIQFGFITLFVASFPLAPLLALMNNILEVRVDAWKLTTQFRRPVAAKAHSIGAWDEILNMIAVFSVVTNAFIVAFTSDMIPRLVYLYAYHPGTELTMQGYVNNSLSIFNISQLHSDNTPDPGENPAWFNNSVITTCRYRDYRYPP--GHEYEYSHTMQFWHILAAKMAFIIIMEHVVFVVKFLVAWLIPDVPSDVQARVKRERYLVQEYLHNYEVDK 879          
BLAST of Anoctamin vs. Ensembl Cavefish
Match: ano5a (anoctamin 5 [Source:NCBI gene;Acc:103044829])

HSP 1 Score: 367.851 bits (943), Expect = 1.868e-111
Identity = 292/950 (30.74%), Postives = 464/950 (48.84%), Query Frame = 2
Query:  110 FYQQQTLNNEKEKNNKGMFFTDRVRRIDFVLVYQQLLDSEE-KRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIRKSIMNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQGYTYPFSKQK--YYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYKK---ENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISERN---NITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDE--PLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGI------------TVTKTIIRNLLRLQLTYVMSKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGSDSF----SMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLG--GFVDFSLSFMNTTEFNISSSI-----------SNETHCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELEE 2839
            F + ++  +++ ++   ++F D  RRIDFVL Y +  D E+ K+ +R  + E++   GLE+E++                 D    E     F+KIHA W+ L  YA+++KI+       +  N        +      F    + +  ++P    +T PF K K  ++L D   ++   F P  R+ IV YIL R  Y  +                + I+ DKR                    GI +L++   + +AF LH+     K +    E+ R  LY++WA     ++ QPL+ IR Y+GE +  YFAWLGFYT  LF  AL G+   IY  AT    I  +EI + +    I MCP+   +  C  WKL++     +   L DN ATV  A  + +WV LFLE W+R+Q  L + W++ D E E +   LRPEY     K    + NK++ + EP+     +      L+ +T+LF I L +A + G+            +V K    N + L  + +  +L+T+   S I+ + I+IL   Y RVA+W+TD+E  +T  +Y+N +T K+++ +F+N YSS FY+ F        PG  ++    S ++ + C  G CL++L+ QL+ ++ GKQ+  NI    +P L    K +   R      K RS      + +E                          QD  L +     LF EYLEM+IQFGFIT+F+  FPLAPLLA++NN++E+R DA K  T +RRPVA +   IG W +IL  IA   V +NA ++AF +  I R++Y+  +    +L   G+V+ SLS  N ++ +  ++            S  T C Y  +RYPP   H    S+T  FW +LAAK+AF+ + E  V +   +   +IP++P + +  +KRE  +  E++   E+++
Sbjct:   53 FLKYRSRVDKQHQSKDSVYFRDGKRRIDFVLSYIE--DKEDRKQERRKLYEENMQKAGLELELE-----------------DKTESEDGKTYFLKIHAPWEVLATYADVLKIKVPFKVNDIPEN-------REIPVSWLFTPLLLPDHVMRPDPDYFTSPFDKSKDDFFLID---DKETLFPPSTRNRIVYYILSRCFYNRD----------------DNINKDKR--------------------GIKRLLNNGTYTSAFPLHDCRYWTKSRDTHCESERYSLYRYWARFFRFYKEQPLNLIRKYYGEKIGIYFAWLGFYTEMLFYAALVGLICFIYGAATYDDVIWTKEICDDDIGGQIVMCPL--CDKKCGFWKLNSTCNSTWQSHLFDNTATVFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQLRPEYET---KCTSRRRNKVTQEMEPYFPV-TSKCARACLSGATVLFWISLIIASIIGVIAYRLAVFAALASVMKDSPTNKMELVGSLITPQLATSVTASCINFVIIMILNFFYERVAIWITDMEVPKTHLEYENKLTIKMFLFQFVNYYSSCFYVAFFKGKFVGYPGKYTYMFNGSGLRNEECDPGGCLIELTTQLVIVMTGKQVWGNIQEALLPWL----KNWWSSR------KARSHPESLYSRWE--------------------------QDYDLQNFSQFGLFYEYLEMVIQFGFITLFVASFPLAPLLALMNNILEVRVDAWKLTTQFRRPVAAKAHSIGAWDEILNMIAVFSVVTNAFIVAFTSDMIPRLVYLYAYHPGTELTMQGYVNNSLSIFNISQLHSDNTPDPGENPAWFNNSVITTCRYRDYRYPP--GHEYEYSHTMQFWHILAAKMAFIIIMEHVVFVVKFLVAWLIPDVPSDVQARVKRERYLVQEYLHNYEVDK 893          
BLAST of Anoctamin vs. Ensembl Sea Lamprey
Match: ano11 (anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245])

HSP 1 Score: 327.405 bits (838), Expect = 1.690e-98
Identity = 236/682 (34.60%), Postives = 377/682 (55.28%), Query Frame = 2
Query:  839 GIAKLISEKVFETAFILHEKFSNGKY---KKENM--RVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAW-LGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISER-NNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRNLLRLQL-----TYVMSKLSTAA--IGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGS-DSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLGGFVDFSLSFMNTTEFNISSSISNETHCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELEE 2839
            G+ +++ + +F  AF LHE   +G Y     E M  R +LYK+WA     F++QPLDHIR YFGE +AFYFAW LGFYT WL P AL G+ V      T+  D  ++EI E  ++  MCP+ C   +C+ W LS       +  + D   T+  +  +S+W   FLE W+RK  +L + W    +  E+ P RPEYAAL     + + N I+G++EP+ S  ++    + +T S +LF   L ++ +    VT  + + LL + +      ++ ++ +  A   G+L+ L+ I+I+  +Y+ +A +LT  E HRTQS+++N++T K++I + +N YSS  Y+GF        PG+  +    + + C  G CL++L+ QL  I+VGKQI++N+    +P     I+++R +R                   ++ E+          G +L  EL I   D  L       LF EYLEM++QFGFITIF++ FPLAPL A++NN +EIR DA+KFV  YRR V +RV+ IG+W DIL+ +A I + SNA LIAF + ++ R++Y   +  + D  G+VDF+L++           ++N T C Y  FR       ++  + T  +W++LA +++FV +FE  V L  +    +I ++  + ++ +KRE     E++ K  L E
Sbjct:  166 GLDRMLRDHIFSAAFPLHEGSYDGTYLGLAPEQMTRRQVLYKYWARWGCWFKYQPLDHIREYFGEKIAFYFAWLLGFYTCWLLPPALVGLVVFFVGWLTLHNDSTVKEICENGSHYQMCPL-C--DTCKVWNLSNTCNMAKMGHIFDYPGTIFYSIFISLWSVSFLEYWKRKSSSLTYHWGCTLVHEEERP-RPEYAALAP---LIRENPITGEKEPYFS--EDDRTPRTVTGSIVLF---LMISVVLIFLVTVILYQALLSISIFKTGNWFLATQATNIANMTGTLVFLVLIVIMARLYTTIADYLTRWEMHRTQSEHENALTVKVFIFQLVNYYSSPVYVGFFKGKFNGYPGNYGNLFGTRNENCPQGGCLIELAQQLFIIMVGKQILNNLQELILP----IIQQWRQRR-------------------KLDEIR---------GKRLVQELNIWEDDYELL--HNTGLFDEYLEMVMQFGFITIFVMAFPLAPLFALMNNWVEIRLDARKFVCRYRRSVVERVRGIGVWFDILSGLAHISIISNAFLIAFTSDFLPRLLYRYTYKSSLD--GYVDFTLAYAPR-----DYVVANHTMCRYRDFR-------DQDGNLTLFYWKLLAVRLSFVIIFEHLVFLVARAIDWLIVDVAPDLKVKIKRE-----EYLAKQALSE 782          
BLAST of Anoctamin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000399.1 (pep scaffold:Pmarinus_7.0:GL477564:2673:43187:-1 gene:ENSPMAG00000000358.1 transcript:ENSPMAT00000000399.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 296.975 bits (759), Expect = 2.183e-87
Identity = 257/871 (29.51%), Postives = 414/871 (47.53%), Query Frame = 2
Query:  173 DRVRRIDFVLVYQ----------------------------QLLDSEEKRNKRI-SFIESLIDEGLE--------IEIQNIGGRI---INIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIRKSI-------MNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYKKENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISE-RNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEY-AALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRNLLRLQLT--YVMSKLST--AAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGSDSFSMIKP----QGCLTGDCLLDLSMQLIFILVGKQII-SNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPT--ITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLGGFVDFSLSFMNTTEFNISSSI-SNETHCSY 2602
            D  RR+DFVL Y                             + L++E++  KR  S   S+++EG E        +E + +  R     N+ D+  E   D   +++   +++IHA W  L R AE +KI+           ++GV +  +                 ++  K+L       ++PFS+ K  LFDI    S FF    RS IV  ILKR                                        V+        GI  LI+  V+ +AF LH+   +G   + N R LL+  WA+    +++QPL+ I+ YFGE +  YFAWLG YT  L P ++ G+ V +Y      +DI   E      NITMCP    +  C+  +LS    +     L DN  TV+ +  +++W   FLE W+R +  L + W+++ +E  ++ LRPEY A LLEK           + E +   W++ LP  ++  S ILF ++L+ A + G+   + I  N+L    T  Y+ S  S    A   LI+L+ I+IL  +Y  +A WLT +E  +T+ +++  +  K ++L+F+N+Y+S+ Y+ F        P    +  I P    + C  G CL +L++QL  I++GKQ++ +N+    IP++          +   +++ ++  H+    + + +  E+ C D                 Y+    +   P     EY+EM+IQFGF+T+F+  FPLAP  A++NN++EIR D KKFVT  RRP A R KDIG W  IL  +AK+ V  NAL+IA  + ++ R+IY+  +S +  L G+V+++LS+ N +++     I SN T C Y
Sbjct:    8 DGKRRVDFVLAYHFKRHRSFPGSPTSEENTATTLEVITAPAEKLETEDELTKRTRSRKTSVLEEGRETGLSSHHLLEKEQMICREEFEQNLMDARLELEWDEEDQAEGHGYLRIHAPWLVLIREAEFLKIKMPTKKVFEMKQSSGVLHG-LGARINHALQPNVPHSQEALSQKKL-------SFPFSRDKQKLFDIKSEDS-FFDSATRSRIVFEILKR----------------------------------------VKCTKGPYKMGITSLIANGVYTSAFPLHDGELHGS--EVNDRKLLHDEWASYNKFYKYQPLELIKKYFGEKIGLYFAWLGVYTQMLIPPSVVGIAVFLYGWLAAEKDIPGFETCVIGQNITMCPT--CDKLCKYKRLSENCDRVRSSHLFDNITTVLFSIFMALWATTFLEHWKRIETRLNYTWDLNGMEESEQQLRPEYEAKLLEKKRKVDIKLAKTQTEEYGLSWRDQLPSFLINCSCILFMVLLSFAIVVGMIFYR-ITMNVLLANSTDPYLKSNRSAIIMATAFLINLVIILILDEIYGSIARWLTVIEVPKTEEEFETRLIFKSFMLKFVNSYTSIIYVAFLKGRITGYP--KKYYYILPNYRMEECAPGGCLQELALQLCIIMLGKQLLQNNLFEVGIPKI----------KKLCRYLHKKDHHKKASHLKEEDGMELGCKD-----------------YELEPFTGLNP-----EYMEMVIQFGFVTLFVASFPLAPFFALLNNVIEIRLDGKKFVTELRRPTAVRAKDIGTWYVILNGVAKLAVIINALVIALTSDFVPRLIYMYFYSPDGSLRGYVNYTLSYFNVSDYAPGIIIESNYTLCRY 790          
BLAST of Anoctamin vs. Ensembl Sea Lamprey
Match: ano3 (anoctamin 3 [Source:ZFIN;Acc:ZDB-GENE-111031-3])

