SMED30002950

Overview
NameSMED30002950
Smed IDSMED30002950
Length (bp)469
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30002950 (SMED30002950) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30002950 (SMED30002950) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30002950 (SMED30002950) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30002950 (SMED30002950) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002950

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30002950h1SMcG0003517 SmedASXL_015814SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30002950h1SMcG0003517 SmedASXL_015814SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30002950h1SMcG0003517 SmedASXL_001350SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30002950h1SMcG0003517 SmedASXL_001350SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30002950h1SMcG0003517 dd_Smed_v4_7797_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002950h1SMcG0003517 SmWIOct06_014582GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30002950h1SMcG0003517 SMED_24660_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30002950h1SMcG0003517 SMED_24660_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30002950h1SMcG0003517 SMED_07865_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30002950h1SMcG0003517 SMED_07865_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30002950h1SMcG0003517 SmWIOct06_021681GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Alignments
SMED30002950 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.003740:57335..57842 +2307
Homology
BLAST of SMED30002950 vs. Ensembl Human
Match: DDX55 (DEAD-box helicase 55 [Source:HGNC Symbol;Acc:HGNC:20085])

HSP 1 Score: 91.2781 bits (225), Expect = 4.410e-23
Identity = 46/102 (45.10%), Postives = 66/102 (64.71%), Query Frame = -1
Query:  131 SWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIE-LLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSNF 433
            SW+ L   L      AL+ L F   TP+Q+  IP F++ KD+ A+AVTGSGKTLAF+IPI+E LL   +  K + V ++I++PT ELA Q  E+ ++F  +F
Sbjct:    8 SWESLPVPLHPQVLGALRELGFPYMTPVQSATIPLFMRNKDVAAEAVTGSGKTLAFVIPILEILLRREEKLKKSQVGAIIITPTRELAIQIDEVLSHFTKHF 109          
BLAST of SMED30002950 vs. Ensembl Human
Match: DDX55 (DEAD-box helicase 55 [Source:HGNC Symbol;Acc:HGNC:20085])

HSP 1 Score: 88.9669 bits (219), Expect = 1.021e-20
Identity = 46/102 (45.10%), Postives = 66/102 (64.71%), Query Frame = -1
Query:  131 SWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIE-LLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSNF 433
            SW+ L   L      AL+ L F   TP+Q+  IP F++ KD+ A+AVTGSGKTLAF+IPI+E LL   +  K + V ++I++PT ELA Q  E+ ++F  +F
Sbjct:    8 SWESLPVPLHPQVLGALRELGFPYMTPVQSATIPLFMRNKDVAAEAVTGSGKTLAFVIPILEILLRREEKLKKSQVGAIIITPTRELAIQIDEVLSHFTKHF 109          
BLAST of SMED30002950 vs. Ensembl Human
Match: DDX55 (DEAD-box helicase 55 [Source:HGNC Symbol;Acc:HGNC:20085])

HSP 1 Score: 88.9669 bits (219), Expect = 1.021e-20
Identity = 46/102 (45.10%), Postives = 66/102 (64.71%), Query Frame = -1
Query:  131 SWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIE-LLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSNF 433
            SW+ L   L      AL+ L F   TP+Q+  IP F++ KD+ A+AVTGSGKTLAF+IPI+E LL   +  K + V ++I++PT ELA Q  E+ ++F  +F
Sbjct:    8 SWESLPVPLHPQVLGALRELGFPYMTPVQSATIPLFMRNKDVAAEAVTGSGKTLAFVIPILEILLRREEKLKKSQVGAIIITPTRELAIQIDEVLSHFTKHF 109          
BLAST of SMED30002950 vs. Ensembl Human
Match: DDX54 (DEAD-box helicase 54 [Source:HGNC Symbol;Acc:HGNC:20084])

HSP 1 Score: 71.633 bits (174), Expect = 1.957e-15
Identity = 42/94 (44.68%), Postives = 54/94 (57.45%), Query Frame = -1
Query:   89 FEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSNFNGSKPNLILFNKKI 370
            ++ PTPIQ   IP  L  KD+VA A TGSGKT  F++P+ E L    +   T   ++ILSPT ELA QT + F   L  F G K  LIL   ++
Sbjct:   33 YKVPTPIQRKTIPVILDGKDVVAMARTGSGKTACFLLPMFERLKTHSA--QTGARALILSPTRELALQTLK-FTKELGKFTGLKTALILGGDRM 123          
BLAST of SMED30002950 vs. Ensembl Human
Match: DDX46 (DEAD-box helicase 46 [Source:HGNC Symbol;Acc:HGNC:18681])

HSP 1 Score: 72.4034 bits (176), Expect = 5.089e-15
Identity = 38/90 (42.22%), Postives = 56/90 (62.22%), Query Frame = -1
Query:  167 SWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDSFKSTD-VFSVILSPTSELANQ 433
            SW  + C +S    N+LK   +EKPTPIQT  IP  +  +DL+  A TGSGKT+AF++P+   + +  S +  +   +VI++PT ELA Q
Sbjct:  325 SW--VQCGISMKILNSLKKHGYEKPTPIQTQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHIMDQRSLEEGEGPIAVIMTPTRELALQ 412          
BLAST of SMED30002950 vs. Ensembl Celegans
Match: F53H1.1 (pep chromosome:WBcel235:IV:1297222:1309652:-1 gene:WBGene00018776.1 transcript:F53H1.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F53H1.1)

HSP 1 Score: 73.559 bits (179), Expect = 9.383e-16
Identity = 39/98 (39.80%), Postives = 57/98 (58.16%), Query Frame = -1
Query:  143 SWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPII-ELLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNF 433
            +W   G  L     N LK  ++ KPT IQ   IP  +  +D++  A TGSGKTLAF++P+   +L++ +  +     +VIL+PT ELA QTY+  N F
Sbjct:  305 TWAQCGVNL--KMMNVLKKFEYSKPTSIQAQAIPSIMSGRDVIGIAKTGSGKTLAFLLPMFRHILDQPELEEGDGPIAVILAPTRELAMQTYKEANKF 400          
BLAST of SMED30002950 vs. Ensembl Celegans
Match: F53H1.1 (pep chromosome:WBcel235:IV:1297400:1309644:-1 gene:WBGene00018776.1 transcript:F53H1.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F53H1.1)

HSP 1 Score: 73.559 bits (179), Expect = 9.531e-16
Identity = 39/98 (39.80%), Postives = 55/98 (56.12%), Query Frame = -1
Query:  143 SWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDSFKSTD-VFSVILSPTSELANQTYEMFNNF 433
            +W   G  L     N LK  ++ KPT IQ   IP  +  +D++  A TGSGKTLAF++P+   + +    +  D   +VIL+PT ELA QTY+  N F
Sbjct:  305 TWAQCGVNL--KMMNVLKKFEYSKPTSIQAQAIPSIMSGRDVIGIAKTGSGKTLAFLLPMFRHILDQPELEEGDGPIAVILAPTRELAMQTYKEANKF 400          
BLAST of SMED30002950 vs. Ensembl Celegans
Match: Y94H6A.5 (ATP-dependent RNA helicase [Source:UniProtKB/TrEMBL;Acc:Q688Z3])

