Conserved oligomeric Golgi complex subunit 4

Overview
NameConserved oligomeric Golgi complex subunit 4
Smed IDSMED30002952
Length (bp)2622
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Conserved oligomeric Golgi complex subunit 4 (SMED30002952) t-SNE clustered cells

Violin plots show distribution of expression levels for Conserved oligomeric Golgi complex subunit 4 (SMED30002952) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Conserved oligomeric Golgi complex subunit 4 (SMED30002952) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Conserved oligomeric Golgi complex subunit 4 (SMED30002952) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002952

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior sideSMED30002952h1SMcG0019776 dd_Smed_v4_4093_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30002952h1SMcG0019776 dd_Smed_v4_4093_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002952h1SMcG0019776 dd_Smed_v4_4093_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. Ensembl Human
Match: COG4 (component of oligomeric golgi complex 4 [Source:HGNC Symbol;Acc:HGNC:18620])

HSP 1 Score: 145.976 bits (367), Expect = 2.674e-35
Identity = 72/147 (48.98%), Postives = 104/147 (70.75%), Query Frame = 1
Query: 2131 DEFMSLEANDPWVESFILNVESILADFQEIMIPILFEKLIQKLCXXXXXXXXXXXXXXTFNRLGGIQFDREIRTVINFLATTTKWGVRDKFTRLRQIASILNMENPNEITSYW----DNVSWRLTPSEVRQFMKSRMDFRIEDIRNL 2559
            +EF   EANDPWV+ FILN+E  +A+F+  + P++++ L   +   V + +EK++ K TFNRLGG+QFD+E+R++I +L T T W +RDKF RL Q+A+ILN+E   EI  YW      ++WRLTP+EVRQ +  R+DFR EDI+ L
Sbjct:  641 EEFNDYEANDPWVQQFILNLEQQMAEFKASLSPVIYDSLTGLMTSLVAVELEKVVLKSTFNRLGGLQFDKELRSLIAYLTTVTTWTIRDKFARLSQMATILNLERVTEILDYWGPNSGPLTWRLTPAEVRQVLALRIDFRSEDIKRL 787          
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. Ensembl Human
Match: COG4 (component of oligomeric golgi complex 4 [Source:HGNC Symbol;Acc:HGNC:18620])

HSP 1 Score: 145.976 bits (367), Expect = 2.700e-35
Identity = 72/147 (48.98%), Postives = 104/147 (70.75%), Query Frame = 1
Query: 2131 DEFMSLEANDPWVESFILNVESILADFQEIMIPILFEKLIQKLCXXXXXXXXXXXXXXTFNRLGGIQFDREIRTVINFLATTTKWGVRDKFTRLRQIASILNMENPNEITSYW----DNVSWRLTPSEVRQFMKSRMDFRIEDIRNL 2559
            +EF   EANDPWV+ FILN+E  +A+F+  + P++++ L   +   V + +EK++ K TFNRLGG+QFD+E+R++I +L T T W +RDKF RL Q+A+ILN+E   EI  YW      ++WRLTP+EVRQ +  R+DFR EDI+ L
Sbjct:  620 EEFNDYEANDPWVQQFILNLEQQMAEFKASLSPVIYDSLTGLMTSLVAVELEKVVLKSTFNRLGGLQFDKELRSLIAYLTTVTTWTIRDKFARLSQMATILNLERVTEILDYWGPNSGPLTWRLTPAEVRQVLALRIDFRSEDIKRL 766          
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. Ensembl Human
Match: COG4 (component of oligomeric golgi complex 4 [Source:HGNC Symbol;Acc:HGNC:18620])

HSP 1 Score: 115.546 bits (288), Expect = 2.008e-29
Identity = 62/138 (44.93%), Postives = 92/138 (66.67%), Query Frame = 1
Query: 2161 PWVESFILNVESILADFQEIMI-PILFEKLIQKLCXXXXXXXXXXXXXXTFNRLGGIQFDREIRTVINFLATTTKWGVRDKFTRLRQIASILNMENPNEITSYW----DNVSWRLTPSEVRQFMKSRMDFRIEDIRNL 2559
            PW+ SF     S+  + +E  + P++++ L   +   V + +EK++ K TFNRLGG+QFD+E+R++I +L T T W +RDKF RL Q+A+ILN+E   EI  YW      ++WRLTP+EVRQ +  R+DFR EDI+ L
Sbjct:    8 PWINSFF----SVSHNIEEASLSPVIYDSLTGLMTSLVAVELEKVVLKSTFNRLGGLQFDKELRSLIAYLTTVTTWTIRDKFARLSQMATILNLERVTEILDYWGPNSGPLTWRLTPAEVRQVLALRIDFRSEDIKRL 141          
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. Ensembl Celegans
Match: cogc-4 (Conserved oligomeric Golgi complex subunit 4 [Source:UniProtKB/Swiss-Prot;Acc:Q95XZ0])

HSP 1 Score: 72.0182 bits (175), Expect = 1.363e-12
Identity = 44/137 (32.12%), Postives = 71/137 (51.82%), Query Frame = 1
Query: 2149 EANDPWVESFILNVESILADFQEIMIPILFEKLIQKLCXXXXXXXXXXXXXXTFNRLGGIQFDREIRTVINFLATTTKWGVRDKFTRLRQIASILNMENPNEITSYWDNVSW--------RLTPSEVRQFMKSRMDF 2535
            EA+DP++E F+  ++ +L + + ++    ++ L+     E+  +IE+ + K  FNR G +Q DRE R +  +L     W  R+K  RL QI S+LN+E  +E    W N            LT  EVR+ +  R DF
Sbjct:  656 EAHDPFMEQFLAQIDRLLVENEPLLFADNYQTLLLLTSSEIARQIEQSLAKCQFNRYGALQLDREYRQICAYLTNVAGWSAREKVGRLGQIVSLLNVETIDEAMEVWHNSKAMTSSATIRTLTLPEVRKVLALRADF 792          
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. Ensembl Fly
Match: CG7456 (gene:FBgn0032258 transcript:FBtr0080038)

HSP 1 Score: 112.079 bits (279), Expect = 5.914e-25
Identity = 62/149 (41.61%), Postives = 97/149 (65.10%), Query Frame = 1
Query: 2131 DEFMSLEANDPWVESFILNVESILADFQEIMIPILFEKLIQKLCXXXXXXXXXXXXXXTFNRLGGIQFDREIRTVINFLATTTKWGVRDKFTRLRQIASILNMENPNEITSYWDN------VSWRLTPSEVRQFMKSRMDFRIEDIRNL 2559
            +E  + EA + +V+ FI+ ++ +L  F+  + P  ++ L+  L  EV I++E+ IKK +FNRLGG+  D+E+R + ++L   T W VRDK TR+ QIA++LN++   E++ YW+        SW LTP+EVR F+  R DFRIEDI+ L
Sbjct:  626 EELAAYEAGETFVQFFIVQLDGLLNSFKNSLSPRNYDALVSILATEVTIQLERAIKKISFNRLGGLVLDQEVRALGSYLTGATSWSVRDKMTRISQIATLLNLDKITELSEYWNPENNKEMSSWHLTPNEVRTFLTLRNDFRIEDIKRL 774          
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. Ensembl Zebrafish
Match: cog4 (component of oligomeric golgi complex 4 [Source:NCBI gene;Acc:569049])