HSP 1 Score: 207.608 bits (527), Expect = 3.957e-58
Identity = 176/527 (33.40%), Postives = 277/527 (52.56%), Query Frame = 2
Query: 1307 LFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRNLLRL-QLTYV--MSKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPG--SDSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYI--------IVHSRNFDLGGFVDFSLSFMNTTEFNISSSISNETHCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELEEHRN 2848
            +FLE W+R++  LA+ W++ D E E+E +RP++ A   +    + N ISGK EP+ SF  +     +++ S I   I L +  + G+ V + ++ ++    +L +V   S+  TA  G  I+ + I++L  +Y +VAV+LT+LE  RT+++++NS T K+++ +F+N  SS+FY+ F        PG     F + + + C    CL+DL MQ+  I+V KQ  +N +    P L             + + K++  H    T+             D   +  Q E     QD  L       LF EYLEMI+QFGF TIF+  FPLAPLLA++NN++EIR DA KFVT +RR +A R KDIG+W  IL  I  + V +NA +IA  + +I R++Y         +  S    L G+V+ SLS  N + +        + +C Y  +R  P     EP  +T  FW +LAA++AF+ +FE  V     I   +IP+IP   +  M RE  +  E + + +L+  R 
Sbjct:    9 VFLEFWKRRKSELAYEWDLLDWEEEEEEIRPQFEAKYSQK--ERLNAISGKPEPYQSF-HDKCSRLVVSASGIFLMICLVIVAVFGVVVYRVVMLSVFTTSELVFVRSYSQFFTAGTGVCINFVIIMLLNMIYEKVAVFLTNLEQCRTEAEWENSFTLKMFLFQFVNLNSSIFYVAFFLGRFTGHPGKYEKLFHIWRLEECHPSGCLIDLCMQMGIIMVLKQTWNNFMELGFPLL------------QNWWAKKKLQHEMETTE-------------DDMALLPQWE-----QDYSLQQINTYGLFDEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRSLACRAKDIGVWYGILEGIGVVSVITNAFVIAVTSDFIPRLVYFYQYGPCARMRESERDCLEGYVNSSLSVFNPSTY----CQIIKCYCIYRDYREAPSTHREEPYKFTLQFWHVLAARLAFIIVFEHLVYFIKLIIAYMIPDIPKGLKERMHREKFLVQEMVHEADLDALRK 498          
BLAST of Anoctamin vs. Ensembl Sea Lamprey
Match: ano11 (anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245])

HSP 1 Score: 202.986 bits (515), Expect = 1.286e-57
Identity = 130/377 (34.48%), Postives = 210/377 (55.70%), Query Frame = 2
Query: 1691 VYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGS-DSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEM--IIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLGGFVDFSLSFMNTTEFNISSSISNETHCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNE 2812
            VYS +A  LT  E HRTQ+QY+++ T K+++ +F+N YSS FY+ F        PG        + + C  G CL++L+ QLI I+VGKQ+I+NI  F  P           +R    ++++R          +++ +  S +  + +  +   EL  C             LF+EYLEM  ++QFGFITIF+  FPLAPL A++NN +E+R DA+KFV  YRRPVA+R +DIG+W +IL  +  I V  NA LIAF ++++ +++Y   + RN  L G+++F+LS+           ++N THC Y  +R       ++   +T  +W++LA ++ F+  FE  V    ++   ++P++P+   I MKRE  +  +
Sbjct:   59 VYSSLAEQLTKWEMHRTQTQYEDAFTFKVFVFQFVNFYSSPFYVAFFKGRFVGYPGHYKKLLGTRNEDCGPGGCLIELAQQLIIIMVGKQVINNIQEFVFPLTLPPPAPRSCRRKIKAWLQKR----------KLAALRGSHVAPESSRWEEDYELIPC-----------EGLFEEYLEMGPVLQFGFITIFVAAFPLAPLFALLNNWVELRLDAQKFVCEYRRPVAERAQDIGVWFNILDALVNISVIINAFLIAFTSNFLPKLLYQYTYDRN--LRGYINFTLSYAPD-----DYVVNNYTHCRYKDYR-------DQDGKHTLFYWKLLAIRLGFIIAFEHVVFFISRMIDWLVPDVPESLEIKMKRERYLAKQ 400          
BLAST of Anoctamin vs. Ensembl Sea Lamprey
Match: ano11 (anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245])

HSP 1 Score: 201.06 bits (510), Expect = 6.837e-57
Identity = 130/377 (34.48%), Postives = 207/377 (54.91%), Query Frame = 2
Query: 1691 VYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGS-DSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEM--IIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLGGFVDFSLSFMNTTEFNISSSISNETHCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNE 2812
            VYS +A  LT  E HRTQ+QY+++ T K+++ +F+N YSS FY+ F        PG        + + C  G CL++L+ QLI I+VGKQ+I+NI  F  P++ + +++ ++       +   S       DYE+           C G                       LF+EYLEM  ++QFGFITIF+  FPLAPL A++NN +E+R DA+KFV  YRRPVA+R +DIG+W +IL  +  I V  NA LIAF ++++ +++Y   + RN  L G+++F+LS+           ++N THC Y  +R       ++   +T  +W++LA ++ F+  FE  V    ++   ++P++P+   I MKRE  +  +
Sbjct:   64 VYSSLAEQLTKWEMHRTQTQYEDAFTFKVFVFQFVNFYSSPFYVAFFKGRFVGYPGHYKKLLGTRNEDCGPGGCLIELAQQLIIIMVGKQVINNIQEFVFPKIKAWLQKRKLAALRGSHVAPESSRWEE--DYEL---------IPCEG-----------------------LFEEYLEMGPVLQFGFITIFVAAFPLAPLFALLNNWVELRLDAQKFVCEYRRPVAERAQDIGVWFNILDALVNISVIINAFLIAFTSNFLPKLLYQYTYDRN--LRGYINFTLSYAPD-----DYVVNNYTHCRYKDYR-------DQDGKHTLFYWKLLAIRLGFIIAFEHVVFFISRMIDWLVPDVPESLEIKMKRERYLAKQ 392          
BLAST of Anoctamin vs. Ensembl Nematostella
Match: EDO49855 (Anoctamin [Source:UniProtKB/TrEMBL;Acc:A7REV0])

HSP 1 Score: 347.821 bits (891), Expect = 8.076e-106
Identity = 281/873 (32.19%), Postives = 425/873 (48.68%), Query Frame = 2
Query:  320 NIADSVNENSDDITCESK-NLVFVKIHASWDTLCRYAEIMKIRKSIMNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEK--FSNGKYKKENMRV--LLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATI--PRDIIIQEISERNNIT--MCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIV-LTLACLTGITVTKTII-RNLLRLQLTYVMSKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGS-DSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSK-FIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLGGFVDFSLSFM--NTTEFNISSSISNETHCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELEEHRNIYEANNLAKSLKKTI 2893
            N+A S  E  ++IT + K  L F+KIH  W+ L  YAE +  R   +  G++    +     +           + N    P    +T  F   K   F    +   +FT VER+ +   IL+   Y    +                               E+         GI +L+ E VF+  + LH     +   Y    + V  +L ++W       ++QPLDHIR YFGE +  YFAWLG YT WL   +  G+ V +Y +ATI    +    E+ +    T  MCP+   E  C+ W L        +  L DN +TV  A  VS W   FLE W+RK+ TLA+ W+V + E E E  RP +AAL       + N ++G  EP   F       ++ +   I+F++V L L  + G+ V K ++ R L R   T   +     + G+ ++L  I+IL+ VY RVA+ LT  E HRTQ++Y++S+T K+++ +F N YSS+FY+ F        PG       ++ + C  G CL++L+ QL+ I+VGKQ+I+N+   +IP +   IK  R KR  SK  IK R        D+E+ E E                                 LF+EYLEMI+QFGFITIF+  FPLAP  A+ NN+ EIR D+ KFV   RRP+A R +DIGIW +IL ++AKI V SNA LIAF ++++ +++Y    S NF L G+ +++L++   NTT             C Y  FR P  + H     +T  +W +LA ++ FV +FE  V   +++  M++P+IP E  I +KREA     ++ K  L +H N+  +    + ++  +
Sbjct:   27 NLAKSQLEFEEEITQDKKVKLHFIKIHVPWEVLLFYAEELSFRAP-LEVGLNTKVNWSERMLEKFHMPNIFKEEVPN----PPPDFFTCTFQANKLNKFIGSDDPDSYFTDVERTRVAYEILETAPYGKRQR------------------------------GEI---------GIERLVEEGVFKAGYPLHVNCYLNQQGYSPFLIYVSQVLKEYWGRWGKWLKYQPLDHIRDYFGEKIGIYFAWLGQYTAWLIMPSFLGLLVFLYGVATINSSDNKPALEVCDNPPWTFRMCPLCDEELGCQYWDLHISCKSGKIAYLFDNASTVFFAVFVSFWSCFFLEYWKRKEVTLAYHWDVLEYEEEAERPRPTFAALAP---TVERNPVTGILEP--HFPDEKRKPRLFSGIAIVFTMVSLVLVFMVGVIVYKLLVYRPLARNPSTRAYALQIANSTGAFVNLTIIMILSRVYERVALALTHWEMHRTQTEYEDSLTFKVFVFQFANFYSSIFYVAFFKGKLVGYPGHYRRLFGLRQEECSPGGCLMELAQQLVIIMVGKQMINNVQEIAIPLVKQWIK--RKKRGTSKDEIKPRWEQ-----DFELVENEG--------------------------------LFQEYLEMILQFGFITIFVAAFPLAPFFALANNIFEIRIDSDKFVCEVRRPIADRAQDIGIWFNILDSVAKIAVISNAFLIAFTSTFLPKLLYRYAVSENFSLEGYTNYTLAWAPRNTT----------LKPCRYQEFRDP--EGH-----FTVFYWHLLALRLGFVIMFEHVVFFVMRLIDMMVPDIPTELEIIIKREA-----YLAKQALADHHNLMGSGESGEEVEDEL 789          
BLAST of Anoctamin vs. Ensembl Nematostella
Match: EDO49854 (Anoctamin [Source:UniProtKB/TrEMBL;Acc:A7REU8])