HSP 1 Score: 72.4034 bits (176), Expect = 2.130e-15
Identity = 40/102 (39.22%), Postives = 62/102 (60.78%), Query Frame = -1
Query:  125 WKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSNFNG 430
            W+ +G  L  +   A++   F +PTPIQ   IP  +  KD+VA + TGSGKT AF+IP+++ L   D   +T + ++++SPT ELA QT+++    L  F G
Sbjct:   26 WQQIG--LDHSVYKAIEKKGFNQPTPIQRKTIPCIMDGKDVVAMSRTGSGKTAAFVIPMLQKLKRRD---TTGIRALMVSPTRELALQTFKVVKE-LGRFTG 121          
BLAST of SMED30002950 vs. Ensembl Celegans
Match: B0511.6 (RNA helicase [Source:UniProtKB/TrEMBL;Acc:O61815])

HSP 1 Score: 71.633 bits (174), Expect = 4.215e-15
Identity = 40/98 (40.82%), Postives = 59/98 (60.20%), Query Frame = -1
Query:  128 LGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSNFN 421
            L  K++ N   A++ L F   T IQ   I   L+ KD++A A TGSGKTLAF++P IELL++++  +      +I+SPT EL+ QTY + +  L   N
Sbjct:   71 LEGKVNANLLKAVQGLGFTTMTEIQAKSIDPLLEGKDVLASAKTGSGKTLAFLLPAIELLHKLNWKQHNGTGVIIVSPTRELSMQTYGVLSELLEGSN 168          
BLAST of SMED30002950 vs. Ensembl Celegans
Match: ddx-52 (DEAD boX helicase homolog [Source:UniProtKB/TrEMBL;Acc:Q21736])

HSP 1 Score: 69.3218 bits (168), Expect = 2.772e-14
Identity = 39/106 (36.79%), Postives = 61/106 (57.55%), Query Frame = -1
Query:  110 LSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEM------DSFKSTDVFSVILSPTSELANQTYEMFNNFLSNFNGSKPNL 409
            +S +  N L      +P+PIQ   IP   ++++++A A TGSGKTLAF +P+I+ + E+       S  S+ + +V+L PT ELA QTY  F  + +N + S  N 
Sbjct:  133 MSPSLLNRLSENSIRQPSPIQMQSIPFMTERRNVLASAPTGSGKTLAFALPVIDEILELKQRADYSSSNSSKLLAVVLEPTRELAAQTYTEFLKYCANTSISAANF 238          
BLAST of SMED30002950 vs. Ensembl Fly
Match: CG5800 (gene:FBgn0030855 transcript:FBtr0074453)

HSP 1 Score: 77.411 bits (189), Expect = 6.164e-17
Identity = 48/116 (41.38%), Postives = 69/116 (59.48%), Query Frame = -1
Query:   65 LSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDSFKSTD-VFSVILSPTSELANQTYEMFNNFLSNFNGSKPNLILFNKKIRILKFRVE 409
            LSK T  AL   KF  PT +Q   I   LQ KD++  A+TGSGKTLAF+IP++E L  M+ +  TD V ++I+SPT ELA Q +E       + + S   LI+  K ++  + R++
Sbjct:   79 LSKKTQKALAESKFVHPTQVQRDSIGPALQGKDVLGAAITGSGKTLAFLIPVLEHLF-MNKWSRTDGVGAIIISPTRELAYQIFETLKKVGKHHDFS-AGLIIGGKNLKFERTRMD 192          
BLAST of SMED30002950 vs. Ensembl Fly
Match: pit (gene:FBgn0266581 transcript:FBtr0084174)

HSP 1 Score: 75.485 bits (184), Expect = 2.674e-16
Identity = 39/107 (36.45%), Postives = 64/107 (59.81%), Query Frame = -1
Query:  128 DTKDISWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSNFN 448
            D+ D S+  L   +S+ T  A+K + F + T IQ+  +   L+ +DLV  A TGSGKTLAF+IP +EL+N++          +I+SPT EL+ QT+ +    +++ +
Sbjct:  181 DSDDRSFASLKGAVSEATLRAIKEMGFTEMTEIQSKSLTPLLKGRDLVGAAQTGSGKTLAFLIPAVELINKLRFMPRNGTGVIIISPTRELSMQTFGVLKELMAHHH 287          
BLAST of SMED30002950 vs. Ensembl Fly
Match: pit (gene:FBgn0266581 transcript:FBtr0346345)

HSP 1 Score: 75.485 bits (184), Expect = 2.674e-16
Identity = 39/107 (36.45%), Postives = 64/107 (59.81%), Query Frame = -1
Query:  128 DTKDISWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSNFN 448
            D+ D S+  L   +S+ T  A+K + F + T IQ+  +   L+ +DLV  A TGSGKTLAF+IP +EL+N++          +I+SPT EL+ QT+ +    +++ +
Sbjct:  181 DSDDRSFASLKGAVSEATLRAIKEMGFTEMTEIQSKSLTPLLKGRDLVGAAQTGSGKTLAFLIPAVELINKLRFMPRNGTGVIIISPTRELSMQTFGVLKELMAHHH 287          
BLAST of SMED30002950 vs. Ensembl Fly
Match: pit (gene:FBgn0266581 transcript:FBtr0084175)

HSP 1 Score: 75.485 bits (184), Expect = 2.674e-16
Identity = 39/107 (36.45%), Postives = 64/107 (59.81%), Query Frame = -1
Query:  128 DTKDISWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSNFN 448
            D+ D S+  L   +S+ T  A+K + F + T IQ+  +   L+ +DLV  A TGSGKTLAF+IP +EL+N++          +I+SPT EL+ QT+ +    +++ +
Sbjct:  181 DSDDRSFASLKGAVSEATLRAIKEMGFTEMTEIQSKSLTPLLKGRDLVGAAQTGSGKTLAFLIPAVELINKLRFMPRNGTGVIIISPTRELSMQTFGVLKELMAHHH 287          
BLAST of SMED30002950 vs. Ensembl Fly
Match: CG9630 (gene:FBgn0037561 transcript:FBtr0081866)