HSP 1 Score: 129.798 bits (325), Expect = 1.980e-30
Identity = 61/140 (43.57%), Postives = 99/140 (70.71%), Query Frame = 1
Query: 2152 ANDPWVESFILNVESILADFQEIMIPILFEKLIQKLCXXXXXXXXXXXXXXTFNRLGGIQFDREIRTVINFLATTTKWGVRDKFTRLRQIASILNMENPNEITSYW----DNVSWRLTPSEVRQFMKSRMDFRIEDIRNL 2559
            ANDP+V+  I+ +E ++A+F+  + P++++ L   +   + + +EK + K TF+RLGG+QFD+E+R ++ +L++ T W +RDKF RL Q+A+ILN+E  +EI  YW      ++WRLTP+EVRQ +  R+DFR EDI+ L
Sbjct:  640 ANDPFVQQLIVQLEQLMAEFKVGLSPVIYDTLTSLMTSLIAMEMEKTVFKCTFSRLGGLQFDKELRALVAYLSSVTSWTIRDKFARLTQMATILNLERVSEILDYWGPNSGPLTWRLTPAEVRQVLALRVDFRSEDIKRL 779          
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. Ensembl Xenopus
Match: cog4 (component of oligomeric golgi complex 4 [Source:NCBI gene;Acc:100145689])

HSP 1 Score: 143.28 bits (360), Expect = 1.396e-34
Identity = 70/147 (47.62%), Postives = 104/147 (70.75%), Query Frame = 1
Query: 2131 DEFMSLEANDPWVESFILNVESILADFQEIMIPILFEKLIQKLCXXXXXXXXXXXXXXTFNRLGGIQFDREIRTVINFLATTTKWGVRDKFTRLRQIASILNMENPNEITSYW----DNVSWRLTPSEVRQFMKSRMDFRIEDIRNL 2559
            +EF   EANDPWV+ FI+N+E ++A+F+  +  +++E L   L   + + +EK++ K TF+RLGG+QFD+E+R++I +L T T W +RDKF RL Q+A+ILN+E   EI  YW      ++WRLTP+EVRQ +  R+DFR EDI+ L
Sbjct:  587 EEFNDYEANDPWVQQFIVNLEQLMAEFKAGLSSVIYENLTSLLTSLIAMELEKVVLKSTFSRLGGLQFDKELRSLIAYLTTVTTWTIRDKFARLTQMATILNLERVTEILDYWGPNSGPLTWRLTPAEVRQVLALRIDFRSEDIKRL 733          
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. Ensembl Xenopus
Match: cog4 (component of oligomeric golgi complex 4 [Source:NCBI gene;Acc:100145689])

HSP 1 Score: 143.28 bits (360), Expect = 1.535e-34
Identity = 70/147 (47.62%), Postives = 104/147 (70.75%), Query Frame = 1
Query: 2131 DEFMSLEANDPWVESFILNVESILADFQEIMIPILFEKLIQKLCXXXXXXXXXXXXXXTFNRLGGIQFDREIRTVINFLATTTKWGVRDKFTRLRQIASILNMENPNEITSYW----DNVSWRLTPSEVRQFMKSRMDFRIEDIRNL 2559
            +EF   EANDPWV+ FI+N+E ++A+F+  +  +++E L   L   + + +EK++ K TF+RLGG+QFD+E+R++I +L T T W +RDKF RL Q+A+ILN+E   EI  YW      ++WRLTP+EVRQ +  R+DFR EDI+ L
Sbjct:  609 EEFNDYEANDPWVQQFIVNLEQLMAEFKAGLSSVIYENLTSLLTSLIAMELEKVVLKSTFSRLGGLQFDKELRSLIAYLTTVTTWTIRDKFARLTQMATILNLERVTEILDYWGPNSGPLTWRLTPAEVRQVLALRIDFRSEDIKRL 755          
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. Ensembl Xenopus
Match: cog4 (component of oligomeric golgi complex 4 [Source:NCBI gene;Acc:100145689])

HSP 1 Score: 143.28 bits (360), Expect = 1.694e-34
Identity = 70/147 (47.62%), Postives = 104/147 (70.75%), Query Frame = 1
Query: 2131 DEFMSLEANDPWVESFILNVESILADFQEIMIPILFEKLIQKLCXXXXXXXXXXXXXXTFNRLGGIQFDREIRTVINFLATTTKWGVRDKFTRLRQIASILNMENPNEITSYW----DNVSWRLTPSEVRQFMKSRMDFRIEDIRNL 2559
            +EF   EANDPWV+ FI+N+E ++A+F+  +  +++E L   L   + + +EK++ K TF+RLGG+QFD+E+R++I +L T T W +RDKF RL Q+A+ILN+E   EI  YW      ++WRLTP+EVRQ +  R+DFR EDI+ L
Sbjct:  624 EEFNDYEANDPWVQQFIVNLEQLMAEFKAGLSSVIYENLTSLLTSLIAMELEKVVLKSTFSRLGGLQFDKELRSLIAYLTTVTTWTIRDKFARLTQMATILNLERVTEILDYWGPNSGPLTWRLTPAEVRQVLALRIDFRSEDIKRL 770          
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. Ensembl Mouse
Match: Cog4 (component of oligomeric golgi complex 4 [Source:MGI Symbol;Acc:MGI:2142808])

HSP 1 Score: 145.976 bits (367), Expect = 1.308e-35
Identity = 72/147 (48.98%), Postives = 104/147 (70.75%), Query Frame = 1
Query: 2131 DEFMSLEANDPWVESFILNVESILADFQEIMIPILFEKLIQKLCXXXXXXXXXXXXXXTFNRLGGIQFDREIRTVINFLATTTKWGVRDKFTRLRQIASILNMENPNEITSYWDN----VSWRLTPSEVRQFMKSRMDFRIEDIRNL 2559
            +EF   EANDPWV+ FILN+E  +A+F+  + P++++ L   +   V + +EK++ K TFNRLGG+QFD+E+R++I +L T T W +RDKF RL Q+A+ILN+E   EI  YW      ++WRLTP+EVRQ +  R+DFR EDI+ L
Sbjct:  564 EEFNDYEANDPWVQQFILNLEQQMAEFKASLSPVIYDSLTGLMTSLVAVELEKVVLKSTFNRLGGLQFDKELRSLIAYLTTVTTWTIRDKFARLSQMATILNLERVTEILDYWGANSGPLTWRLTPAEVRQVLALRIDFRNEDIKRL 710          
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. Ensembl Mouse
Match: Cog4 (component of oligomeric golgi complex 4 [Source:MGI Symbol;Acc:MGI:2142808])