HSP 1 Score: 314.309 bits (804), Expect = 3.435e-94
Identity = 235/684 (34.36%), Postives = 351/684 (51.32%), Query Frame = 2
Query:  839 GIAKLISEKVFETAFILHEKFSNGKYKKENMRVLLYKHWATLTNIFRHQPLDHIRLYF-----GEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATI--PRDIIIQEISERNNIT--MCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTK-TIIRNLLRLQLTYVMSKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGS-DSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLGGFVDFSLSFM--NTTEFNISSSISNETHCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELEEHRNI 2851
            GI++L+ E  +  A+ LH         K NMR +L ++WA     +++QPLDHIR  +     G  +A YFAWLG YT WL   ++ G+ V IY+ ATI  P ++   E+ +    T  MCP    E  C  W L     +     L DN  TV  +  VS W  LFLE W+RK+ T+   W+V + E E+E  RP +AAL       + N I+G  EP+    K + P  +  I+ I   + L +  + G+ V K  +I  L +       +    +  G++++LI I+IL+ VY ++A+ L   E HRTQ++Y++++T K++I +F N YSS+FYI F        PG+  +   ++ + C  G CL++L+ QL  I++GKQ+I NI    IP L   +K    KR +SK                           D + +K + E      DN         LF+EYLEM+IQ+GFIT+F+  FPLAP  A+ NN+ EIR DA KFV   RR  A R +DIG+W  IL +I K+ V SNA LIAF + ++ +++Y  V S N  L G++++SL++   NTT             C Y GFR       +E  ++T  FW +L  ++ FV LFE FV     +  + +P+IP      +KRE  +  +      L EH  +
Sbjct:   72 GISRLVDEGTYSAAYPLHVGPHGPDEMKLNMRQVLKEYWARWGAWYKYQPLDHIRQAYEREGGGLKIAIYFAWLGQYTAWLIMPSVVGLIVFIYSFATINGPNNMPALEMCDHPAWTYPMCP--NCEVGCSVWDLKKSCSRAKHAYLFDNPMTVAYSIFVSFWAVLFLEFWKRKEVTIGHAWDVLEFESEEERPRPTFAALAPA---VERNPITGLLEPYFPDEKRS-PRVLSGIAIICGMVSLVMLFMVGVIVYKLLVIHPLYKNPNLQPYANQFASGTGAVLNLIIIMILSRVYEKLALLLNHWEMHRTQTEYEDNLTLKVFIFQFTNFYSSIFYIAFFKGKFVGYPGNYGTIFGLRNEECSPGGCLIELAQQLAVIMIGKQVIGNIQEVFIPELKKYLKNR--KRQNSK---------------------------DEDEIKPRWEADYELLDN-------EGLFQEYLEMVIQYGFITLFVAAFPLAPFFALANNVFEIRIDADKFVNDLRRSTADRAQDIGVWFTILDSITKLAVISNAFLIAFTSEFLPKLLYAGVVSPNQSLEGYLNYSLAWAPPNTT----------SQPCRYRGFR-------DEDGNFTRFFWHLLTMRLVFVILFEHFVFGISTLIDVAVPDIPRALEDTIKREKYVATQ-----ALAEHHGL 691          
BLAST of Anoctamin vs. Ensembl Nematostella
Match: EDO48050 (Anoctamin [Source:UniProtKB/TrEMBL;Acc:A7RKU9])

HSP 1 Score: 314.309 bits (804), Expect = 2.398e-93
Identity = 260/902 (28.82%), Postives = 436/902 (48.34%), Query Frame = 2
Query:  218 LDSEEKR------NKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIRKSIMNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRK----GYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILH---EKFSNGKYKKENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISER---NNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEY---AALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTK-TIIRNLLRLQLTYV--MSKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVK-PGS-DSFSM-IKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLGGFVDFSLSFMNTTEF--------------NISSSISNET--HCSYIGFRYP--PWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKRE 2794
            L +E+K       +KR  + E+L   GLE+E               +E  D+   + +   FVKIH  WD L   AE M ++  I ++ ++                   + SI ++    I      P  KQ              F    R +I N  L++K    GY   +   S               + +RS   + I ++        + GI +LI +  +  A+ LH   E+ S  K    N R  L + WA     F++QP D I+ YFG  +  YFAWLGFY   L P A+FGV V IY +A       +++I  +       MCP+   +  C  W L         +   DN +TV+ A  +S+W  +FLE W+R+Q  LA+ W++   E ++E  RPE+      L+K+  SQ+  +     P +  ++    +    +S + F I L L+ + G+ + + ++  +L+      V   +K++T+   ++++LI I +L  VY ++A++LT+ E+ RT++ + +S T K+Y+ +F+NNY+S+FYI F      +  PG+   F+   +  GC +G CL+DL +QL+ I+VG+QII NI   +IP L   +K +++++A  +  +        I  +E+                        Y+ N L  PE   LF EYLE+++QFGF+T+F+  FPLAPL A++N + E+R DA  FV  +RRP  +R +DIG WM I+  +A I V  NA +IAF + +I R++Y   +S +  L G+++ SLS+ N  ++              N + ++ N T  +C Y G+  P  P++V  +       +W ++AA++AFV+ F+  V    K    ++P+ P    + +KR+
Sbjct:    8 LSAEQKETENSHADKRRVYEENLKKAGLELE---------------HEEGDN---KKRKTHFVKIHTPWDVLAATAEEMMMKSPIRDSDIE------IKSWSEKHLSEEFVTSIRSRDPLKIHDSCITPPKKQ--------------FVAYFRKVINNPRLQKKQFFVGYHDKNTFFS---------------AAERSRMTERICSQQRFGEERFDQGIKRLIHQGTYTAAYPLHSGPEEVSR-KGHPSNERQKLRRDWARFGRWFKYQPYDAIKDYFGTEIGLYFAWLGFYAAMLVPAAIFGVAVFIYGIAQSTIFPPVKDICNKAYEAEFYMCPL--CDKQCPYWSLVVNCPYAIWVHAFDNDSTVVFAIFMSIWATVFLEFWKRRQAVLAYEWHMMHYEDQEEQPRPEFIVTVTTLKKDKASQWGGMV-PHVPKLQQYRKLAGV----VSLVAFMIALVLSAVVGVVIYRASVYGSLMAYPDPQVRKQAKMTTSITAAILNLICINLLKFVYEKLAMFLTEWENPRTETDFKDSFTYKMYLFQFVNNYASIFYIAFFKLNLVIGTPGNYRRFAGEYRLDGCSSGGCLMDLCIQLVIIMVGQQIIGNITEIAIPGL---LKWWKMRQAQKEAFEE-------IPRWEVD-----------------------YKLNTL--PE-HHLFWEYLEVVLQFGFVTMFVAAFPLAPLFALVNAVFELRVDAINFVCQFRRPTPRRAQDIGAWMSIMQGLANISVLVNAFVIAFTSDFIPRLVYTTAYSPDGTLRGYLNNSLSYFNVKDYDRMGAIGAREKPGDNYAYTVLNYTREYCRYPGYHEPEFPYEVSKQ-------YWHVIAARLAFVFAFQYIVYAVTKFVAWLVPDRPRHLELRIKRQ 805          
BLAST of Anoctamin vs. Ensembl Nematostella
Match: EDO48307 (Anoctamin [Source:UniProtKB/TrEMBL;Acc:A7RJQ8])

HSP 1 Score: 295.819 bits (756), Expect = 1.030e-86
Identity = 270/911 (29.64%), Postives = 430/911 (47.20%), Query Frame = 2
Query:  188 IDFVLVYQQ--------LLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIRKSIMNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQGYTYP-------FSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNG--KYKKENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISERNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRNLLRLQL-TYVM------SKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGF---------AHPYTKVKPGSDSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPR-PLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLGGFVDFSLSFMNTTEFNISSSISNETHCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFI 2818
            +DFV+VY++        + D EEK   R +F E LI EGL ++                 ++D    E  N VFV IHA WD L R+AE M +R  +  A                      + S  +K   P + G T         FS+ K   F I  ++ +FF+ ++RS IV  IL+   + S                 EP                        +FGI +L+   V+  A+ LHE  S         N R  L   WA+    +R QPL+ I+ YFG  V FYFAWLG Y   L   AL G+   I  LA++   +  +EI ++ N      + +  SC   K++          L D+  TV  A  +++W  LFLE+W+R+Q +LAF W++ D + E EP RP++   +++    + N I+G  EPF+ + K     Q++  +     ++L +  +    V   + R  +   L +Y        +++ T+   S I+L+ I IL+ VY+ +AV+LT+ E+ RT++QY +++T K+++ + +N YSS+FYI F            YT++  G       + +GC    CL++L +QL  IL GKQ IS II   +P L              ++  RRS  R  +   E+   E                       + L +PEP   +F EY +M++QFGF+T+F+  FPLAPL A++NN++E+R DA  FV   RRPVA+R ++IG W+ IL T+++  +  N+ +IAF + +I R++Y + +S +  L G+V+ SLS  N  +F   S   +          Y  +     P  Y+  F+ +LAA++AFV +F+  V   V +   ++P++P    I MK E  I  + +
Sbjct:    1 VDFVMVYEETKGKDEEEIRDEEEKAEMRRNFEEHLIKEGLLLQ-----------------HTDSDLNEEVNKVFVLIHAPWDVLTRFAEKMLLRFPLREAS--------PPPAAQGFDKIPELISNWSKIFDPPSCGITKEKRFVHGLFSRDKKDSFLIS-DKDKFFSDIDRSRIVARILRLCRFSS-----------------EPD-----------------------DFGIDRLLHRGVYGAAYPLHEGLSTSYPTDSSANHREYLQYSWASFRQWYRFQPLNEIKSYFGTRVGFYFAWLGTYNLMLVIAALVGLFCFIGGLASVESFVPAKEICDKANENY---WSLHTSCRYSKIT---------HLFDHEGTVFFAAFMALWSSLFLEVWKRQQTSLAFEWDMLDFDEELEPARPQFVEAVKER---RPNPITGILEPFVPYAK-----QLIKQTCAFVVVLLMILLVIAAVVGVIVYRAAMSAALHSYPREDVRRGARVITSITASTINLVAITILSYVYNYIAVFLTNWENPRTRTQYTDALTFKMFLFQSVNMYSSLFYIAFFKSAMIVGVPGRYTRIGGG-------RLEGCDPSGCLIELCIQLAIILGGKQAISLIIKIVLPCLW-------------RWWNRRS-QRNLLETGELDRWEL----------------------DYLLNPEPDFRMFYEYHDMVLQFGFVTMFVAAFPLAPLFALLNNILELRIDAINFVVTTRRPVAERARNIGSWLGILQTLSRFAILVNSFVIAFTSEFIPRLVYTVAYSPDGSLNGYVNNSLSSFNVRDFERQSLPQDPFQNLPYNNTYKEYFESTSPYMYSRQFYYVLAARLAFVIIFQYLVIFTVFLINWLVPDVPYSLEIRMKHEKYIAQKML 782          
BLAST of Anoctamin vs. Ensembl Nematostella
Match: EDO48048 (Anoctamin [Source:UniProtKB/TrEMBL;Acc:A7RKU7])