HSP 1 Score: 73.9442 bits (180), Expect = 7.444e-16
Identity = 37/95 (38.95%), Postives = 61/95 (64.21%), Query Frame = -1
Query:  134 LSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELL---NEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSN 409
            LS      ++   F++ TP+QT  IP  L +KD+ A+AVTGSGKTLAF++P++E+L   ++   +   ++ ++++SPT ELA Q  E+   FL +
Sbjct:   14 LSDAVLQVVQSFGFQQMTPVQTAAIPLLLARKDVSAEAVTGSGKTLAFLVPMLEILQRRHKETPWGPKEIGALVISPTRELARQISEVLAQFLEH 108          
BLAST of SMED30002950 vs. Ensembl Zebrafish
Match: ddx55 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 55 [Source:NCBI gene;Acc:286745])

HSP 1 Score: 88.9669 bits (219), Expect = 6.990e-21
Identity = 48/104 (46.15%), Postives = 61/104 (58.65%), Query Frame = -1
Query:  131 DISWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIE-LLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSNF 439
            D  W  L  KL  N    LK L F   TP+Q+  IP F+  KD+ A+AVTGSGKTLAF+IP +E LL   +  K   V ++I++PT ELA Q  E+   FL  F
Sbjct:    6 DGKWGSLPVKLHDNILQTLKELGFTYMTPVQSACIPLFMSNKDVAAEAVTGSGKTLAFVIPALEILLKREEKLKKMQVGALIITPTRELAMQISEVMGRFLQGF 109          
BLAST of SMED30002950 vs. Ensembl Zebrafish
Match: ddx18 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 18 [Source:ZFIN;Acc:ZDB-GENE-030131-9685])

HSP 1 Score: 73.559 bits (179), Expect = 1.573e-15
Identity = 40/103 (38.83%), Postives = 61/103 (59.22%), Query Frame = -1
Query:  134 KDISWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSN 442
            +D S+  L   +S+NT   +K + F+  T IQ   I   L+ +D++A A TGSGKTLAF+IP IEL+ ++          ++LSPT ELA QTY +    +++
Sbjct:  157 EDRSFASLSEVVSENTLKGVKEMGFDTMTEIQHKTIRPLLEGRDVLAAAKTGSGKTLAFLIPSIELIYKLKFMPRNGTGVIVLSPTRELAMQTYGVLKELMTH 259          
BLAST of SMED30002950 vs. Ensembl Zebrafish
Match: ddx46 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:NCBI gene;Acc:321948])

HSP 1 Score: 72.0182 bits (175), Expect = 5.839e-15
Identity = 36/84 (42.86%), Postives = 53/84 (63.10%), Query Frame = -1
Query:  167 CKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPII-ELLNEMDSFKSTDVFSVILSPTSELANQ 415
            C +S    NALK   +EKPTPIQ   IP  +  +DL+  A TGSGKT+AF++P+   +L++    ++    +VI++PT ELA Q
Sbjct:  345 CGISMKVLNALKKHNYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHILDQRPVGEAEGPLAVIMTPTRELALQ 428          
BLAST of SMED30002950 vs. Ensembl Zebrafish
Match: ddx54 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 54 [Source:ZFIN;Acc:ZDB-GENE-021220-2])

HSP 1 Score: 70.0922 bits (170), Expect = 2.410e-14
Identity = 41/89 (46.07%), Postives = 53/89 (59.55%), Query Frame = -1
Query:  104 FEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSNFNGSKPNLIL 370
            ++ PTPIQ   IP  L  KD+VA A TGSGKT AF++P+ E L    +   T   ++IL+PT ELA QT + F   L  F G +  LIL
Sbjct:   98 YKVPTPIQRKTIPVILDGKDVVAMARTGSGKTAAFLVPLFEKLKAPQA--QTGARALILTPTRELALQTMK-FTKELGKFTGLRTALIL 183          
BLAST of SMED30002950 vs. Ensembl Zebrafish
Match: ddx31 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 31 [Source:ZFIN;Acc:ZDB-GENE-030131-3973])

HSP 1 Score: 67.0106 bits (162), Expect = 3.060e-13
Identity = 37/110 (33.64%), Postives = 59/110 (53.64%), Query Frame = -1
Query:   59 KCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDS--FKSTDVFSVILSPTSELANQTYEMFNNFLSNFNGSKPNLILFNKKIRILKFRVE*G 382
            K L     T +Q   IP  +  KD V ++ TGSGKTLA+ IP+++ L  +     +S    +V++ PT ELA Q+++MF   L  F    P +++  +K +  K R+  G
Sbjct:  171 KVLNVSSMTSVQKQTIPVLMSGKDAVVRSQTGSGKTLAYGIPMVQFLQAIQPKVKRSDGPLAVVIVPTRELALQSFQMFQKLLRPFTWIVPGVLMGGEKKKAEKARLRKG 280          
BLAST of SMED30002950 vs. Ensembl Xenopus
Match: ddx55 (DEAD-box helicase 55 [Source:NCBI gene;Acc:100145293])

HSP 1 Score: 88.1965 bits (217), Expect = 1.960e-20
Identity = 44/102 (43.14%), Postives = 64/102 (62.75%), Query Frame = -1
Query:  131 SWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIE-LLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSNF 433
            +W  L  KL+ +    L  LKF   TP+Q+  IP F+  KD+ A+A+TGSGKTLAF+IP++E LL   +  K   V ++I++PT ELA Q  E+ + F  +F
Sbjct:    8 TWDSLSHKLNSSIRQTLSELKFTHMTPVQSATIPLFMNNKDIAAEAITGSGKTLAFVIPLLEILLKREEKLKKNQVGAIIITPTRELAVQIDEVLSYFTKHF 109          
BLAST of SMED30002950 vs. Ensembl Xenopus
Match: ddx55 (DEAD-box helicase 55 [Source:NCBI gene;Acc:100145293])

HSP 1 Score: 87.8113 bits (216), Expect = 2.451e-20
Identity = 44/102 (43.14%), Postives = 64/102 (62.75%), Query Frame = -1
Query:  131 SWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIE-LLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSNF 433
            +W  L  KL+ +    L  LKF   TP+Q+  IP F+  KD+ A+A+TGSGKTLAF+IP++E LL   +  K   V ++I++PT ELA Q  E+ + F  +F
Sbjct:    8 TWDSLSHKLNSSIRQTLSELKFTHMTPVQSATIPLFMNNKDIAAEAITGSGKTLAFVIPLLEILLKREEKLKKNQVGAIIITPTRELAVQIDEVLSYFTKHF 109          
BLAST of SMED30002950 vs. Ensembl Xenopus
Match: ddx55 (DEAD-box helicase 55 [Source:NCBI gene;Acc:100145293])