HSP 1 Score: 145.976 bits (367), Expect = 1.573e-35
Identity = 72/147 (48.98%), Postives = 104/147 (70.75%), Query Frame = 1
Query: 2131 DEFMSLEANDPWVESFILNVESILADFQEIMIPILFEKLIQKLCXXXXXXXXXXXXXXTFNRLGGIQFDREIRTVINFLATTTKWGVRDKFTRLRQIASILNMENPNEITSYWDN----VSWRLTPSEVRQFMKSRMDFRIEDIRNL 2559
            +EF   EANDPWV+ FILN+E  +A+F+  + P++++ L   +   V + +EK++ K TFNRLGG+QFD+E+R++I +L T T W +RDKF RL Q+A+ILN+E   EI  YW      ++WRLTP+EVRQ +  R+DFR EDI+ L
Sbjct:  615 EEFNDYEANDPWVQQFILNLEQQMAEFKASLSPVIYDSLTGLMTSLVAVELEKVVLKSTFNRLGGLQFDKELRSLIAYLTTVTTWTIRDKFARLSQMATILNLERVTEILDYWGANSGPLTWRLTPAEVRQVLALRIDFRNEDIKRL 761          
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. Ensembl Mouse
Match: Cog4 (component of oligomeric golgi complex 4 [Source:MGI Symbol;Acc:MGI:2142808])

HSP 1 Score: 145.976 bits (367), Expect = 1.699e-35
Identity = 72/147 (48.98%), Postives = 104/147 (70.75%), Query Frame = 1
Query: 2131 DEFMSLEANDPWVESFILNVESILADFQEIMIPILFEKLIQKLCXXXXXXXXXXXXXXTFNRLGGIQFDREIRTVINFLATTTKWGVRDKFTRLRQIASILNMENPNEITSYWDN----VSWRLTPSEVRQFMKSRMDFRIEDIRNL 2559
            +EF   EANDPWV+ FILN+E  +A+F+  + P++++ L   +   V + +EK++ K TFNRLGG+QFD+E+R++I +L T T W +RDKF RL Q+A+ILN+E   EI  YW      ++WRLTP+EVRQ +  R+DFR EDI+ L
Sbjct:  637 EEFNDYEANDPWVQQFILNLEQQMAEFKASLSPVIYDSLTGLMTSLVAVELEKVVLKSTFNRLGGLQFDKELRSLIAYLTTVTTWTIRDKFARLSQMATILNLERVTEILDYWGANSGPLTWRLTPAEVRQVLALRIDFRNEDIKRL 783          
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. UniProt/SwissProt
Match: sp|Q3MHG0|COG4_BOVIN (Conserved oligomeric Golgi complex subunit 4 OS=Bos taurus OX=9913 GN=COG4 PE=2 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 4.998e-35
Identity = 72/147 (48.98%), Postives = 104/147 (70.75%), Query Frame = 1
Query: 2131 DEFMSLEANDPWVESFILNVESILADFQEIMIPILFEKLIQKLCXXXXXXXXXXXXXXTFNRLGGIQFDREIRTVINFLATTTKWGVRDKFTRLRQIASILNMENPNEITSYWDN----VSWRLTPSEVRQFMKSRMDFRIEDIRNL 2559
            +EF   EANDPWV+ FILN+E  +A+F+  + P++++ L   +   V + +EK++ K TFNRLGG+QFD+E+R++I +L T T W +RDKF RL Q+A+ILN+E   EI  YW      ++WRLTP+EVRQ +  R+DFR EDI+ L
Sbjct:  637 EEFSDYEANDPWVQQFILNLEQQMAEFKAGLSPVIYDSLTSLMTSLVAVELEKVVLKSTFNRLGGLQFDKELRSLIAYLTTVTTWTIRDKFARLSQMATILNLERVTEILDYWGANSGPLTWRLTPAEVRQVLALRIDFRSEDIKRL 783          
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. UniProt/SwissProt
Match: sp|Q8R1U1|COG4_MOUSE (Conserved oligomeric Golgi complex subunit 4 OS=Mus musculus OX=10090 GN=Cog4 PE=1 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 1.188e-34
Identity = 72/147 (48.98%), Postives = 104/147 (70.75%), Query Frame = 1
Query: 2131 DEFMSLEANDPWVESFILNVESILADFQEIMIPILFEKLIQKLCXXXXXXXXXXXXXXTFNRLGGIQFDREIRTVINFLATTTKWGVRDKFTRLRQIASILNMENPNEITSYWDN----VSWRLTPSEVRQFMKSRMDFRIEDIRNL 2559
            +EF   EANDPWV+ FILN+E  +A+F+  + P++++ L   +   V + +EK++ K TFNRLGG+QFD+E+R++I +L T T W +RDKF RL Q+A+ILN+E   EI  YW      ++WRLTP+EVRQ +  R+DFR EDI+ L
Sbjct:  637 EEFNDYEANDPWVQQFILNLEQQMAEFKASLSPVIYDSLTGLMTSLVAVELEKVVLKSTFNRLGGLQFDKELRSLIAYLTTVTTWTIRDKFARLSQMATILNLERVTEILDYWGANSGPLTWRLTPAEVRQVLALRIDFRNEDIKRL 783          
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. UniProt/SwissProt
Match: sp|Q9H9E3|COG4_HUMAN (Conserved oligomeric Golgi complex subunit 4 OS=Homo sapiens OX=9606 GN=COG4 PE=1 SV=3)