HSP 1 Score: 293.508 bits (750), Expect = 2.688e-85
Identity = 257/900 (28.56%), Postives = 421/900 (46.78%), Query Frame = 2
Query:  242 KRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIRKSIMNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEK----FSNGKYKKENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISERNN-ITMCPVFCIEGSCESWKLSAGYVQFYLI-RLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAA---LLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVL---------------TLACLTGITVTKTIIRNLLRLQLTYVMSKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVK-PGSDS--FSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLG---GFVDFSLSFMNTT---EFNISSSISN--------ETHCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFI 2818
            KR +F  +L ++GL IE ++I           +  +D +        FVK+H  W TL   AE + ++  +    +D                           LK   +            +FD P    +   P +    + Y  +RK      K +     EKM   L+  +  +R      I             G+ +L+ E  +   + LH+          Y   N R  L K W+++  IF++QPLD ++ Y+G  +A YFAWLGFYT  L P+A+ G+ V IY + +      +++  + NN   MCP+   + +C  W L +    +  +    DN  TV LA   SVW  LFLE W+R+Q  LA+ W+V + E E+E +RPE+AA    L+KN       I+GK EP I   + TL  +   I +++  ++L                 A L+G   + + IR   R  +  + S++ T+   +LI+L+ I IL   Y+R+AVWLT+ E+ RT++ Y++S T K+Y+ +F+N Y+S+FYI F      V  PG         + +GC    C L+L +Q++ I+VG+QII NI   +IP + + IKE            R+      +  +E                          QD  L   E   LF EYLE+++Q+GF+T+FI  FPLAPL +++N+++EIR DA  FV+ +RRP     +DIG W  IL T+ ++ V  NA +++F + +I +++Y + ++     G   G+++ SLS +N T   E+   ++  N        ET C Y G+       +  P  +   +W ++AA++AFV++F+  V          +P+ P    +  KRE  +T + +
Sbjct:   53 KRDAFEAALSEQGLVIERESI----------TSPQNDKVKRH-----FVKLHVPWRTLSSKAEELMLKAPLQENDID---------------------------LKTTGEK-----------IFD-PFRIKDSSIPEKPKCFMAYFKERK----VDKYMGKAEPEKMFTALDRHYVVQR------ICYATRFAEGPKGVGLKQLVYEGAYCANYPLHDGDDDVIGESSYP-SNDRQRLKKDWSSMKRIFKYQPLDTVKGYYGTAIALYFAWLGFYTAMLIPLAIVGLLVFIYGIGSSATSPTVRDACDTNNKFYMCPL--CDRTCSYWDLVSTTCMYARVTHFFDNDGTVFLAIFTSVWATLFLEFWKRRQAVLAYEWHVANFEEEEEQIRPEFAATAPTLKKNI------ITGKLEPHIP--RRTLYQRYGAIGSVVAFMILLVIAAVIGVVVYRAAVFAALSG--NSDSTIR--ARYAMIAIGSRIITSMTAALINLLCINILKLFYNRLAVWLTNWENPRTKTDYEDSFTYKMYLFQFVNTYASIFYIAFFKSEIVVGTPGRYKRIAGKYRLEGCSAQGCFLELCVQMLIIMVGQQIIGNITEVAIPAIMTWIKE------------RKEPKNKQLPQFE--------------------------QDYNLQPQEEHNLFWEYLEIVLQYGFVTMFIAAFPLAPLFSLLNSIVEIRVDAINFVSQFRRPDTMIAEDIGAWYRILETLTRLSVLINAFVLSFTSEFIPKLVYKLKYAPEGSEGTLEGYLNNSLSAINVTVMEEWEPGTAPLNPTKNLNYTETFCRYKGYH-----DNTYPFKFNKQYWHVIAARLAFVFVFQYTVYAITSFIAWAVPDQPRSLELRSKREEHLTKKIL 830          
BLAST of Anoctamin vs. Ensembl Medaka
Match: ano3 (anoctamin 3 [Source:NCBI gene;Acc:101164148])

HSP 1 Score: 408.297 bits (1048), Expect = 4.226e-126
Identity = 309/939 (32.91%), Postives = 465/939 (49.52%), Query Frame = 2
Query:  125 TLNNEKEKNNKGMFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIRKSIM---------NAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQG--YTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYKK---------ENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISERNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTI-IRNLLRLQLTYVMSKL--STAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPG--SDSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYII---------VHSRNFDLGGFVDFSLSFMNTTEFNISSSISNETHCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELEE 2839
            +L  +   N+ G+FF D  +RID++LVY++   S  +  KR +F ++L  EGL +E ++          S+  N         +++ VK+HASWDTLC+YAE M IR             + G+   +      ++  ++       +D + L  + +   YT PFS+ + + F I  NR  FF+   RS IV+++L+R  Y                                       E+G +   GI +L+    +E AF  HE    G YK          +N R LLY+ WA     +++QPLD IR YFGE +  YFAWLG+YT  L P AL GV V +Y L T+    + +EI E N   MCP+   E +CE W LS   V   +  L DNG TV  A  +++W  +FLE W+R++  L + W++ D E E+E LRP++ A   +    + N ISGK EPF  F  + L   M+++S I F I L L  +  + V + I +      +  +V   L  +T+  G  ++ + I+ L  VY +VA  LT+LEH RT+S+++NS   K+++ +F+N  SS FYI F       +PG  S  F+  + + C    CL+DL +Q+  I+  KQI +N +    P L               +  RR + +       +                 +++L    +D  L       L  EYLEM++QFGF TIF+  FPLAPLLA++NN++EIR DA KFVT +RRP+  R  DIGIW  IL  I  + V +NA +IA  + YI R +Y            H  N  L G+V+ SLS  +  E N +SS+S   +C Y  +R PPW   + P  +T  FW +LAA++AF+ +FE  V         +IP++P +    M+RE  +  E + + ELE 
Sbjct:  124 SLQEKDPSNSSGLFFRDGKKRIDYILVYKK---SSPQVEKRCTFEKNLRAEGLMLEKEH----------SLTNN---------DIMLVKVHASWDTLCKYAERMNIRMPFRKKCYFSDKRSKGLGSRF--HLRCQQIKNWFPKNPMKLDKEALPDLEESDCYTAPFSRARMHHFTI-SNRETFFSNSTRSRIVHHVLQRTKY---------------------------------------EDGKS-KMGINRLLGNNTYEAAFPPHE----GGYKSRHPIKTHGPQNHRHLLYERWARWGIWYKYQPLDLIRRYFGEKIGLYFAWLGWYTGMLIPAALVGVFVFLYGLFTMDSSQVSKEICEANTTIMCPM--CEETCEPWTLSDSCVYAKVTHLFDNGGTVFFAIFMAIWATVFLEFWKRRRAELTYDWDLIDWEEEEEELRPQFEAKYSRK--ERVNPISGKPEPFQPF-SDKLSRLMVSVSGIFFMISLVLTAVFAVVVFRLIAMEKFASFRWHFVKKNLQFATSGTGVCLNFMIIMSLNVVYEKVAYLLTNLEHPRTESEWENSFALKMFLFQFVNLNSSTFYIAFFLGRFAGRPGKYSKLFNRWRLEECHPSGCLIDLCLQMGVIMFFKQIWNNFMELGYPLL-------------QNWWSRRKIKKGGGGGQNV-----------------ETQLPQWDKDWNLQPMNAHGLVDEYLEMVLQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPMPARATDIGIWHGILEGIGVLAVITNAFVIAITSDYIPRFVYAFKYGPCMDKGQHHENECLQGYVNSSLSVFDMWEVN-NSSMSR--YCRYRDYRAPPWS--SVPYKFTLQFWHVLAARLAFIIVFEHLVFGIKSFIAYLIPDMPKDLCDRMRREKYLMQEMMYEAELEH 953          
BLAST of Anoctamin vs. Ensembl Medaka
Match: ano5b (anoctamin-5 [Source:NCBI gene;Acc:101167353])

HSP 1 Score: 397.512 bits (1020), Expect = 8.266e-123
Identity = 294/942 (31.21%), Postives = 475/942 (50.42%), Query Frame = 2
Query:  101 ERSFYQQQTLNNEKEKNNKGMFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIRKSIMNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYKK---ENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISERN---NITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPL--RPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTK--------TIIRNLLR-LQLT--YVMSKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGSDSFSM-----IKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLGGFVDFSLSFMNTTEFNISSSI------SNETHCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELE 2836
            ER+        ++ +     +FF D VRRIDFVL Y    D E+K+ +R +F  +L   GL++E ++        +DS ++ +           F+KIHA WD L  YA+++KI+     + + +        +        R F + +  ++P    +TYPF K K   F I  ++  FF P  R+ IV YIL R                       P +++ R +   +              GI +L+S   F  AF LH+     K +K   E+ R  LYKHWA     ++ QPL+ IR Y+GE +  YFAWLGFYT  LF  A+ G+    Y + +   +I  +EI + +   +I MCP+   +  C  WKL++  +  +   L DN  TV  A  + +WV LFLE+W+R+Q  L ++W++ D E E + L  RPE+     K  I   NKI+ + EP++ F         L+ +T+L  I L +AC+ G+   +        +II++ LR +QL   ++  +L+T+   S I+   I+IL   Y +VAVW+TD+E  +T  +Y+N +T K+++ +F+N YSS FY+ F        PG+ S+ +     ++ + C  G CL++L+ QL+ ++ GKQ+  N+    +P +             + +  R+  H P                        ++      QD +L +     LF EYLEM+IQFGFIT+F+  FPLAPLLA+ NN++EIR DA KF T +RRPVA + ++IG W +IL  +A + V +NA ++AF +  I RM+Y+ V S++  + G+V+ SLS  N ++ +  +        ++ T C Y  +R PP   H     +   FW +LAAK+AF+ + E  V +       +IP++P + +  +KRE  +  E++   E+E
Sbjct:   38 ERAQLPGHIETDKLQPTRDTVFFRDGVRRIDFVLSYVDDKD-EKKQERRRAFEANLEKTGLQLETEDK-------SDSKDQKT----------YFLKIHAPWDVLATYADVLKIKVPFRESDIPHG-------QDVPLEWLSRPFRLPDDIIRPQCDYFTYPFDKNKTDFFLIE-DKDTFFPPSTRNRIVFYILARC----------------------PYYAEGRKDWEKT--------------GIKRLLSNGTFNAAFPLHDCRYWKKARKDDGESERYNLYKHWARFLCFYKEQPLNLIRKYYGEKIGIYFAWLGFYTEMLFFAAVMGLICFTYGVLSYDDNISSKEICDPDIGGSIVMCPL--CDKKCPFWKLNSTCLSSWQSHLFDNEGTVFFAIFMGIWVTLFLEIWKRRQARLEYQWDLVDFEEEQQQLQIRPEFEIKCTKRRI---NKITQESEPYLPFSSKCARFS-LSATTVLLWISLIVACIIGVIAYRLAVYAAFASIIKDPLRKIQLVGRFITPQLATSVTASCINFAIIMILNFFYEKVAVWITDMEIPKTHLEYENKLTMKMFLFQFVNYYSSCFYVAFFKGKFVGYPGAYSYMLGNLTKLRNEECDPGGCLIELTTQLVIVMAGKQLWGNVQEALLPLM------------RNWWSSRKGRHNP------------------------ENHYSRWEQDYVLQNFSQLGLFYEYLEMVIQFGFITLFVASFPLAPLLALFNNILEIRVDAWKFTTQFRRPVASKARNIGAWQEILNAVAILSVVTNAFIMAFTSDMIPRMVYLYVLSKDRSMSGYVNSSLSIYNISQIHPQNMPEERWYDNSTTTCRYRDYRNPP--GHQREYDHNMQFWHILAAKMAFIIIMEHVVFVVKFFVAWMIPDVPSDVKARIKRERYLIQEYLHNYEVE 873          
BLAST of Anoctamin vs. Ensembl Medaka
Match: ano5b (anoctamin-5 [Source:NCBI gene;Acc:101167353])