HSP 1 Score: 87.8113 bits (216), Expect = 2.455e-20
Identity = 44/102 (43.14%), Postives = 64/102 (62.75%), Query Frame = -1
Query:  131 SWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIE-LLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSNF 433
            +W  L  KL+ +    L  LKF   TP+Q+  IP F+  KD+ A+A+TGSGKTLAF+IP++E LL   +  K   V ++I++PT ELA Q  E+ + F  +F
Sbjct:   11 TWDSLSHKLNSSIRQTLSELKFTHMTPVQSATIPLFMNNKDIAAEAITGSGKTLAFVIPLLEILLKREEKLKKNQVGAIIITPTRELAVQIDEVLSYFTKHF 112          
BLAST of SMED30002950 vs. Ensembl Xenopus
Match: DDX54 (DEAD-box helicase 54 [Source:NCBI gene;Acc:733994])

HSP 1 Score: 77.0258 bits (188), Expect = 1.466e-16
Identity = 47/94 (50.00%), Postives = 55/94 (58.51%), Query Frame = -1
Query:   89 FEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSNFNGSKPNLILFNKKI 370
            ++ PTPIQ  VIP  L  KD+VA A TGSGKT  F+IP+ E L    +   T V  +ILSPT ELA QT + F   L  F G K  LIL   KI
Sbjct:   71 YKVPTPIQRKVIPVILDGKDVVAMARTGSGKTACFLIPMFEKLKAHSA--QTGVRGLILSPTRELALQTLK-FTKELGKFTGLKTALILGGDKI 161          
BLAST of SMED30002950 vs. Ensembl Xenopus
Match: DDX54 (DEAD-box helicase 54 [Source:NCBI gene;Acc:733994])

HSP 1 Score: 73.559 bits (179), Expect = 2.291e-15
Identity = 47/94 (50.00%), Postives = 55/94 (58.51%), Query Frame = -1
Query:   89 FEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSNFNGSKPNLILFNKKI 370
            ++ PTPIQ  VIP  L  KD+VA A TGSGKT  F+IP+ E L    +   T V  +ILSPT ELA QT + F   L  F G K  LIL   KI
Sbjct:   69 YKVPTPIQRKVIPVILDGKDVVAMARTGSGKTACFLIPMFEKLKAHSA--QTGVRGLILSPTRELALQTLK-FTKELGKFTGLKTALILGGDKI 159          
BLAST of SMED30002950 vs. Ensembl Mouse
Match: Ddx55 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 55 [Source:MGI Symbol;Acc:MGI:1915098])

HSP 1 Score: 87.0409 bits (214), Expect = 3.518e-20
Identity = 44/102 (43.14%), Postives = 65/102 (63.73%), Query Frame = -1
Query:  131 SWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIE-LLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSNF 433
            +W+ L   L      AL+ L F   TP+Q+  IP F++ KD+ A+AVTGSGKTLAF+IPI+E LL   +  K   V +++++PT ELA Q  E+ ++F  +F
Sbjct:    8 AWESLQVPLHPRVLGALRELGFPHMTPVQSATIPLFMKNKDVAAEAVTGSGKTLAFVIPILEILLRREEKLKKNQVGAIVITPTRELAIQIDEVLSHFTKHF 109          
BLAST of SMED30002950 vs. Ensembl Mouse
Match: Ddx55 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 55 [Source:MGI Symbol;Acc:MGI:1915098])

HSP 1 Score: 87.0409 bits (214), Expect = 3.525e-20
Identity = 44/102 (43.14%), Postives = 65/102 (63.73%), Query Frame = -1
Query:  131 SWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIE-LLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSNF 433
            +W+ L   L      AL+ L F   TP+Q+  IP F++ KD+ A+AVTGSGKTLAF+IPI+E LL   +  K   V +++++PT ELA Q  E+ ++F  +F
Sbjct:    8 AWESLQVPLHPRVLGALRELGFPHMTPVQSATIPLFMKNKDVAAEAVTGSGKTLAFVIPILEILLRREEKLKKNQVGAIVITPTRELAIQIDEVLSHFTKHF 109          
BLAST of SMED30002950 vs. Ensembl Mouse
Match: Ddx18 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 18 [Source:MGI Symbol;Acc:MGI:1914192])

HSP 1 Score: 73.9442 bits (180), Expect = 1.389e-15
Identity = 40/103 (38.83%), Postives = 64/103 (62.14%), Query Frame = -1
Query:  134 KDISWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSN 442
            +D S+  L   +++NT  A++ + F++ T IQ   I   L+ +DL+A A TGSGKTLAF+IP+IEL+ ++          +ILSPT ELA QT+ +    +++
Sbjct:  165 EDTSFASLSNLVNENTLKAIEEMGFKRMTEIQHKSIRPLLEGRDLLAAAKTGSGKTLAFLIPVIELIVKLKFMPRNGTGVLILSPTRELAMQTFGVLKELMTH 267          
BLAST of SMED30002950 vs. Ensembl Mouse
Match: Ddx55 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 55 [Source:MGI Symbol;Acc:MGI:1915098])

HSP 1 Score: 68.9366 bits (167), Expect = 2.951e-15
Identity = 32/64 (50.00%), Postives = 44/64 (68.75%), Query Frame = -1
Query:  242 SWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELL 433
            +W+ L   L      AL+ L F   TP+Q+  IP F++ KD+ A+AVTGSGKTLAF+IPI+E+L
Sbjct:    8 AWESLQVPLHPRVLGALRELGFPHMTPVQSATIPLFMKNKDVAAEAVTGSGKTLAFVIPILEIL 71          
BLAST of SMED30002950 vs. Ensembl Mouse
Match: Ddx46 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:MGI Symbol;Acc:MGI:1920895])