HSP 1 Score: 145.976 bits (367), Expect = 1.231e-34
Identity = 72/147 (48.98%), Postives = 104/147 (70.75%), Query Frame = 1
Query: 2131 DEFMSLEANDPWVESFILNVESILADFQEIMIPILFEKLIQKLCXXXXXXXXXXXXXXTFNRLGGIQFDREIRTVINFLATTTKWGVRDKFTRLRQIASILNMENPNEITSYW----DNVSWRLTPSEVRQFMKSRMDFRIEDIRNL 2559
            +EF   EANDPWV+ FILN+E  +A+F+  + P++++ L   +   V + +EK++ K TFNRLGG+QFD+E+R++I +L T T W +RDKF RL Q+A+ILN+E   EI  YW      ++WRLTP+EVRQ +  R+DFR EDI+ L
Sbjct:  637 EEFNDYEANDPWVQQFILNLEQQMAEFKASLSPVIYDSLTGLMTSLVAVELEKVVLKSTFNRLGGLQFDKELRSLIAYLTTVTTWTIRDKFARLSQMATILNLERVTEILDYWGPNSGPLTWRLTPAEVRQVLALRIDFRSEDIKRL 783          
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. UniProt/SwissProt
Match: sp|Q5R7R6|COG4_PONAB (Conserved oligomeric Golgi complex subunit 4 OS=Pongo abelii OX=9601 GN=COG4 PE=2 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 1.590e-34
Identity = 72/147 (48.98%), Postives = 104/147 (70.75%), Query Frame = 1
Query: 2131 DEFMSLEANDPWVESFILNVESILADFQEIMIPILFEKLIQKLCXXXXXXXXXXXXXXTFNRLGGIQFDREIRTVINFLATTTKWGVRDKFTRLRQIASILNMENPNEITSYW----DNVSWRLTPSEVRQFMKSRMDFRIEDIRNL 2559
            +EF   EANDPWV+ FILN+E  +A+F+  + P++++ L   +   V + +EK++ K TFNRLGG+QFD+E+R++I +L T T W +RDKF RL Q+A+ILN+E   EI  YW      ++WRLTP+EVRQ +  R+DFR EDI+ L
Sbjct:  637 EEFNDYEANDPWVQQFILNLEQQMAEFKASLSPVIYDSLTGLMTSLVTVELEKVVLKSTFNRLGGLQFDKELRSLIAYLTTVTTWTIRDKFARLSQMATILNLERVTEILDYWGPNSGPLTWRLTPAEVRQVLALRIDFRSEDIKRL 783          
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. UniProt/SwissProt
Match: sp|Q29RB1|COG4_DANRE (Conserved oligomeric Golgi complex subunit 4 OS=Danio rerio OX=7955 GN=cog4 PE=1 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 1.494e-29
Identity = 61/140 (43.57%), Postives = 99/140 (70.71%), Query Frame = 1
Query: 2152 ANDPWVESFILNVESILADFQEIMIPILFEKLIQKLCXXXXXXXXXXXXXXTFNRLGGIQFDREIRTVINFLATTTKWGVRDKFTRLRQIASILNMENPNEITSYW----DNVSWRLTPSEVRQFMKSRMDFRIEDIRNL 2559
            ANDP+V+  I+ +E ++A+F+  + P++++ L   +   + + +EK + K TF+RLGG+QFD+E+R ++ +L++ T W +RDKF RL Q+A+ILN+E  +EI  YW      ++WRLTP+EVRQ +  R+DFR EDI+ L
Sbjct:  640 ANDPFVQQLIVQLEQLMAEFKVGLSPVIYDTLTSLMTSLIAMEMEKTVFKCTFSRLGGLQFDKELRALVAYLSSVTSWTIRDKFARLTQMATILNLERVSEILDYWGPNSGPLTWRLTPAEVRQVLALRVDFRSEDIKRL 779          
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. TrEMBL
Match: U6DBA4 (Component of oligomeric golgi complex 4, isoform CRA_b (Fragment) OS=Neovison vison OX=452646 GN=B4DDL2 PE=2 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 7.486e-36
Identity = 72/147 (48.98%), Postives = 104/147 (70.75%), Query Frame = 1
Query: 2131 DEFMSLEANDPWVESFILNVESILADFQEIMIPILFEKLIQKLCXXXXXXXXXXXXXXTFNRLGGIQFDREIRTVINFLATTTKWGVRDKFTRLRQIASILNMENPNEITSYWDN----VSWRLTPSEVRQFMKSRMDFRIEDIRNL 2559
            +EF   EANDPWV+ FILN+E  +A+F+  + P++++ L   +   V + +E+++ K TFNRLGG+QFD+E+R++I +L T T W +RDKF RL Q+A+ILN+E   EI  YW      ++WRLTP+EVRQ +  RMDFR EDI+ L
Sbjct:   99 EEFNDYEANDPWVQQFILNLEQQMAEFKASLSPVIYDSLTGLMTSLVAVELERVVLKSTFNRLGGLQFDKELRSLIAYLTTVTTWTIRDKFARLSQMATILNLERVTEILDYWGANSGPLTWRLTPAEVRQVLALRMDFRSEDIKRL 245          
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. TrEMBL
Match: A0A5E4A7C7 (Cog4 domain-containing protein OS=Marmota monax OX=9995 GN=MONAX_5E038466 PE=4 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 2.555e-34
Identity = 72/147 (48.98%), Postives = 104/147 (70.75%), Query Frame = 1
Query: 2131 DEFMSLEANDPWVESFILNVESILADFQEIMIPILFEKLIQKLCXXXXXXXXXXXXXXTFNRLGGIQFDREIRTVINFLATTTKWGVRDKFTRLRQIASILNMENPNEITSYWDN----VSWRLTPSEVRQFMKSRMDFRIEDIRNL 2559
            +EF   EANDPWV+ FILN+E  +A+F+  + P++++ L   +   V + +EK++ K TFNRLGG+QFD+E+R++I +L T T W +RDKF RL Q+A+ILN+E   EI  YW      ++WRLTP+EVRQ +  R+DFR EDI+ L
Sbjct:  215 EEFNDYEANDPWVQQFILNLEQQMAEFKASLSPVIYDSLTGLMTSLVAVELEKVVLKSTFNRLGGLQFDKELRSLIAYLTTVTTWTIRDKFARLSQMATILNLERVTEILDYWGANSGPLTWRLTPAEVRQVLALRIDFRSEDIKRL 361          
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. TrEMBL
Match: A0A5E4A728 (Cog4 domain-containing protein OS=Marmota monax OX=9995 GN=MONAX_5E038466 PE=4 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 2.848e-34
Identity = 72/147 (48.98%), Postives = 104/147 (70.75%), Query Frame = 1
Query: 2131 DEFMSLEANDPWVESFILNVESILADFQEIMIPILFEKLIQKLCXXXXXXXXXXXXXXTFNRLGGIQFDREIRTVINFLATTTKWGVRDKFTRLRQIASILNMENPNEITSYWDN----VSWRLTPSEVRQFMKSRMDFRIEDIRNL 2559
            +EF   EANDPWV+ FILN+E  +A+F+  + P++++ L   +   V + +EK++ K TFNRLGG+QFD+E+R++I +L T T W +RDKF RL Q+A+ILN+E   EI  YW      ++WRLTP+EVRQ +  R+DFR EDI+ L
Sbjct:  225 EEFNDYEANDPWVQQFILNLEQQMAEFKASLSPVIYDSLTGLMTSLVAVELEKVVLKSTFNRLGGLQFDKELRSLIAYLTTVTTWTIRDKFARLSQMATILNLERVTEILDYWGANSGPLTWRLTPAEVRQVLALRIDFRSEDIKRL 371          
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. TrEMBL
Match: A0A480SDX5 (Conserved oligomeric Golgi complex subunit 4 OS=Sus scrofa OX=9823 PE=4 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 7.176e-34
Identity = 72/147 (48.98%), Postives = 104/147 (70.75%), Query Frame = 1
Query: 2131 DEFMSLEANDPWVESFILNVESILADFQEIMIPILFEKLIQKLCXXXXXXXXXXXXXXTFNRLGGIQFDREIRTVINFLATTTKWGVRDKFTRLRQIASILNMENPNEITSYWDN----VSWRLTPSEVRQFMKSRMDFRIEDIRNL 2559
            +EF   EANDPWV+ FILN+E  +A+F+  + P++++ L   +   V + +EK++ K TFNRLGG+QFD+E+R++I +L T T W +RDKF RL Q+A+ILN+E   EI  YW      ++WRLTP+EVRQ +  R+DFR EDI+ L
Sbjct:  265 EEFNDYEANDPWVQQFILNLEQQMAEFKAGLSPVIYDSLTSLMTSLVAVELEKVVLKSTFNRLGGLQFDKELRSLIAYLTTVTTWTIRDKFARLSQMATILNLERVTEILDYWGANSGPLTWRLTPAEVRQVLALRIDFRSEDIKRL 411          
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. TrEMBL
Match: B4DDL2 (Component of oligomeric golgi complex 4, isoform CRA_b OS=Homo sapiens OX=9606 GN=COG4 PE=2 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 2.182e-33
Identity = 72/147 (48.98%), Postives = 104/147 (70.75%), Query Frame = 1
Query: 2131 DEFMSLEANDPWVESFILNVESILADFQEIMIPILFEKLIQKLCXXXXXXXXXXXXXXTFNRLGGIQFDREIRTVINFLATTTKWGVRDKFTRLRQIASILNMENPNEITSYW----DNVSWRLTPSEVRQFMKSRMDFRIEDIRNL 2559
            +EF   EANDPWV+ FILN+E  +A+F+  + P++++ L   +   V + +EK++ K TFNRLGG+QFD+E+R++I +L T T W +RDKF RL Q+A+ILN+E   EI  YW      ++WRLTP+EVRQ +  R+DFR EDI+ L
Sbjct:  299 EEFNDYEANDPWVQQFILNLEQQMAEFKASLSPVIYDSLTGLMTSLVAVELEKVVLKSTFNRLGGLQFDKELRSLIAYLTTVTTWTIRDKFARLSQMATILNLERVTEILDYWGPNSGPLTWRLTPAEVRQVLALRIDFRSEDIKRL 445          
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. Ensembl Cavefish
Match: ENSAMXT00000039226.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000099.1:564912:568121:1 gene:ENSAMXG00000042173.1 transcript:ENSAMXT00000039226.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.0542 bits (105), Expect = 2.470e-7
Identity = 42/136 (30.88%), Postives = 77/136 (56.62%), Query Frame = 3
Query:  117 KEKNINELVSSVNAXXXXXXXXXXXXXXXXXXHFPYLEMVITNNVILENFNHE-FEKRLANLQSIFEFPFGEIDNENIFSNITYTFQLI---SSNLELEILTLQSDIIFKFHVNENNFWNLLKEEKYSLFRSVAMK 512
            K+ ++  +VS+VNAFK KL L++SQ K +   HF  ++ ++ N    ++F+ E F   L  L+  F   F E+ N++I   ++  FQ +    + +++EI+ L++DI  K    + +FW L+  E+Y    + A+K
Sbjct:  399 KDCDVPHMVSAVNAFKVKLALWTSQLKCKKLTHFQNVDKMLNNISNKDSFHPENFCIHLNRLEEEFSKRFEEL-NKDIIEELSAKFQQVFELPNGVDMEIIDLENDIEMKARSRDKDFWGLVSRERYPSLSACALK 533          