HSP 1 Score: 397.897 bits (1021), Expect = 9.937e-123
Identity = 294/942 (31.21%), Postives = 475/942 (50.42%), Query Frame = 2
Query:  101 ERSFYQQQTLNNEKEKNNKGMFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIRKSIMNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYKK---ENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISERN---NITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPL--RPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTK--------TIIRNLLR-LQLT--YVMSKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGSDSFSM-----IKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLGGFVDFSLSFMNTTEFNISSSI------SNETHCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELE 2836
            ER+        ++ +     +FF D VRRIDFVL Y    D E+K+ +R +F  +L   GL++E ++        +DS ++ +           F+KIHA WD L  YA+++KI+     + + +        +        R F + +  ++P    +TYPF K K   F I  ++  FF P  R+ IV YIL R                       P +++ R +   +              GI +L+S   F  AF LH+     K +K   E+ R  LYKHWA     ++ QPL+ IR Y+GE +  YFAWLGFYT  LF  A+ G+    Y + +   +I  +EI + +   +I MCP+   +  C  WKL++  +  +   L DN  TV  A  + +WV LFLE+W+R+Q  L ++W++ D E E + L  RPE+     K  I   NKI+ + EP++ F         L+ +T+L  I L +AC+ G+   +        +II++ LR +QL   ++  +L+T+   S I+   I+IL   Y +VAVW+TD+E  +T  +Y+N +T K+++ +F+N YSS FY+ F        PG+ S+ +     ++ + C  G CL++L+ QL+ ++ GKQ+  N+    +P +             + +  R+  H P                        ++      QD +L +     LF EYLEM+IQFGFIT+F+  FPLAPLLA+ NN++EIR DA KF T +RRPVA + ++IG W +IL  +A + V +NA ++AF +  I RM+Y+ V S++  + G+V+ SLS  N ++ +  +        ++ T C Y  +R PP   H     +   FW +LAAK+AF+ + E  V +       +IP++P + +  +KRE  +  E++   E+E
Sbjct:   53 ERAQLPGHIETDKLQPTRDTVFFRDGVRRIDFVLSYVDDKD-EKKQERRRAFEANLEKTGLQLETEDK-------SDSKDQKT----------YFLKIHAPWDVLATYADVLKIKVPFRESDIPHG-------QDVPLEWLSRPFRLPDDIIRPQCDYFTYPFDKNKTDFFLIE-DKDTFFPPSTRNRIVFYILARC----------------------PYYAEGRKDWEKT--------------GIKRLLSNGTFNAAFPLHDCRYWKKARKDDGESERYNLYKHWARFLCFYKEQPLNLIRKYYGEKIGIYFAWLGFYTEMLFFAAVMGLICFTYGVLSYDDNISSKEICDPDIGGSIVMCPL--CDKKCPFWKLNSTCLSSWQSHLFDNEGTVFFAIFMGIWVTLFLEIWKRRQARLEYQWDLVDFEEEQQQLQIRPEFEIKCTKRRI---NKITQESEPYLPFSSKCARFS-LSATTVLLWISLIVACIIGVIAYRLAVYAAFASIIKDPLRKIQLVGRFITPQLATSVTASCINFAIIMILNFFYEKVAVWITDMEIPKTHLEYENKLTMKMFLFQFVNYYSSCFYVAFFKGKFVGYPGAYSYMLGNLTKLRNEECDPGGCLIELTTQLVIVMAGKQLWGNVQEALLPLM------------RNWWSSRKGRHNP------------------------ENHYSRWEQDYVLQNFSQLGLFYEYLEMVIQFGFITLFVASFPLAPLLALFNNILEIRVDAWKFTTQFRRPVASKARNIGAWQEILNAVAILSVVTNAFIMAFTSDMIPRMVYLYVLSKDRSMSGYVNSSLSIYNISQIHPQNMPEERWYDNSTTTCRYRDYRNPP--GHQREYDHNMQFWHILAAKMAFIIIMEHVVFVVKFFVAWMIPDVPSDVKARIKRERYLIQEYLHNYEVE 888          
BLAST of Anoctamin vs. Ensembl Medaka
Match: ano3 (anoctamin 3 [Source:NCBI gene;Acc:101164148])

HSP 1 Score: 389.037 bits (998), Expect = 1.490e-119
Identity = 306/939 (32.59%), Postives = 463/939 (49.31%), Query Frame = 2
Query:   92 EILERSFYQQQTLNNEKEKNNKGMFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIRKSIMNAGV--DYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQG--YTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYKK---------ENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISERNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTI-IRNLLRLQLTYVMSKL--STAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPG--SDSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFD-----LGGFVDFSLSFMNTTEFNISSSISNETHCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELEE 2839
            E+   SF+ Q+    +   N+ G+FF D  +RID++LVY++   S  +  KR +F ++L  EGL +E ++          S+  N         +++ VK+HASWDTLC+YAE M IR          D         ++  ++       +D + L  + +   YT PFS+ + + F I  NR  FF+   RS IV+++L+R  Y                                       E+G +   GI +L+    +E AF  HE    G YK          +N R LLY+ WA     +++QPLD IR YFGE +  YFAWLG+YT  L P AL GV V +Y L T+    + +EI E N   MCP+   E +CE W LS   V +  +R   +G  +I +        +FLE W+R++  L + W++ D E E+E LRP++ A   +    + N ISGK EPF  F  + L   M+++S I F I L L  +  + V + I +      +  +V   L  +T+  G  ++ + I+ L  VY +VA  LT+LEH RT+S+++NS   K+++ +F+N  SS FYI F       +PG  S  F+  + + C    CL+DL +Q+  I+  KQI +N +    P L               +  RR + +       +                 +++L    +D  L       L  EYLEM++QFGF TIF+  FPLAPLLA++NN++EIR DA KFVT +RRP+  R  DIGIW  IL  I  + V +NA +IA  + YI R +Y   +   F      L G+V+ SLS  +  E N +SS+S   +C Y  +R PPW   + P  +T  FW +LAA++AF+ +FE  V         +IP++P +    M+RE  +  E + + ELE 
Sbjct:   73 ELTGESFFLQE----KDPSNSSGLFFRDGKKRIDYILVYKK---SSPQVEKRCTFEKNLRAEGLMLEKEH----------SLTNN---------DIMLVKVHASWDTLCKYAERMNIRMPFRKKCYFSDKRSKGLGRCQQIKNWFPKNPMKLDKEALPDLEESDCYTAPFSRARMHHFTI-SNRETFFSNSTRSRIVHHVLQRTKY---------------------------------------EDGKS-KMGINRLLGNNTYEAAFPPHE----GGYKSRHPIKTHGPQNHRHLLYERWARWGIWYKYQPLDLIRRYFGEKIGLYFAWLGWYTGMLIPAALVGVFVFLYGLFTMDSSQVSKEICEANTTIMCPM--CEETCEPWTLSDSCV-YAKVREQLHGECLIFSAAT-----VFLEFWKRRRAELTYDWDLIDWEEEEEELRPQFEAKYSRK--ERVNPISGKPEPFQPF-SDKLSRLMVSVSGIFFMISLVLTAVFAVVVFRLIAMEKFASFRWHFVKKNLQFATSGTGVCLNFMIIMSLNVVYEKVAYLLTNLEHPRTESEWENSFALKMFLFQFVNLNSSTFYIAFFLGRFAGRPGKYSKLFNRWRLEECHPSGCLIDLCLQMGVIMFFKQIWNNFMELGYPLL-------------QNWWSRRKIKKGGGGGQNV-----------------ETQLPQWDKDWNLQPMNAHGLVDEYLEMVLQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPMPARATDIGIWHGILEGIGVLAVITNAFVIAITSDYIPRFVYAFKYGPCFSGPSRCLQGYVNSSLSVFDMWEVN-NSSMSR--YCRYRDYRAPPWS--SVPYKFTLQFWHVLAARLAFIIVFEHLVFGIKSFIAYLIPDMPKDLCDRMRREKYLMQEMMYEAELEH 894          
BLAST of Anoctamin vs. Ensembl Medaka
Match: ano5a (anoctamin 5 [Source:NCBI gene;Acc:101164640])