HSP 1 Score: 72.4034 bits (176), Expect = 4.129e-15
Identity = 38/90 (42.22%), Postives = 56/90 (62.22%), Query Frame = -1
Query:  167 SWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDSFKSTD-VFSVILSPTSELANQ 433
            SW  + C +S    N+LK   +EKPTPIQT  IP  +  +DL+  A TGSGKT+AF++P+   + +  S +  +   +VI++PT ELA Q
Sbjct:  373 SW--VQCGISMKILNSLKKHGYEKPTPIQTQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHIMDQRSLEEGEGPIAVIMTPTRELALQ 460          
BLAST of SMED30002950 vs. UniProt/SwissProt
Match: sp|Q6CN92|SPB4_KLULA (ATP-dependent rRNA helicase SPB4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=SPB4 PE=3 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 1.281e-21
Identity = 47/109 (43.12%), Postives = 71/109 (65.14%), Query Frame = -1
Query:  131 TKDISWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELL--NEMDS--FKSTDVFSVILSPTSELANQTYEMFNNFLSNF 445
            +K +SW DL C++      A++ + FE  TP+Q   IP F   KD+V ++VTGSGKT+AF+IPI+E L   E +S  FK +   S+I+SPT ELA+Q +++  +FL  +
Sbjct:    2 SKSLSWDDLKCEIQPWIRTAIESMGFETMTPVQASTIPLFSGNKDVVVESVTGSGKTIAFVIPILERLIKEEANSAKFKKSHFHSLIISPTRELASQIHDVIEDFLKYY 110          
BLAST of SMED30002950 vs. UniProt/SwissProt
Match: sp|Q54EC2|DDX55_DICDI (Probable ATP-dependent RNA helicase ddx55 OS=Dictyostelium discoideum OX=44689 GN=ddx55 PE=3 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 3.650e-21
Identity = 48/103 (46.60%), Postives = 68/103 (66.02%), Query Frame = -1
Query:  128 SWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIE-LLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSNFN 433
             W  L  KLS +T N +  L F+  +P+Q+ VIP F+  KD++ +A TGSGKTLAF+IPIIE +L    + K TD+ S+I+SPT ELA Q  ++   FL++ N
Sbjct:    9 GWNKLENKLSDSTLNTINRLGFKSMSPVQSAVIPLFMSNKDVLVEACTGSGKTLAFVIPIIEKILKRETNLKKTDIASIIISPTRELAIQIQQVLLEFLNDLN 111          
BLAST of SMED30002950 vs. UniProt/SwissProt
Match: sp|Q8NHQ9|DDX55_HUMAN (ATP-dependent RNA helicase DDX55 OS=Homo sapiens OX=9606 GN=DDX55 PE=1 SV=3)

HSP 1 Score: 88.9669 bits (219), Expect = 4.901e-20
Identity = 46/102 (45.10%), Postives = 66/102 (64.71%), Query Frame = -1
Query:  131 SWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIE-LLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSNF 433
            SW+ L   L      AL+ L F   TP+Q+  IP F++ KD+ A+AVTGSGKTLAF+IPI+E LL   +  K + V ++I++PT ELA Q  E+ ++F  +F
Sbjct:    8 SWESLPVPLHPQVLGALRELGFPYMTPVQSATIPLFMRNKDVAAEAVTGSGKTLAFVIPILEILLRREEKLKKSQVGAIIITPTRELAIQIDEVLSHFTKHF 109          
BLAST of SMED30002950 vs. UniProt/SwissProt
Match: sp|Q8JHJ2|DDX55_DANRE (ATP-dependent RNA helicase DDX55 OS=Danio rerio OX=7955 GN=ddx55 PE=2 SV=2)

HSP 1 Score: 88.9669 bits (219), Expect = 5.176e-20
Identity = 48/104 (46.15%), Postives = 61/104 (58.65%), Query Frame = -1
Query:  131 DISWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIE-LLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSNF 439
            D  W  L  KL  N    LK L F   TP+Q+  IP F+  KD+ A+AVTGSGKTLAF+IP +E LL   +  K   V ++I++PT ELA Q  E+   FL  F
Sbjct:    6 DGKWGSLPVKLHDNILQTLKELGFTYMTPVQSACIPLFMSNKDVAAEAVTGSGKTLAFVIPALEILLKREEKLKKMQVGALIITPTRELAMQISEVMGRFLQGF 109          
BLAST of SMED30002950 vs. UniProt/SwissProt
Match: sp|Q5ZLN8|DDX55_CHICK (ATP-dependent RNA helicase DDX55 OS=Gallus gallus OX=9031 GN=DDX55 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 8.070e-20
Identity = 46/101 (45.54%), Postives = 64/101 (63.37%), Query Frame = -1
Query:  131 WKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIE-LLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSNF 430
            W  L   LS     AL+ L F++ TP+Q+  IP F+  KD+ A+AVTGSGKTLAF+IPI+E LL   +  K   V ++I++PT ELA Q  E+  +F  +F
Sbjct:    9 WSSLPVALSPGVLRALQDLGFDRMTPVQSATIPLFMSNKDVAAEAVTGSGKTLAFVIPILEILLRREEKLKKMQVGAIIITPTRELAIQIDEVLTHFTKHF 109          
BLAST of SMED30002950 vs. TrEMBL
Match: D6WYU0 (RNA helicase OS=Tribolium castaneum OX=7070 GN=TcasGA2_TC006038 PE=3 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 1.698e-25
Identity = 51/103 (49.51%), Postives = 72/103 (69.90%), Query Frame = -1
Query:  125 SWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSNFNG 433
            SW +LG KL K   NA+K L F   TPIQ   IP+ L KKD+VA+AVTGSGKTLAF+IP++++L + D +K  ++ ++I+SPT ELA Q  ++ N  L + +G
Sbjct:    4 SWAELGVKLHKEVQNAVKTLNFPTMTPIQAAAIPQLLNKKDVVAEAVTGSGKTLAFLIPLLQILKQRDKWKKAEIGALIISPTRELATQINQVLNQLLESISG 106          
BLAST of SMED30002950 vs. TrEMBL
Match: A0A180GHF6 (RNA helicase OS=Puccinia triticina (isolate 1-1 / race 1 (BBBD)) OX=630390 GN=PTTG_02665 PE=3 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 6.199e-23
Identity = 50/97 (51.55%), Postives = 69/97 (71.13%), Query Frame = -1
Query:  134 DLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSN 424
            DL   L+   ++ +K L F + TP+Q H IP FLQ KD+V QAVTGSGKTLAF+IPIIE L +++    + V ++I+SPT ELA+QT+++ N FL N
Sbjct:   13 DLKPPLTSWVSDTIKSLGFHQMTPVQAHTIPLFLQNKDVVVQAVTGSGKTLAFLIPIIERLVQLEQRPKSHVAAIIISPTRELASQTFQVLNQFLDN 109          
BLAST of SMED30002950 vs. TrEMBL
Match: A0A1B6KBR8 (Uncharacterized protein (Fragment) OS=Graphocephala atropunctata OX=36148 GN=g.18868 PE=4 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 1.319e-22
Identity = 54/106 (50.94%), Postives = 70/106 (66.04%), Query Frame = -1
Query:  131 DISWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIE-LLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFL--SNF 439
            D SW ++   LSK   N +K L F+  TP+Q   IP  L+ KD+ AQAVTGSGKTLAF+IPI+E LL   D +K  +V ++I+SPT ELA Q  E+ + FL  SNF
Sbjct:    2 DSSWSNIKPSLSKTNLNTIKSLGFQSMTPVQASCIPLLLRNKDVAAQAVTGSGKTLAFVIPIMELLLKRDDKWKPHEVGAIIISPTRELALQISEVLDKFLIHSNF 107          
BLAST of SMED30002950 vs. TrEMBL
Match: A0A0L0VLZ9 (RNA helicase OS=Puccinia striiformis f. sp. tritici PST-78 OX=1165861 GN=PSTG_06421 PE=3 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 3.872e-22
Identity = 50/100 (50.00%), Postives = 69/100 (69.00%), Query Frame = -1
Query:  134 SWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSN 433
            S+ DL   L+    + +K L F + TP+Q H IP FL+ KD+V QAVTGSGKTLAF+IPIIE L +++    + V ++I+SPT ELA QT+++ N FL N
Sbjct:   10 SFDDLNPPLASWVLDTIKSLGFHQMTPVQAHTIPLFLENKDVVVQAVTGSGKTLAFVIPIIERLIQLEPRPHSHVAAIIISPTRELATQTFQVVNQFLEN 109          
BLAST of SMED30002950 vs. TrEMBL
Match: A0A2S4UDG9 (RNA helicase OS=Puccinia striiformis OX=27350 GN=PSTT_16400 PE=3 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 4.149e-22
Identity = 50/100 (50.00%), Postives = 69/100 (69.00%), Query Frame = -1
Query:  134 SWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSN 433
            S+ DL   L+    + +K L F + TP+Q H IP FL+ KD+V QAVTGSGKTLAF+IPIIE L +++    + V ++I+SPT ELA QT+++ N FL N
Sbjct:   10 SFDDLNPPLASWVLDTIKSLGFHQMTPVQAHTIPLFLENKDVVVQAVTGSGKTLAFVIPIIERLIQLEPRPHSHVAAIIISPTRELATQTFQVVNQFLEN 109          
BLAST of SMED30002950 vs. Ensembl Cavefish
Match: ddx55 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 55 [Source:NCBI gene;Acc:286745])