HSP 2 Score: 30.4166 bits (67), Expect = 2.470e-7
Identity = 12/32 (37.50%), Postives = 20/32 (62.50%), Query Frame = 1
Query:  553 RSYLTDDHLMTSIRLCISDYKPNFTRLVDKME 648
            R+ LTD HL   +RL +S+Y P++    D ++
Sbjct:  559 RTCLTDAHLTDCVRLAVSNYTPDYKAPADSVQ 590          
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. Ensembl Sea Lamprey
Match: cog4 (component of oligomeric golgi complex 4 [Source:NCBI gene;Acc:569049])

HSP 1 Score: 135.576 bits (340), Expect = 6.010e-33
Identity = 65/146 (44.52%), Postives = 98/146 (67.12%), Query Frame = 1
Query: 2131 DEFMSLEANDPWVESFILNVESILADFQEIMIPILFEKLIQKLCXXXXXXXXXXXXXXTFNRLGGIQFDREIRTVINFLATTTKWGVRDKFTRLRQIASILNMENPNEITSYW---DNVSWRLTPSEVRQFMKSRMDFRIEDIRNL 2559
            +EF   EANDPW + FI+N E ++A+F+  + P +++ LI      +   +E+ + K TF+RLGG+QFD+E+R ++ +L + T W +RDKF RL Q+A+ILN+E   EI  YW     ++WRLTP+EVR+ +  R DFR EDI+ L
Sbjct:  624 EEFNDYEANDPWAQKFIVNFEQLMAEFKAAVSPSIYDSLIGLATGLISQEMERCVHKTTFSRLGGLQFDKELRALVAYLTSITTWTIRDKFARLTQMATILNLERVTEILDYWGPNGPLTWRLTPAEVRRALSLRADFRSEDIKRL 769          
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. Ensembl Nematostella
Match: EDO46453 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPW3])

HSP 1 Score: 125.946 bits (315), Expect = 1.023e-29
Identity = 68/188 (36.17%), Postives = 112/188 (59.57%), Query Frame = 1
Query: 2008 TNMYYSLAHCTMTYTSDNHIMDYFIHTLINFPLIRSIIFS*DEFMSLEANDPWVESFILNVESILADFQEIMIPILFEKLIQKLCXXXXXXXXXXXXXXTFNRLGGIQFDREIRTVINFLATTTKWGVRDKFTRLRQIASILNMENPNEITSYWDN----VSWRLTPSEVRQFMKSRMDFRIEDIRNL 2559
             N++  L    + +   N +M      +  F  I   I S +EF   E NDP++++FI +++S+L  F+  +    ++ L+  +  ++   +EK + K  FNRLGG+Q D+E+R+++ +L   T+W +RDKF RL QI+++LN+E  +EI  YW      ++WRLTP+EVRQ +  R+DFR EDI  L
Sbjct:  561 ANIFKDLLQEGICHLCANAVMPRLKPLIDGFSSISHNI-SEEEFSYYEVNDPFIQNFITHLDSVLTSFKGPLTTSNYDSLVSYVATDITALVEKAVIKTNFNRLGGLQLDKELRSLVGYLTAVTQWTIRDKFARLTQISTLLNLEKVSEIMDYWGANSGPLTWRLTPAEVRQVLALRIDFRSEDINRL 747          
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. Ensembl Medaka
Match: cog4 (component of oligomeric golgi complex 4 [Source:NCBI gene;Acc:101166702])