HSP 1 Score: 388.652 bits (997), Expect = 2.651e-119
Identity = 301/948 (31.75%), Postives = 462/948 (48.73%), Query Frame = 2
Query:  107 SFYQQQTLNNEKEKNNKGMFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIRKSIMNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYKKENM---RVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISER---NNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDE--PLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGI------------TVTKTIIRNLLRLQLTYVMSKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGSDSF-----SMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHS--RNFDLGGFVDFSLSFMNTTEFNISSSI----------SNETHCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELEE 2839
            SF Q+++   +++++   +FF D VRRIDFVL Y    D E K+ +R  F  +L+  GLE+EI++               SDD     +   FVKIHA W+ L  YA+++KI+       +  N        +         F +    ++P    +T PF K K   F I  +R +FF P  R+ IV YIL R  Y      I +   E+          DK+                    GI +L++   +  AF LH+     K K  N    R  LYK+WA   + F+ QPL+ IR Y+GE +  YFAWLGFYT  LF  A+ G    +Y + T   +   +EI       NI MCP+   +  C  WKL+      +   L DN  TV  A  + +WV LFLE W+R+Q  L + W++ D E E +   LRPEY     K    + N+I+ + EP++        I  L+ +T+L  I L +AC+ G+            ++ K    + L +   Y+  +L+T+   S I+ + I+IL  +Y RVAVW+TD+E  +T  +Y+N +T K+++ +F+N YSS FY+ F        PG  ++     S ++ + C  G CL++L+ QL+ ++ GKQ+  NI    +P L +    +   R      K RS      + +E                          QD+ L       LF EYLEM+IQFGFIT+F+  FPLAPLLA+ NN++EIR DA K  T +RRPVA +   IG W +IL  +A + V +NA ++AF +  I R++Y+  +      ++ G+++ SLS  N +E  + +            S+ T C Y  +R PP   H    S+T  FW +LAAK+AF+ + E  V L       +IP++P + +  +KRE  +  E++   E+E+
Sbjct:   39 SFQQEESGIQKQQQSKDSVFFRDGVRRIDFVLSYVDDKDGERKQERRRVFEANLVKVGLELEIED------------KSESDD-----RKTYFVKIHAPWEVLATYADVLKIKVPFKANDIPDN-------SEMPMNWLSTPFRLPEPIMQPEPDFFTAPFDKSKSDFFLIE-DRDKFFLPSTRNRIVYYILSRCSY------IRDECGER----------DKK--------------------GIKRLLNNSTYTAAFPLHDSRYWTKSKDVNCDSDRYNLYKYWAGFFSFFKEQPLNLIRKYYGEKIGLYFAWLGFYTEMLFFAAVVGTLCFVYGVLTYDDNEWSKEICSDEIGGNIVMCPL--CDKKCGFWKLNTTCNSSWQSHLFDNVGTVFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQLRPEYET---KCNSRKLNRITQEMEPYLPITSKCARI-CLSGATVLLWISLIIACIIGVIAYRLAVYAAFASIMKDSPTSNLEVVGPYITPQLATSVTASCINFVIIMILNLMYERVAVWITDMEIPKTHLEYENKLTVKMFLFQFVNYYSSCFYVAFFKGKFVGYPGDYAYMFGKWSKLRNEECDPGGCLIELTTQLVIVMTGKQVWGNIQEALVPWLMN----WWASR------KARSYPESLYSRWE--------------------------QDHDLQGFGQLGLFYEYLEMVIQFGFITLFVASFPLAPLLALFNNIIEIRVDAWKLTTQFRRPVAAKAHCIGAWEEILNGMAVLSVVTNAFIVAFTSDMIPRLVYMYAYQPEGEMNMKGYINNSLSVFNISEIPLPNRPEDGENPLWFNSSITTCRYRDYRNPP--GHENQYSHTMQFWHILAAKLAFIIIMEHVVFLVKYFVAWMIPDVPSDVKARVKRERYLVQEYLHNYEVEK 881          
BLAST of Anoctamin vs. Planmine SMEST
Match: SMESG000033732.1 (SMESG000033732.1)

HSP 1 Score: 1869.74 bits (4842), Expect = 0.000e+0
Identity = 973/974 (99.90%), Postives = 973/974 (99.90%), Query Frame = 2
Query:   83 MNSEILERSFYQQQTLNNEKEKNNKGMFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIRKSIMNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYKKENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISERNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRNLLRLQLTYVMSKLSTAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGSDSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLGGFVDFSLSFMNTTEFNISSSISNETHCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELEEHRNIYEANNLAKSLKKTIINYRQKLNKPNSKQRSTIMRDILRMNSKDTVSNEEKV 3004
            MNSEILERS YQQQTLNNEKEKNNKGMFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIRKSIMNAGVDYNYIFQSFFEKFVDFDFFRIFSIDNKRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYKKENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISERNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRNLLRLQLTYVMSKLSTAAIGSLISLITIIILTSVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGSDSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITIFILPFPLAPLLAIINNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLGGFVDFSLSFMNTTEFNISSSISNETHCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELEEHRNIYEANNLAKSLKKTIINYRQKLNKPNSKQRSTIMRDILRMNSKDTVSNEEKV
Sbjct:    1 MNSEILERSLYQQQTLNNEKEKNNKGMFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIRKSIMNAGVDYNYIFQSFFEKFVDFDFFRIFSIDNKRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHEKFSNGKYKKENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISERNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRNLLRLQLTYVMSKLSTAAIGSLISLITIIILTSVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGSDSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITIFILPFPLAPLLAIINNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLGGFVDFSLSFMNTTEFNISSSISNETHCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELEEHRNIYEANNLAKSLKKTIINYRQKLNKPNSKQRSTIMRDILRMNSKDTVSNEEKV 974          
BLAST of Anoctamin vs. Planmine SMEST
Match: SMESG000033728.1 (SMESG000033728.1)

HSP 1 Score: 816.994 bits (2109), Expect = 0.000e+0
Identity = 444/850 (52.24%), Postives = 590/850 (69.41%), Query Frame = 2
Query:  134 NEKEKNNKGMFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCES--KNLVFVKIHASWDTLCRYAEIMKIRKSIMNAGVDYNYIXXXXXXXXXXXXXXXXXSIDN-KRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGY-----KSNHKPIS-----NLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGS-----------NLNFGIAKLISEKVFETAFILHEKFSNGKYKKENM----RVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISERNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRNLLRLQLTYVMSKLS---TAAIGXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGSDSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVH------RPTITD-YEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLGGFVDFSLSFMNTTEFNIS 2569
            N+ +K N GMFF D VR+IDFVLVY+++ D+   + KR++F++SL+ EGLEIEIQ+ G ++    ++   ++D +   S   N+VF+K+ A+W+TLCRYAE++KIRK +++ G +Y++           F+ F   +I N   LKPI +G+T P+SK K YLFDIP + + FFT  ERSLIVNYIL+R  Y     K   +P+      ++ + +  VE+  I  +   N  +  TN    +G             ++FGIAKLISE VF++A+ILHE+  N     EN+    R LLYKHW ++ NIFR QPLDHI+LYFGE VAFYFAWLG+YT+WL PI+L G+ V++YN+     DI+++EI +  NITMCP+ C    C  WKLS  Y +F+LIRL+DNGATV++A V+S+W  LFLEMW+R+Q  LA+ WNVHD+E EDEP RPE+ AL++KNY  + N ISGKEEPFI FW+  +P+   T ST+L SI + LA L GI + K +  +L+R+  +  +S +S   TAA GSL+SL+ I+ LT VYSRVAVWLTD+EHHRTQSQYD+SVT KLY+LEFINNYSS+FYIGF  P+T+  P   S SMIKP+GC  G CLLDLS+QL FI++GKQIIS+I  +++PRL S++K Y++K+A+ K I +             I D   I + +C D +      K++ EL  CY DNILSDP PRPLF EYLEM+IQFGFITIFI  FPLAPLLA+ NNL EIRSDA KF    RRPVAQRVKDIGIW+ I++ +A I VKSNA+LIAFAT+YID++IYII +S N  L GF DFSLS+MN++EFN +
Sbjct:   16 NDDKKYNNGMFFVDGVRKIDFVLVYERINDNRTNQIKRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIRKQMLSLGFEYDF--NRKTIFQRLFETFDFLNIFNINELKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFAFEDISNKTVDFGIAKLISEGVFDSAYILHERPLNEDDDLENVENNERNLLYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQGTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPSFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTW------KVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITIFIPAFPLAPLLALTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLNGFTDFSLSYMNSSEFNAT 857          
BLAST of Anoctamin vs. Planmine SMEST
Match: SMESG000033730.1 (SMESG000033730.1)

HSP 1 Score: 711.064 bits (1834), Expect = 0.000e+0
Identity = 404/919 (43.96%), Postives = 578/919 (62.89%), Query Frame = 2
Query:  152 NKGMFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIRKSIMNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSN------------EKMLVELEPIHSDK---RSNSNDSITNE--------VEENGSNLNFGIAKLISEKVFETAFILHEKF--SNGKYKKENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISERNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRNLLRLQLTYVMSKLSTAAI---GXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGSDSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITXXXXXXXXXXXXXXXNNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLGGFVDFSLSFMNTTEFNISSSISNETHCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILK 2824
            N G+FFTD +R+IDFVL YQ+L D+E  R  R  F++ L+ +GLE EIQ+  G + ++ +   +N DD    +K +VF+K+ A W+TLC YAE+++IRK I++      Y     F K+            N         +T PFS  K YLFDIP NR  FF   ERSLIVNYIL+    + N    + L+N            +  +     I+S+    +S+SN+  T+E        ++ N    N  +  LISE+VFE+A+ LHE F   N   + E+ RV LYK W    NI R QPLD IR YFGE +AFYF+WLGFYT+WLF  +L G+ +T++N+     DII+ EI E  NITMCP+ C    C+ WKLS  Y +F++IR++DN   V++A  +S+W  LFLEMW+R+QF LAF WNV+DL+ + EP +PE+ A + +N   + N+ S      + FW+ T+P      ST+LFS++L LA L GI + + +I  LL +  + +++++S   I   GS+ISLI I++LT VY+++A WLT LE++ TQS+YD+SVT KLY+LEFINNYS +FY GF  P  +  PG  + S +KP GC TG CL  LS+QL FI++G+Q+IS+   +S P LCSSIK+Y++++ +   +K RS                       N   + +E+  CY D +L+D E +P+F EYLEM+IQFGFIT+FI  FPLAPLLA+ NNL+EIR+DA KF+T Y+RPVAQRVKDIG W++IL+ +A + VKSNA+LIAF T +I+R++YI+ +S   DL GF DF+LS++ ++EF   +S +NET+C Y+ FRY P D+ N P++ T ++W++LAAK+ FVYLFE  V   +KI    IPN  +     + +E  I+ + +LK
Sbjct:   20 NNGLFFTDGIRQIDFVLAYQKLNDNERNRKIRSKFLKILMKQGLEFEIQDEEGNLFSLENF--DNQDD----TKKIVFIKLFAKWETLCHYAELLRIRKPILHPPSSIKYEQSLSFRKYFRKFDIFNLYFGNS-FHSRTHTFTMPFSSSKEYLFDIPANRQYFFIQTERSLIVNYILRSITLQCNRNKCNILANILHPKSTPSSITDMEMRTFSTINSESECSKSHSNNDETDEGLTEIQHLIQTNDKLTNMSLHNLISEQVFESAYCLHESFIVQNSLKRDESDRVNLYKCWGLTRNICRSQPLDSIRSYFGEKIAFYFSWLGFYTYWLFFPSLLGLVITVFNILHASSDIIVNEIKEGGNITMCPLLCNSKQCKFWKLSDVYYKFFVIRILDNKTMVLMAFSMSIWASLFLEMWKREQFRLAFHWNVYDLQNQYEPQKPEFVAFITQNQTDKGNESS------VPFWRRTVPFMFFKFSTVLFSVILALAFLVGIILYEIVIYALLMMHPSPLVTQMSNVIISVTGSIISLIVILLLTMVYAKLAHWLTGLENNETQSEYDDSVTMKLYLLEFINNYSYLFYFGFILPLIQPIPGFKAMSDLKPIGCPTGGCLFGLSVQLAFIMIGRQLISHFTEYSYPLLCSSIKKYKLRKCNK--VKYRSK----------------------NITNVNAEIIRCYDDLLLADLESQPVFYEYLEMLIQFGFITMFIPAFPLAPLLALFNNLLEIRNDATKFLTAYKRPVAQRVKDIGTWINILSVVAGLAVKSNAILIAFTTFFIERLLYILKYSPTGDLKGFSDFTLSYLKSSEF---ASSTNETYCRYMDFRYHPLDIKNGPLTLTSIYWEILAAKVIFVYLFENVVYTIMKIISATIPNQNERITKEITKEVTISRKLLLK 898          
BLAST of Anoctamin vs. Planmine SMEST
Match: SMESG000033732.1 (SMESG000033732.1)