HSP 1 Score: 84.7297 bits (208), Expect = 1.440e-19
Identity = 44/101 (43.56%), Postives = 59/101 (58.42%), Query Frame = -1
Query:  131 WKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIE-LLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSNF 430
            W  L   L       L+ L F   TP+Q+  IP F+  KD+ A+AVTGSGKTLAF+IP++E LL   +  K   V ++I++PT ELA Q  E+   FL  F
Sbjct:    9 WDSLSVNLQDGIKRTLQKLGFTFMTPVQSACIPLFMSNKDIAAEAVTGSGKTLAFVIPVLEILLKREEKLKKMQVGALIITPTRELAVQISEVMGQFLEEF 109          
BLAST of SMED30002950 vs. Ensembl Cavefish
Match: ENSAMXT00000040066.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000729.1:45111:52135:1 gene:ENSAMXG00000042612.1 transcript:ENSAMXT00000040066.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.2554 bits (186), Expect = 1.465e-16
Identity = 42/101 (41.58%), Postives = 60/101 (59.41%), Query Frame = -1
Query:  140 KDISWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFL 442
            +D S+  L   +S+NT   +K + FE  T IQ   I   L+ +D++A A TGSGKTLAF+IP IEL+ ++          +ILSPT ELA QTY +  + +
Sbjct:   67 EDQSFASLAELVSENTLKGIKEMGFENMTEIQHKSIRPLLEGRDVLAAAKTGSGKTLAFLIPAIELIYKLRFMPRNGTGVIILSPTRELAMQTYGVLKDLM 167          
BLAST of SMED30002950 vs. Ensembl Cavefish
Match: ENSAMXT00000031571.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000729.1:45111:52134:1 gene:ENSAMXG00000042612.1 transcript:ENSAMXT00000031571.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.8702 bits (185), Expect = 2.237e-16
Identity = 42/101 (41.58%), Postives = 60/101 (59.41%), Query Frame = -1
Query:  140 KDISWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFL 442
            +D S+  L   +S+NT   +K + FE  T IQ   I   L+ +D++A A TGSGKTLAF+IP IEL+ ++          +ILSPT ELA QTY +  + +
Sbjct:  104 EDQSFASLAELVSENTLKGIKEMGFENMTEIQHKSIRPLLEGRDVLAAAKTGSGKTLAFLIPAIELIYKLRFMPRNGTGVIILSPTRELAMQTYGVLKDLM 204          
BLAST of SMED30002950 vs. Ensembl Cavefish
Match: ddx18 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 18 [Source:ZFIN;Acc:ZDB-GENE-030131-9685])

HSP 1 Score: 75.485 bits (184), Expect = 2.892e-16
Identity = 42/101 (41.58%), Postives = 60/101 (59.41%), Query Frame = -1
Query:  140 KDISWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFL 442
            +D S+  L   +S+NT   +K + FE  T IQ   I   L+ +D++A A TGSGKTLAF+IP IEL+ ++          +ILSPT ELA QTY +  + +
Sbjct:  222 EDQSFASLAELVSENTLKGIKEMGFENMTEIQHKSIRPLLEGRDVLAAAKTGSGKTLAFLIPAIELIYKLRFMPRNGTGVIILSPTRELAMQTYGVLKDLM 322          
BLAST of SMED30002950 vs. Ensembl Cavefish
Match: ddx46 (DEAD-box helicase 46 [Source:NCBI gene;Acc:103041720])

HSP 1 Score: 70.4774 bits (171), Expect = 1.609e-14
Identity = 36/84 (42.86%), Postives = 52/84 (61.90%), Query Frame = -1
Query:  167 CKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPII-ELLNEMDSFKSTDVFSVILSPTSELANQ 415
            C  S    NALK   +EKPTPIQ+  IP  +  +DL+  A TGSGKT+AF++P+   +L++    +     +VI++PT ELA Q
Sbjct:  379 CGTSMKVLNALKKHNYEKPTPIQSQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHILDQRPLEEGEGPIAVIMTPTRELALQ 462          
BLAST of SMED30002950 vs. Ensembl Sea Lamprey
Match: DDX54 (DEAD-box helicase 54 [Source:HGNC Symbol;Acc:HGNC:20084])

HSP 1 Score: 69.707 bits (169), Expect = 4.699e-15
Identity = 39/94 (41.49%), Postives = 55/94 (58.51%), Query Frame = -1
Query:   89 FEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSNFNGSKPNLILFNKKI 370
            ++ PTPIQ   IP  L+ +D+VA A TGSGKT AF++P+ E L+   +       +++LSPT ELA QT + F   L    G K  LIL   ++
Sbjct:   53 YKVPTPIQRKCIPVILEGRDVVAMARTGSGKTAAFLVPMFERLHARSA--QAGARALVLSPTRELALQTSK-FTKELGKHTGLKTALILGGDRM 143          
BLAST of SMED30002950 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010109.1 (pep scaffold:Pmarinus_7.0:GL476492:615610:626431:-1 gene:ENSPMAG00000009147.1 transcript:ENSPMAT00000010109.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.3218 bits (168), Expect = 7.085e-15
Identity = 39/103 (37.86%), Postives = 60/103 (58.25%), Query Frame = -1
Query:  134 KDISWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSN 442
            +D+S+  L   +S+ T  A+  + F   T IQ   I   L+ +D++A A TGSGKTLAF+IP IEL++++          ++LSPT ELA QTY +    + +
Sbjct:  173 EDMSFSSLAELVSEYTLKAVAEMGFATMTEIQHKSIRPLLEGRDILAAARTGSGKTLAFLIPAIELIHKIKFMPRNGTGVLVLSPTRELAMQTYGVLRELMKH 275          
BLAST of SMED30002950 vs. Ensembl Sea Lamprey
Match: ddx23 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:ZFIN;Acc:ZDB-GENE-030131-6215])