HSP 1 Score: 137.117 bits (344), Expect = 7.868e-33
Identity = 64/147 (43.54%), Postives = 102/147 (69.39%), Query Frame = 1
Query: 2131 DEFMSLEANDPWVESFILNVESILADFQEIMIPILFEKLIQKLCXXXXXXXXXXXXXXTFNRLGGIQFDREIRTVINFLATTTKWGVRDKFTRLRQIASILNMENPNEITSYW----DNVSWRLTPSEVRQFMKSRMDFRIEDIRNL 2559
            +EF   EANDPWV+  I+N+E ++ +F+  + P++++ +   +   + I +EK + K +F+RLGG+QFD+E+R+++ +L T T W +RDKF RL Q+A+ILN+E   EI  YW      ++WRLTP+EVR+ +  R+DFR EDI+ L
Sbjct:  625 EEFNDYEANDPWVQQLIVNLEQLMGEFKAALSPVIYDTMTSLMTSLIAIEMEKTVLKCSFSRLGGLQFDKELRSLVAYLTTVTTWTIRDKFARLTQMATILNLERVTEILDYWGPNSGPLTWRLTPAEVRRVLALRIDFRSEDIKRL 771          
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. Ensembl Medaka
Match: ENSORLT00000033470.1 (pep primary_assembly:ASM223467v1:22:24335229:24337076:1 gene:ENSORLG00000028972.1 transcript:ENSORLT00000033470.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.3294 bits (181), Expect = 1.689e-20
Identity = 51/161 (31.68%), Postives = 85/161 (52.80%), Query Frame = 3
Query:   93 HLIYNYREKEKNINELVSSVNAXXXXXXXXXXXXXXXXXXHFPYLEMVITNNV---------------ILENFNHEFEKRLAN---LQSIFEF---PFGEIDNENIFSNITYTFQLISSNLELEILTLQSDIIFKFHVNENNFWNLLKEEKYSLFRSVAMK 512
            HL    + K+K +   +S+VNAF+ KL +FS+Q + +   HFP ++  + +NV               ++     EFE R  +   L+    F   PF ++D  +    ++  F L + ++E+EILTLQ+D++ K H +  NFW L+ +EKYS   + AMK
Sbjct:  393 HLNRELQGKDKTVAHTISAVNAFRAKLSIFSTQLQKKKMLHFPSVQAALNDNVSASAALNEAVKKYSQVINRLGQEFEDRFCDFEQLEPCVSFVTNPFMQVDVTSTAEQLSALFTLNAGDVEMEILTLQNDLLLKAHQSAPNFWCLVDQEKYSGVCTAAMK 553          

HSP 2 Score: 38.1206 bits (87), Expect = 1.689e-20
Identity = 19/47 (40.43%), Postives = 27/47 (57.45%), Query Frame = 1
Query:  520 FSKEKHRGKSIRSYLTDDHLMTSIRLCISDYKPNFTRLVDKMEFHKS 660
            F K KHR     + LTD HL  S+R+ +S+Y P++  LV  M+   S
Sbjct:  573 FIKNKHR-----TCLTDAHLQDSLRIAVSNYSPDYNALVSSMQCQTS 614          

HSP 3 Score: 27.335 bits (59), Expect = 1.689e-20
Identity = 11/29 (37.93%), Postives = 16/29 (55.17%), Query Frame = 2
Query:    5 THGEKHKQLKDPVWIKKFEFLSDFMGH*N 91
            + GE    L+DP W+    FL+D  G+ N
Sbjct:  364 SKGEDTSLLEDPEWVLDLAFLTDLTGNLN 392          
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. Ensembl Medaka
Match: ENSORLT00000046355.1 (pep primary_assembly:ASM223467v1:21:4582475:4584322:1 gene:ENSORLG00000025904.1 transcript:ENSORLT00000046355.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 1.089e-13
Identity = 45/153 (29.41%), Postives = 74/153 (48.37%), Query Frame = 3
Query:  117 KEKNINELVSSVNAXXXXXXXXXXXXXXXXXXHFPYLEMVITNNV---------------ILENFNHEFEKRLANLQSI------FEFPFGEIDNENIFSNITYTFQLISSNLELEILTLQSDIIFKFHVNENNFWNLLKEEKYSLFRSVAMK 512
            K K + +++S++NAFK K+  FS+  + +   HFP ++ V+ +N                ++     EFE R  +L  +         PF   D       ++ TF L +  +E+EI+TLQ+D+  K +    NFW L+  EKYS   + AMK
Sbjct:  401 KGKTVVDMISALNAFKAKMNAFSADLQRKKVLHFPSVQSVLKDNASASETFEKVAEKYIEVINRLGQEFENRFCDLHQLEPCVFFISNPFMNGDTTCFAEQLSATFNLDAGQVEIEIITLQNDLHLKAYQAAPNFWRLVDTEKYSGVCTAAMK 553          

HSP 2 Score: 34.6538 bits (78), Expect = 1.089e-13
Identity = 18/47 (38.30%), Postives = 26/47 (55.32%), Query Frame = 1
Query:  520 FSKEKHRGKSIRSYLTDDHLMTSIRLCISDYKPNFTRLVDKMEFHKS 660
            F K KHR +     LTD HL  S+ + +S Y P++  LV+ M+   S
Sbjct:  573 FIKNKHRTR-----LTDAHLRDSLTVAVSSYTPDYNTLVNSMQCQSS 614          
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. Planmine SMEST
Match: SMESG000014264.1 (SMESG000014264.1)

HSP 1 Score: 268.855 bits (686), Expect = 7.063e-78
Identity = 147/158 (93.04%), Postives = 150/158 (94.94%), Query Frame = 1
Query: 2086 TLINFPLIRSIIFS*DEFMSLEANDPWVESFILNVESILADFQEIMIPILFEKLIQKLCXXXXXXXXXXXXXXTFNRLGGIQFDREIRTVINFLATTTKWGVRDKFTRLRQIASILNMENPNEITSYWDNVSWRLTPSEVRQFMKSRMDFRIEDIRNL 2559
            TL N   ++ I+   DEFMSLEANDPWVESFILNVESILADFQEIMIPILFEKLIQKLCEEVVIRIEKIIKKKTFNRLGGIQFDREIRTVINFLATTTKWGVRDKFTRLRQIASILNMENPNEITSYWDNVSWRLTPSEVRQFMKSRMDFRIEDIRNL
Sbjct:  597 TLQNLSSMKHILTE-DEFMSLEANDPWVESFILNVESILADFQEIMIPILFEKLIQKLCEEVVIRIEKIIKKKTFNRLGGIQFDREIRTVINFLATTTKWGVRDKFTRLRQIASILNMENPNEITSYWDNVSWRLTPSEVRQFMKSRMDFRIEDIRNL 753          
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. Planmine SMEST
Match: SMESG000054155.1 (SMESG000054155.1)