HSP 1 Score: 503.442 bits (1295), Expect = 5.842e-172
Identity = 270/271 (99.63%), Postives = 270/271 (99.63%), Query Frame = 2
Query:   83 MNSEILERSFYQQQTLNNEKEKNNKGMFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIRKSIMNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHE 895
            MNSEILERS YQQQTLNNEKEKNNKGMFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIRKSIMNAGVDYNYIFQSFFEKFVDFDFFRIFSIDNKRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHE
Sbjct:    1 MNSEILERSLYQQQTLNNEKEKNNKGMFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIRKSIMNAGVDYNYIFQSFFEKFVDFDFFRIFSIDNKRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNLNFGIAKLISEKVFETAFILHE 271          
BLAST of Anoctamin vs. Planmine SMEST
Match: SMESG000033730.1 (SMESG000033730.1)

HSP 1 Score: 427.172 bits (1097), Expect = 2.311e-137
Identity = 247/580 (42.59%), Postives = 353/580 (60.86%), Query Frame = 2
Query:  152 NKGMFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLVFVKIHASWDTLCRYAEIMKIRKSIMNAGVDYNYIXXXXXXXXXXXXXXXXXSIDNKRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGYKSNHKPISNLSN------------EKMLVELEPIHSDK---RSNSNDSITNE--------VEENGSNLNFGIAKLISEKVFETAFILHEKF--SNGKYKKENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISERNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRNLLRLQLTYVMSKLSTAAI---GXXXXXXXXXXXXXVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYS 1807
            N G+FFTD +R+IDFVL YQ+L D+E  R  R  F++ L+ +GLE EIQ+  G + ++ +   +N DD    +K +VF+K+ A W+TLC YAE+++IRK I++      Y     F K+            N         +T PFS  K YLFDIP NR  FF   ERSLIVNYIL+    + N    + L+N            +  +     I+S+    +S+SN+  T+E        ++ N    N  +  LISE+VFE+A+ LHE F   N   + E+ RV LYK W    NI R QPLD IR YFGE +AFYF+WLGFYT+WLF  +L G+ +T++N+     DII+ EI E  NITMCP+ C    C+ WKLS  Y +F++IR++DN   V++A  +S+W  LFLEMW+R+QF LAF WNV+DL+ + EP +PE+ A + +N   + N+ S      + FW+ T+P      ST+LFS++L LA L GI + + +I  LL +  + +++++S   I   GS+ISLI I++LT VY+++A WLT LE++ TQS+YD+SVT KLY+LEFINNYS
Sbjct:   20 NNGLFFTDGIRQIDFVLAYQKLNDNERNRKIRSKFLKILMKQGLEFEIQDEEGNLFSLENF--DNQDD----TKKIVFIKLFAKWETLCHYAELLRIRKPILHPPSSIKYEQSLSFRKYFRKFDIFNLYFGNS-FHSRTHTFTMPFSSSKEYLFDIPANRQYFFIQTERSLIVNYILRSITLQCNRNKCNILANILHPKSTPSSITDMEMRTFSTINSESECSKSHSNNDETDEGLTEIQHLIQTNDKLTNMSLHNLISEQVFESAYCLHESFIVQNSLKRDESDRVNLYKCWGLTRNICRSQPLDSIRSYFGEKIAFYFSWLGFYTYWLFFPSLLGLVITVFNILHASSDIIVNEIKEGGNITMCPLLCNSKQCKFWKLSDVYYKFFVIRILDNKTMVLMAFSMSIWASLFLEMWKREQFRLAFHWNVYDLQNQYEPQKPEFVAFITQNQTDKGNESS------VPFWRRTVPFMFFKFSTVLFSVILALAFLVGIILYEIVIYALLMMHPSPLVTQMSNVIISVTGSIISLIVILLLTMVYAKLAHWLTGLENNETQSEYDDSVTMKLYLLEFINNYS 586          
The following BLAST results are available for this feature:
BLAST of Anoctamin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANO41.217e-11632.16anoctamin 4 [Source:HGNC Symbol;Acc:HGNC:23837][more]
ANO42.709e-11632.16anoctamin 4 [Source:HGNC Symbol;Acc:HGNC:23837][more]
ANO13.456e-11530.19anoctamin 1 [Source:HGNC Symbol;Acc:HGNC:21625][more]
ANO49.753e-11532.16anoctamin 4 [Source:HGNC Symbol;Acc:HGNC:23837][more]
ANO28.844e-11331.59anoctamin 2 [Source:HGNC Symbol;Acc:HGNC:1183][more]
back to top
BLAST of Anoctamin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
anoh-16.727e-3424.81Anoctamin [Source:UniProtKB/TrEMBL;Acc:C0P286][more]
anoh-17.976e-3424.81Anoctamin [Source:UniProtKB/TrEMBL;Acc:C0P286][more]
anoh-25.525e-3025.33Anoctamin [Source:UniProtKB/TrEMBL;Acc:H2L2L3][more]
anoh-27.083e-3025.33Anoctamin [Source:UniProtKB/TrEMBL;Acc:H2L2L3][more]
back to top
BLAST of Anoctamin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
subdued3.994e-12932.06gene:FBgn0038721 transcript:FBtr0083806[more]
subdued3.994e-12932.06gene:FBgn0038721 transcript:FBtr0334921[more]
subdued1.480e-12732.06gene:FBgn0038721 transcript:FBtr0083805[more]
subdued6.693e-12631.15gene:FBgn0038721 transcript:FBtr0334922[more]
subdued1.724e-12431.15gene:FBgn0038721 transcript:FBtr0302492[more]
back to top
BLAST of Anoctamin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ano33.600e-12532.79anoctamin 3 [Source:ZFIN;Acc:ZDB-GENE-111031-3][more]
ano5b3.002e-11530.14anoctamin 5b [Source:ZFIN;Acc:ZDB-GENE-061215-108][more]
ano5a5.600e-11429.98anoctamin 5a [Source:ZFIN;Acc:ZDB-GENE-091013-2][more]
ano5a1.976e-11330.01anoctamin 5a [Source:ZFIN;Acc:ZDB-GENE-091013-2][more]
ano111.368e-11032.73anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245][more]
back to top
BLAST of Anoctamin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANO41.540e-11932.53major histocompatibility complex class I-related g... [more]
ANO41.610e-11632.53major histocompatibility complex class I-related g... [more]
ANO31.103e-11331.11anoctamin 3 [Source:NCBI gene;Acc:100495805][more]
znf3671.104e-11031.00zinc finger protein 367 [Source:Xenbase;Acc:XB-GEN... [more]
znf3671.188e-10830.73zinc finger protein 367 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of Anoctamin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ano48.712e-11631.74anoctamin 4 [Source:MGI Symbol;Acc:MGI:2443344][more]
Ano48.712e-11631.74anoctamin 4 [Source:MGI Symbol;Acc:MGI:2443344][more]
Ano12.277e-11529.64anoctamin 1, calcium activated chloride channel [S... [more]
Ano42.496e-11531.87anoctamin 4 [Source:MGI Symbol;Acc:MGI:2443344][more]
Ano19.036e-11529.64anoctamin 1, calcium activated chloride channel [S... [more]
back to top
BLAST of Anoctamin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q32M45|ANO4_HUMAN1.301e-11532.16Anoctamin-4 OS=Homo sapiens OX=9606 GN=ANO4 PE=2 S... [more]
sp|Q8C5H1|ANO4_MOUSE1.746e-11431.87Anoctamin-4 OS=Mus musculus OX=10090 GN=Ano4 PE=1 ... [more]
sp|A6QLE6|ANO4_BOVIN5.721e-11432.13Anoctamin-4 OS=Bos taurus OX=9913 GN=ANO4 PE=2 SV=... [more]
sp|Q8BHY3|ANO1_MOUSE1.239e-11329.62Anoctamin-1 OS=Mus musculus OX=10090 GN=Ano1 PE=1 ... [more]
sp|Q8CFW1|ANO2_MOUSE1.801e-11030.79Anoctamin-2 OS=Mus musculus OX=10090 GN=Ano2 PE=1 ... [more]
back to top
BLAST of Anoctamin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K4FF500.000e+041.74Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A5K4FDS20.000e+040.84Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A5K4FBC00.000e+041.07Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A0X3P2Y50.000e+034.92Anoctamin (Fragment) OS=Schistocephalus solidus OX... [more]
A0A0X3NPU40.000e+034.71Anoctamin OS=Schistocephalus solidus OX=70667 GN=T... [more]
back to top
BLAST of Anoctamin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ano5b2.180e-11230.09anoctamin 5b [Source:ZFIN;Acc:ZDB-GENE-061215-108][more]
ano5a6.635e-11230.89anoctamin 5 [Source:NCBI gene;Acc:103044829][more]
ano5a1.230e-11130.89anoctamin 5 [Source:NCBI gene;Acc:103044829][more]
ano5a1.546e-11130.89anoctamin 5 [Source:NCBI gene;Acc:103044829][more]
ano5a1.868e-11130.74anoctamin 5 [Source:NCBI gene;Acc:103044829][more]
back to top
BLAST of Anoctamin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ano111.690e-9834.60anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245][more]
ENSPMAT00000000399.12.183e-8729.51pep scaffold:Pmarinus_7.0:GL477564:2673:43187:-1 g... [more]
ano33.957e-5833.40anoctamin 3 [Source:ZFIN;Acc:ZDB-GENE-111031-3][more]
ano111.286e-5734.48anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245][more]
ano116.837e-5734.48anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245][more]
back to top
BLAST of Anoctamin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Anoctamin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO498558.076e-10632.19Anoctamin [Source:UniProtKB/TrEMBL;Acc:A7REV0][more]
EDO498543.435e-9434.36Anoctamin [Source:UniProtKB/TrEMBL;Acc:A7REU8][more]
EDO480502.398e-9328.82Anoctamin [Source:UniProtKB/TrEMBL;Acc:A7RKU9][more]
EDO483071.030e-8629.64Anoctamin [Source:UniProtKB/TrEMBL;Acc:A7RJQ8][more]
EDO480482.688e-8528.56Anoctamin [Source:UniProtKB/TrEMBL;Acc:A7RKU7][more]
back to top
BLAST of Anoctamin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ano34.226e-12632.91anoctamin 3 [Source:NCBI gene;Acc:101164148][more]
ano5b8.266e-12331.21anoctamin-5 [Source:NCBI gene;Acc:101167353][more]
ano5b9.937e-12331.21anoctamin-5 [Source:NCBI gene;Acc:101167353][more]
ano31.490e-11932.59anoctamin 3 [Source:NCBI gene;Acc:101164148][more]
ano5a2.651e-11931.75anoctamin 5 [Source:NCBI gene;Acc:101164640][more]
back to top
BLAST of Anoctamin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033732.10.000e+099.90SMESG000033732.1[more]
SMESG000033728.10.000e+052.24SMESG000033728.1[more]
SMESG000033730.10.000e+043.96SMESG000033730.1[more]
SMESG000033732.15.842e-17299.63SMESG000033732.1[more]
SMESG000033730.12.311e-13742.59SMESG000033730.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002957 ID=SMED30002957|Name=Anoctamin|organism=Schmidtea mediterranea sexual|type=transcript|length=3039bp
TGAATTTGTTTAAATGGATTATGAATCAACTTATCAAATAATGTTTATTT
TAAATTTCAAGTATAATAACTAAATTTAATTGATGAATTCTGAAATATTG
GAAAGAAGTTTTTACCAACAACAAACATTAAACAATGAAAAGGAAAAAAA
TAATAAAGGAATGTTCTTCACGGACAGAGTTCGGCGGATAGATTTTGTAC
TAGTTTATCAGCAGTTGCTGGACAGTGAAGAAAAGCGTAATAAAAGAATA
TCATTCATAGAATCTTTGATAGACGAAGGATTAGAAATCGAAATTCAAAA
TATTGGGGGCAGAATAATCAACATAGCAGACTCGGTCAATGAAAACTCCG
ATGATATAACATGCGAGTCCAAAAATCTTGTTTTTGTTAAAATTCACGCT
TCATGGGATACGCTGTGCAGATACGCAGAAATAATGAAAATCAGAAAATC
TATTATGAATGCCGGTGTGGATTACAATTATATTTTTCAATCTTTTTTCG
AAAAGTTTGTCGATTTTGATTTCTTCCGCATATTCAGCATAGACAACAAG
AGATTGAAACCGATTGCGCAAGGCTATACGTATCCGTTTTCCAAACAGAA
ATATTATCTATTCGACATTCCTGTCAATCGGTCAGAATTTTTCACTCCGG
TTGAGCGTAGTTTAATTGTCAATTATATTTTGAAACGGAAAGGATACAAA
TCAAATCATAAGCCAATCTCAAACCTGTCGAATGAGAAAATGTTAGTTGA
ACTTGAACCAATACACTCTGACAAAAGAAGCAATTCCAATGATTCTATTA
CTAATGAAGTGGAAGAAAATGGATCAAATTTGAATTTTGGAATAGCTAAA
CTCATTTCAGAAAAGGTATTCGAGACTGCATTCATTCTTCATGAGAAATT
TTCGAATGGAAAGTATAAAAAGGAAAATATGAGAGTTTTGCTCTATAAAC
ATTGGGCAACATTGACAAATATTTTCCGGCATCAGCCATTAGATCATATA
CGACTTTATTTTGGTGAAATGGTTGCCTTTTATTTTGCGTGGCTTGGTTT
CTATACATTTTGGTTGTTTCCAATTGCATTGTTTGGAGTCTGCGTAACAA
TATACAATCTCGCTACTATTCCACGTGATATAATAATACAAGAAATAAGT
GAACGGAACAATATAACCATGTGTCCTGTTTTCTGCATAGAAGGGTCCTG
TGAATCATGGAAATTGTCAGCTGGATATGTCCAATTCTATTTAATACGAC
TGATTGACAACGGGGCAACTGTAATATTGGCTGGTGTTGTATCAGTTTGG
GTTTTCCTTTTTCTTGAGATGTGGGAAAGAAAACAATTTACACTCGCCTT
CCGATGGAATGTTCATGATTTAGAGGTTGAGGATGAGCCTCTGCGCCCTG
AATATGCGGCATTGCTTGAGAAAAATTACATAAGCCAGTTCAATAAAATT
TCTGGAAAAGAGGAGCCATTTATTTCATTTTGGAAAAATACTTTACCTAT
TCAAATGTTAACCATTTCAACTATTTTATTTTCGATTGTTTTAACACTTG
CTTGTTTGACTGGTATTACAGTTACGAAAACTATTATTCGCAATTTGTTG
CGTTTGCAGTTGACTTATGTTATGTCAAAATTATCAACTGCCGCCATTGG
ATCCCTTATATCATTAATTACTATAATTATATTAACATCAGTCTACTCAA
GGGTTGCGGTGTGGCTCACTGATTTAGAACATCATCGAACACAATCTCAG
TATGATAATAGTGTCACTGGAAAACTTTATATATTAGAATTTATTAACAA
TTATTCCTCTATGTTTTATATTGGATTTGCTCATCCTTATACTAAAGTTA
AACCAGGCTCAGATTCGTTTTCAATGATAAAGCCCCAAGGCTGCCTGACT
GGAGATTGCCTACTGGATCTTTCAATGCAGTTAATATTTATTCTGGTCGG
TAAACAAATTATCAGTAACATTATAAATTTTAGCATTCCACGACTTTGTT
CATCAATTAAAGAATACAGAATAAAACGAGCTGATAGTAAATTCATTAAG
CGGCGATCCGTACATCGTCCAACAATAACGGATTACGAAATCAGTGAGGT
GGAATGCTCTGACATATACACAGATTGTAACGGCGTGAAATTACAATCTG
AACTAAAAATATGTTATCAAGATAATATTCTTTCCGATCCGGAACCCAGA
CCCTTATTTAAAGAATATTTAGAAATGATCATACAATTTGGATTCATAAC
TATTTTTATATTACCGTTTCCTCTTGCTCCTCTTCTTGCAATTATAAACA
ATCTTATGGAAATTCGAAGTGATGCAAAAAAATTCGTCACGGTCTATCGA
AGACCTGTGGCTCAACGAGTCAAAGATATTGGAATTTGGATGGATATTTT
AACAACAATAGCGAAGATTGTTGTCAAATCAAATGCTTTATTAATTGCTT
TTGCTACGTCGTATATTGACCGGATGATTTATATCATTGTTCACAGCAGA
AACTTTGATCTTGGAGGCTTCGTGGATTTCTCTTTATCCTTTATGAATAC
AACTGAATTCAACATTTCATCCTCAATTTCCAACGAAACACATTGCAGTT
ATATAGGATTTCGTTACCCTCCTTGGGATGTACACAATGAACCGATGTCA
TACACCCCTGTTTTCTGGCAAATGTTGGCAGCAAAAATTGCATTTGTTTA
TTTGTTTGAGACTTTTGTATCGTTATTCGTGAAAATTTTCTTAATGATAA
TACCGAATATTCCTGATGAATATCGCATAGCCATGAAACGGGAGGCAGCG
ATCACGAATGAATTCATATTGAAAATAGAATTGGAGGAACACAGAAATAT
ATATGAAGCAAATAACCTCGCCAAATCTTTGAAGAAAACAATTATAAATT
ATAGACAAAAACTCAATAAACCAAACTCTAAACAAAGATCTACAATCATG
AGAGATATTCTACGAATGAATTCAAAGGACACAGTTTCGAACGAAGAAAA
AGTTTAAGCTAAGACTGCTTTATTCTGATTAAAAAAAAG
back to top