HSP 1 Score: 67.781 bits (164), Expect = 2.463e-14
Identity = 38/80 (47.50%), Postives = 51/80 (63.75%), Query Frame = -1
Query:  158 KCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPI---IELLNEMDSFKSTDV--FSVILSPTSELANQTYE 382
            KC  ++ PTPIQ   IP  LQ +D++  A TGSGKT AF+IP+   I  L ++D  + TD   ++VIL+PT ELA Q  E
Sbjct:  337 KC-GYKDPTPIQRQAIPIGLQNRDIIGIAETGSGKTAAFLIPLLVWITTLPKIDRIEDTDQGPYAVILAPTRELAQQIEE 415          
BLAST of SMED30002950 vs. Ensembl Sea Lamprey
Match: ddx49 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 [Source:ZFIN;Acc:ZDB-GENE-031030-3])

HSP 1 Score: 67.3958 bits (163), Expect = 3.426e-14
Identity = 35/78 (44.87%), Postives = 50/78 (64.10%), Query Frame = -1
Query:  149 KCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDSFKSTDVFSVILSPTSELANQTYEMFN 382
            K +   KPTP+Q + IP  L+ +D +  A TGSGKT AF++PI++ L+E D F    +F ++L+PT ELA Q  E F 
Sbjct:   21 KQMGISKPTPVQENCIPPILRGQDCMGCAQTGSGKTAAFVLPILQKLSE-DPF---GIFCLVLAPTRELAYQIAEQFR 94          
BLAST of SMED30002950 vs. Ensembl Sea Lamprey
Match: ddx46 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:NCBI gene;Acc:321948])

HSP 1 Score: 65.855 bits (159), Expect = 1.476e-13
Identity = 33/84 (39.29%), Postives = 49/84 (58.33%), Query Frame = -1
Query:  167 CKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPII-ELLNEMDSFKSTDVFSVILSPTSELANQ 415
            C +S    N LK   +EKPTPIQ   IP  +  +DL+  A TGSGKT+ F++P+   ++++    +      VI++PT ELA Q
Sbjct:  374 CGISMKILNTLKKQNYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTIGFLLPMFRHVMDQRPLEEGEGPIGVIMTPTRELALQ 457          
BLAST of SMED30002950 vs. Ensembl Yeast
Match: DBP10 (Putative ATP-dependent RNA helicase of the DEAD-box protein family; constituent of 66S pre-ribosomal particles; essential protein involved in ribosome biogenesis [Source:SGD;Acc:S000002189])

HSP 1 Score: 77.411 bits (189), Expect = 7.426e-18
Identity = 42/89 (47.19%), Postives = 54/89 (60.67%), Query Frame = -1
Query:  143 LSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNF 409
            LSK   N +K   F +PTPIQ   IP  LQ +D+V  A TGSGKT AFI+P++E L            +VILSP+ ELA QT+ +F +F
Sbjct:  144 LSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSG--KIGARAVILSPSRELAMQTFNVFKDF 230          
BLAST of SMED30002950 vs. Ensembl Yeast
Match: DBP9 (DEAD-box protein required for 27S rRNA processing; exhibits DNA, RNA and DNA/RNA helicase activities; ATPase activity shows preference for DNA over RNA; DNA helicase activity abolished by mutation in RNA-binding domain [Source:SGD;Acc:S000004266])

HSP 1 Score: 75.8702 bits (185), Expect = 2.327e-17
Identity = 39/88 (44.32%), Postives = 57/88 (64.77%), Query Frame = -1
Query:  140 ALKCLKFEKPTPIQTHVIPKFLQ-KKDLVAQAVTGSGKTLAFIIPIIELLNE----MDSFKSTDVFSVILSPTSELANQTYEMFNNFL 388
            A+K + F+ PT IQ+H IP  LQ K+D++A+A TGSGKTLA++IP+IE + E    +D+ +      +IL PT ELA Q Y +    +
Sbjct:   31 AIKNIGFQYPTLIQSHAIPLALQQKRDIIAKAATGSGKTLAYLIPVIETILEYKKTIDNGEENGTLGIILVPTRELAQQVYNVLEKLV 118          
BLAST of SMED30002950 vs. Ensembl Yeast
Match: SPB4 (Putative ATP-dependent RNA helicase; nucleolar protein required for synthesis of 60S ribosomal subunits at a late step in the pathway; sediments with 66S pre-ribosomes in sucrose gradients [Source:SGD;Acc:S000001894])

HSP 1 Score: 75.0998 bits (183), Expect = 5.459e-17
Identity = 39/109 (35.78%), Postives = 61/109 (55.96%), Query Frame = -1
Query:  131 TKDISWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDS----FKSTDVFSVILSPTSELANQTYEMFNNFLSNF 445
            +K + W +LG  L       L  + FE  TP+Q   IP     KD+V  +VTGSGKT AF+IP++E + + ++    FK     S+I++PT EL+ Q   +  +FL ++
Sbjct:    2 SKSLEWDNLGFSLLPWIRTGLDVMGFETMTPVQASTIPMLAGNKDVVVDSVTGSGKTAAFVIPVLEKVVKEEANTSKFKKAHFHSLIIAPTRELSRQIESVVLSFLEHY 110          
BLAST of SMED30002950 vs. Ensembl Yeast
Match: DBP8 (ATPase, putative RNA helicase of the DEAD-box family; component of 90S preribosome complex involved in production of 18S rRNA and assembly of 40S small ribosomal subunit; ATPase activity stimulated by association with Esf2p [Source:SGD;Acc:S000001212])

HSP 1 Score: 70.8626 bits (172), Expect = 1.305e-15
Identity = 42/101 (41.58%), Postives = 58/101 (57.43%), Query Frame = -1
Query:  128 WKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSNFN 430
            +K LG  LSK    +L+ +K  +PT IQ   IPK L+ +D +  A TGSGKT+AF  P++   +E  S     +F V+L+PT ELA Q  E F    S+ N
Sbjct:    4 FKSLG--LSKWLTESLRAMKITQPTAIQKACIPKILEGRDCIGGAKTGSGKTIAFAGPMLTKWSEDPS----GMFGVVLTPTRELAMQIAEQFTALGSSMN 98          
BLAST of SMED30002950 vs. Ensembl Yeast
Match: DBP7 (Putative ATP-dependent RNA helicase of the DEAD-box family; involved in ribosomal biogenesis; required at post-transcriptional step for efficient retrotransposition; essential for growth under anaerobic conditions [Source:SGD;Acc:S000001732])