HSP 1 Score: 73.9442 bits (180), Expect = 2.751e-25
Identity = 39/68 (57.35%), Postives = 48/68 (70.59%), Query Frame = 1
Query:  514 SVFSKEKHRGKSIRSYLTDDHLMTSIRLCISDYKPNFTRLVDKMEFHKSA*KMNTKVLSIKYDAQNIY 717
            + F + K+     RS LTD HLM  I+LCISDYK  FTRLVD+ME H S  ++  KVLS+K+DAQNIY
Sbjct:  556 AAFFQMKNIKSEFRSSLTDRHLMAYIQLCISDYKLYFTRLVDEMECHTSTSEIYAKVLSLKHDAQNIY 623          

HSP 2 Score: 62.003 bits (149), Expect = 2.751e-25
Identity = 29/41 (70.73%), Postives = 35/41 (85.37%), Query Frame = 3
Query:  390 LELEILTLQSDIIFKFHVNENNFWNLLKEEKYSLFRSVAMK 512
            L+LEILTLQS++I K H +ENNF NL +EEKYSL RSVAM+
Sbjct:  503 LKLEILTLQSELILKSHASENNFCNLFQEEKYSLLRSVAMR 543          
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. Planmine SMEST
Match: SMESG000009055.1 (SMESG000009055.1)

HSP 1 Score: 44.2838 bits (103), Expect = 2.261e-6
Identity = 27/60 (45.00%), Postives = 34/60 (56.67%), Query Frame = 3
Query:  330 IDNENIFSNITYTFQLISSNLELEILTLQSDIIFKFHVN-ENNFWNLLKEEKYSLFRSVA 506
            ID E I + I       S+ LE EI+ L+SDI  K     E+NFWNL+ EEKY + R V 
Sbjct:  731 IDTEEIATQINEFLDSDSTCLEDEIIALKSDIQLKSRATTEDNFWNLISEEKYPILRIVV 790          