protein sequence of SMED30002957-orf-1

>SMED30002957-orf-1 ID=SMED30002957-orf-1|Name=SMED30002957-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=975bp
MNSEILERSFYQQQTLNNEKEKNNKGMFFTDRVRRIDFVLVYQQLLDSEE
KRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCESKNLV
FVKIHASWDTLCRYAEIMKIRKSIMNAGVDYNYIFQSFFEKFVDFDFFRI
FSIDNKRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYIL
KRKGYKSNHKPISNLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGSNL
NFGIAKLISEKVFETAFILHEKFSNGKYKKENMRVLLYKHWATLTNIFRH
QPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDI
IIQEISERNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILA
GVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYI
SQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKT
IIRNLLRLQLTYVMSKLSTAAIGSLISLITIIILTSVYSRVAVWLTDLEH
HRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGSDSFSMIK
PQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRA
DSKFIKRRSVHRPTITDYEISEVECSDIYTDCNGVKLQSELKICYQDNIL
SDPEPRPLFKEYLEMIIQFGFITIFILPFPLAPLLAIINNLMEIRSDAKK
FVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIY
IIVHSRNFDLGGFVDFSLSFMNTTEFNISSSISNETHCSYIGFRYPPWDV
HNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIA
MKREAAITNEFILKIELEEHRNIYEANNLAKSLKKTIINYRQKLNKPNSK
QRSTIMRDILRMNSKDTVSNEEKV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR032394Anoct_dimer
IPR007632Anoctamin
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR032394Anoctamin, dimerisation domainPFAMPF16178Anoct_dimercoord: 248..303
e-value: 2.4E-11
score: 43.8
coord: 28..231
e-value: 3.1E-35
score: 121.9
IPR007632AnoctaminPFAMPF04547Anoctamincoord: 306..904
e-value: 8.6E-122
score: 407.2
IPR007632AnoctaminPANTHERPTHR12308NGEP-RELATEDcoord: 28..237
coord: 249..921
NoneNo IPR availablePANTHERPTHR12308:SF31ANOCTAMINcoord: 28..237
coord: 249..921
NoneNo IPR availableTMHMMTMhelixcoord: 387..409
NoneNo IPR availableTMHMMTMhelixcoord: 716..738
NoneNo IPR availableTMHMMTMhelixcoord: 517..539
NoneNo IPR availableTMHMMTMhelixcoord: 316..338
NoneNo IPR availableTMHMMTMhelixcoord: 869..891
NoneNo IPR availableTMHMMTMhelixcoord: 475..497