HSP 2 Score: 27.335 bits (59), Expect = 2.261e-6
Identity = 12/22 (54.55%), Postives = 15/22 (68.18%), Query Frame = 1
Query:  553 RSYLTDDHLMTSIRLCISDYKP 618
            RS LTD HL + +R+ IS Y P
Sbjct:  818 RSCLTDGHLASCLRIAISSYDP 839          
The following BLAST results are available for this feature:
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
COG42.674e-3548.98component of oligomeric golgi complex 4 [Source:HG... [more]
COG42.700e-3548.98component of oligomeric golgi complex 4 [Source:HG... [more]
COG42.008e-2944.93component of oligomeric golgi complex 4 [Source:HG... [more]
back to top
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cogc-41.363e-1232.12Conserved oligomeric Golgi complex subunit 4 [Sou... [more]
back to top
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG74565.914e-2541.61gene:FBgn0032258 transcript:FBtr0080038[more]
back to top
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cog41.980e-3043.57component of oligomeric golgi complex 4 [Source:NC... [more]
back to top
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cog41.396e-3447.62component of oligomeric golgi complex 4 [Source:NC... [more]
cog41.535e-3447.62component of oligomeric golgi complex 4 [Source:NC... [more]
cog41.694e-3447.62component of oligomeric golgi complex 4 [Source:NC... [more]
back to top
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Cog41.308e-3548.98component of oligomeric golgi complex 4 [Source:MG... [more]
Cog41.573e-3548.98component of oligomeric golgi complex 4 [Source:MG... [more]
Cog41.699e-3548.98component of oligomeric golgi complex 4 [Source:MG... [more]
back to top
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3MHG0|COG4_BOVIN4.998e-3548.98Conserved oligomeric Golgi complex subunit 4 OS=Bo... [more]
sp|Q8R1U1|COG4_MOUSE1.188e-3448.98Conserved oligomeric Golgi complex subunit 4 OS=Mu... [more]
sp|Q9H9E3|COG4_HUMAN1.231e-3448.98Conserved oligomeric Golgi complex subunit 4 OS=Ho... [more]
sp|Q5R7R6|COG4_PONAB1.590e-3448.98Conserved oligomeric Golgi complex subunit 4 OS=Po... [more]
sp|Q29RB1|COG4_DANRE1.494e-2943.57Conserved oligomeric Golgi complex subunit 4 OS=Da... [more]
back to top
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
U6DBA47.486e-3648.98Component of oligomeric golgi complex 4, isoform C... [more]
A0A5E4A7C72.555e-3448.98Cog4 domain-containing protein OS=Marmota monax OX... [more]
A0A5E4A7282.848e-3448.98Cog4 domain-containing protein OS=Marmota monax OX... [more]
A0A480SDX57.176e-3448.98Conserved oligomeric Golgi complex subunit 4 OS=Su... [more]
B4DDL22.182e-3348.98Component of oligomeric golgi complex 4, isoform C... [more]
back to top
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000039226.12.470e-730.88pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cog46.010e-3344.52component of oligomeric golgi complex 4 [Source:NC... [more]
back to top
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO464531.023e-2936.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cog47.868e-3343.54component of oligomeric golgi complex 4 [Source:NC... [more]
ENSORLT00000033470.11.689e-2031.68pep primary_assembly:ASM223467v1:22:24335229:24337... [more]
ENSORLT00000046355.11.089e-1329.41pep primary_assembly:ASM223467v1:21:4582475:458432... [more]
back to top
BLAST of Conserved oligomeric Golgi complex subunit 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000014264.17.063e-7893.04SMESG000014264.1[more]
SMESG000054155.12.751e-2557.35SMESG000054155.1[more]
SMESG000009055.12.261e-645.00SMESG000009055.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002952 ID=SMED30002952|Name=Conserved oligomeric Golgi complex subunit 4|organism=Schmidtea mediterranea sexual|type=transcript|length=2622bp
GGACACACACGGAGAAAAACATAAACAATTGAAAGATCCAGTATGGATAA
AAAAATTCGAATTTCTTTCGGATTTTATGGGCCATTAAAACTCACTTAAT
TTACAATTACAGGGAAAAGGAAAAAAATATTAATGAATTGGTCAGTTCAG
TAAATGCTTTTAAAGAAAAATTAAAACTTTTTTCTTCACAATTTAAAAGC
CAAAGTTTTAAACATTTTCCATATTTAGAAATGGTTATCACAAATAATGT
AATACTGGAAAATTTTAATCATGAATTTGAGAAACGATTAGCAAATCTCC
AATCGATTTTTGAATTTCCCTTTGGAGAAATCGATAACGAGAATATTTTT
TCAAATATAACGTATACCTTTCAATTGATTTCATCGAATCTAGAGTTAGA
AATTTTAACATTGCAATCAGATATAATTTTTAAATTCCATGTAAATGAAA
ATAATTTTTGGAATTTATTGAAAGAAGAAAAATATTCATTATTTAGATCG
GTGGCAATGAAGCAGCGTTTTCTCAAAAGAAAAACATCGAGGAAAAAGCA
TTAGGAGTTATCTGACTGATGACCACTTAATGACATCTATTCGATTGTGC
ATCAGTGATTACAAACCTAATTTTACAAGACTCGTAGATAAAATGGAATT
TCACAAATCTGCATAAAAAATGAATACAAAAGTTTTATCAATAAAGTATG
ATGCACAAAATATTTATCAATAAAGTATATCTATATTCCACAAAATAGTA
AATACAATTGACCTATTGAATATATTATTATTAATAAAGAGTCTAATTAA
ATCATTATTTGTTTTTAATTTAACCTATTTTTGGAAGGCATAAATAAGAA
AAATTTAAGTCCATCATACCAATAATCAGTTTGCCCACCCCTGCTTTAAT
TTGTGACCATTAAAAATTACATTTTAGAGTCATGAATGTCAACTAATTGG
AATTTGTTTATGATGCGCACAAATGTATATTTTTATACCTTCCAATATTG
GTTCAATGACTTATTCAGATCCAGTAAATACATTTTAGACCCTAAAACCA
ATGTTTTCTTTAATCGAAAACCAACCTTTTGACTATTAAAACAAAACCGG
TTACGTAATGACATTGGCCTATTATATAATATGACATTCAAATGACCTTG
AGTGGAGAGGCTATAGTGGCTAACGTCACAGTGTACTACTCCATTATCTT
ATGTGTTTTAAGATGAAATTTACATAATTATCACTGTATATTTAAGCATA
CAAATGTTTAAAATACTCAGATATAAAACCAATATATTTTAAACATAGAA
CCTAAATATAAGACAAAAGCTATTGTATTATTTATAAAATCTTCATTAAA
ATGTAAATTAATATGCAATCAATTAAAATCAATTTACATGAATTATATAG
ATCAAGGTCAATGCATGGCATAGCAAATATAAATCATTCCAGTGTTAATG
TTGTGTTTCACCATTCATGGCACCGAATATAGCAGACATTAAAAAGCACT
AATTTCAAAAATCACATTAAGTTCGAAGTCGTTCAGCGCATTGCATACAA
AGATGTAATATTATATATATATATTACATGTACAATGTATTTTTCATTTT
CATAATAAAACTAAACTTTTAAATCTATTTGTCTTTTTAACGACCCGACT
GCGTTCTAAATAATTTACCATGTGGCTCACATGCTGCAAAATGAATGTTT
GGAAATATTTTACATTTTAATAAGTTCTAAAAATGATGTTTTTTAATTTG
TACAAATTGTTCGATATTCAAGAGAAAAGTTAATTTCCAGAACATGTTAA
AATAAAAATACGTAGTTGATTAAAGATGAAGTTATGATAAACTTTTAATA
TAATGTAATGAATTGCGAACAACTGCATAGATCTAGTATATTTTATGTAC
TATGTGAAAGCATTTTTCTAAAACAAAGACAGTTTTTAAACTGCTACTAG
GCTGAATCTAAAATGGCAGTGATCTATTTATTATTGATACATTTTTAGAC
AAACCTTACAAACATGTATTACTCACTAGCTCATTGTACAATGACTTACA
CATCAGATAATCACATAATGGATTATTTTATTCATACACTTATTAATTTC
CCTCTGATTAGATCTATAATATTTTCGTAGGACGAATTTATGTCACTAGA
GGCAAATGATCCGTGGGTTGAAAGTTTTATTCTCAATGTTGAATCAATTT
TAGCAGATTTTCAAGAAATTATGATACCAATTTTATTTGAAAAATTAATA
CAAAAGTTATGTGAAGAAGTCGTCATTAGAATTGAAAAAATAATTAAAAA
GAAGACTTTCAATAGACTCGGTGGAATTCAGTTTGACAGAGAAATACGAA
CTGTCATTAATTTTTTGGCAACAACAACAAAGTGGGGAGTTCGAGATAAA
TTTACAAGACTACGTCAGATTGCTAGCATTTTAAATATGGAAAATCCGAA
TGAAATCACATCATATTGGGATAATGTGTCGTGGAGATTAACCCCGTCTG
AAGTGCGACAATTTATGAAGTCACGAATGGATTTCAGAATCGAGGATATT
CGCAATTTAAAATTTACTTGATAATTTAAGTTTTGTTTTTTAATATATCA
TTTTTGTTGAAAAAAAAGATCG
back to top

protein sequence of SMED30002952-orf-1

>SMED30002952-orf-1 ID=SMED30002952-orf-1|Name=SMED30002952-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=108bp
MVITNNVILENFNHEFEKRLANLQSIFEFPFGEIDNENIFSNITYTFQLI
SSNLELEILTLQSDIIFKFHVNENNFWNLLKEEKYSLFRSVAMKQRFLKR
KTSRKKH*
back to top

protein sequence of SMED30002952-orf-2

>SMED30002952-orf-2 ID=SMED30002952-orf-2|Name=SMED30002952-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=144bp
MSLEANDPWVESFILNVESILADFQEIMIPILFEKLIQKLCEEVVIRIEK
IIKKKTFNRLGGIQFDREIRTVINFLATTTKWGVRDKFTRLRQIASILNM
ENPNEITSYWDNVSWRLTPSEVRQFMKSRMDFRIEDIRNLKFT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005829cytosol
GO:0005737cytoplasm
GO:0000139Golgi membrane
GO:0005794Golgi apparatus
GO:0016020membrane
GO:0017119Golgi transport complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR009976Sec10-like
Vocabulary: biological process
TermDefinition
GO:0006887exocytosis
GO:0048278vesicle docking
GO:0000301retrograde transport, vesicle recycling within Golgi
GO:0006810transport
GO:0006890retrograde vesicle-mediated transport, Golgi to ER
GO:0007030Golgi organization
GO:0015031protein transport
GO:0048213Golgi vesicle prefusion complex stabilization
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.58.1970coord: 1..142
e-value: 3.2E-49
score: 168.8
NoneNo IPR availablePANTHERPTHR24016:SF0CONSERVED OLIGOMERIC GOLGI COMPLEX SUBUNIT 4coord: 4..142
NoneNo IPR availablePANTHERPTHR24016FAMILY NOT NAMEDcoord: 4..142