HSP 1 Score: 67.781 bits (164), Expect = 2.018e-14
Identity = 36/111 (32.43%), Postives = 66/111 (59.46%), Query Frame = -1
Query:   59 LKFEKPTPIQTHVIPKFLQ---KKDLVAQAVTGSGKTLAFIIPIIELLNEMDSF--KSTDVFSVILSPTSELANQTYEMFNNFLSNFNGSKPNLILFNKKIRILKFRVE*G 376
            ++ +KPT IQ   IP+ +    K D    A TGSGKTL++++PII  +  MD+   +++  F+++++PT ELA+Q Y + +  +S  +   P L++  ++ +  K R+  G
Sbjct:  162 MRIKKPTSIQKQAIPQIIGNAGKNDFFIHAQTGSGKTLSYLLPIISTILNMDTHVDRTSGAFALVIAPTRELASQIYHVCSTLVSCCHYLVPCLLIGGERKKSEKARLRKG 272          
BLAST of SMED30002950 vs. Ensembl Nematostella
Match: EDO41335 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4S3])

HSP 1 Score: 85.5001 bits (210), Expect = 2.905e-20
Identity = 45/117 (38.46%), Postives = 68/117 (58.12%), Query Frame = -1
Query:  113 SWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIE-LLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSN---------FNGSKPN 433
            +W+     LS+ T N++K + F   TP+Q   IP F+  KD+  +AVTGSGKTLAF+IPIIE +L   D  K  ++ ++I++PT ELA Q  E+ +  + +           G+ PN
Sbjct:    4 TWESSRPSLSQTTLNSMKKMNFSTMTPVQAAAIPLFMSNKDVAVEAVTGSGKTLAFVIPIIEIILRREDKLKKHEIGALIITPTRELAQQIDEVVSTLVEDIPNIRRLLLIGGADPN 120          
BLAST of SMED30002950 vs. Ensembl Nematostella
Match: EDO41969 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2R2])

HSP 1 Score: 70.0922 bits (170), Expect = 8.178e-15
Identity = 45/115 (39.13%), Postives = 64/115 (55.65%), Query Frame = -1
Query:   77 LSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSNFNGSKPNLI----LFNKKIRILK 409
            +SK T + L    F  PT IQ   IP  L  +D++  A TGSGKTLAF+IPIIE L          + ++++SPT ELA QT+E+     +  + S   +I    L N++ RI+K
Sbjct:   57 ISKRTLDGLMKAGFVTPTDIQKQGIPVALSGRDVLGAAKTGSGKTLAFLIPIIETLWRQKWTSMDGLGALVISPTRELAYQTFEVLVKIGNKHDLSAGLIIGGKDLKNEQKRIMK 171          
BLAST of SMED30002950 vs. Ensembl Nematostella
Match: EDO38731 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC22])

HSP 1 Score: 68.1662 bits (165), Expect = 3.256e-14
Identity = 36/94 (38.30%), Postives = 55/94 (58.51%), Query Frame = -1
Query:  128 LSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSNFN 409
            +S+ T   +K + F   T IQ   I   L+ +DL+  A TGSGKTLAF++P++ELL ++          +I+SPT EL+ QTY +  + L + N
Sbjct:    8 VSEKTLQGIKDMGFTTMTEIQHKSIAPLLKGRDLLGAAKTGSGKTLAFLVPVVELLYKLQFKTRNGTGVIIISPTRELSLQTYGVARDLLKHHN 101          
BLAST of SMED30002950 vs. Ensembl Nematostella
Match: EDO39253 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAP0])

HSP 1 Score: 64.6994 bits (156), Expect = 3.869e-14
Identity = 37/89 (41.57%), Postives = 53/89 (59.55%), Query Frame = -1
Query:  143 LSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNF 409
            LS+    A+  L F  PTPIQ   IP  L  KD+ A A TG+GKT AF++PI+E L    + +S  +  ++++PT ELA Q + + NN 
Sbjct:   19 LSRPLLKAVNELGFLHPTPIQASTIPVALMGKDVCACAATGTGKTAAFMLPILERLLYRPT-QSPAIRVLVITPTRELAIQIHSVTNNL 106          
BLAST of SMED30002950 vs. Ensembl Nematostella
Match: EDO25716 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DVP3])

HSP 1 Score: 65.0846 bits (157), Expect = 8.045e-14
Identity = 36/93 (38.71%), Postives = 52/93 (55.91%), Query Frame = -1
Query:  158 ISWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDSFKSTDVFSVILSPTSELANQTYE 436
            +S+  LG  L      A++   +  P+PIQ   IP  L  KD++A A TG+GKT  F +PI+E L +    K   V ++IL+PT ELA Q  +
Sbjct:    1 MSFSQLG--LCPGIAKAVELKGYTTPSPIQAQAIPAILAGKDVMAAAQTGTGKTAGFTLPILENLVKGSRAKPNHVRALILTPTRELAAQVAD 91          
BLAST of SMED30002950 vs. Ensembl Medaka
Match: ddx55 (DEAD-box helicase 55 [Source:NCBI gene;Acc:101161657])

HSP 1 Score: 88.9669 bits (219), Expect = 6.058e-21
Identity = 45/102 (44.12%), Postives = 63/102 (61.76%), Query Frame = -1
Query:  131 SWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIE-LLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSNF 433
            +W+ L  KL +     L+ L+F   TP+Q   +P F+  KD+ A+AVTGSGKTLAF+IPIIE LL   +  K   V +++++PT ELA Q  E+   FL  F
Sbjct:    8 TWESLPVKLHEGILETLRELRFTHMTPVQAACVPLFMSNKDVAAEAVTGSGKTLAFVIPIIELLLKREEKLKKMQVGALVITPTRELALQISEVMETFLRRF 109          
BLAST of SMED30002950 vs. Ensembl Medaka
Match: ddx18 (DEAD-box helicase 18 [Source:NCBI gene;Acc:101158147])

HSP 1 Score: 70.0922 bits (170), Expect = 1.854e-14
Identity = 38/103 (36.89%), Postives = 61/103 (59.22%), Query Frame = -1
Query:  134 KDISWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSN 442
            +D +++ L   +S+ T   +K + F+  T IQ   +   L+ +D++A A TGSGKTLAF+IP IEL+ ++          +ILSPT ELA QTY +    +++
Sbjct:  147 EDTAFESLADLVSEGTLKGVKEMGFQHMTEIQHKTVRPLLEGRDVLAAAKTGSGKTLAFLIPSIELIYKLKFMPRNGTGVIILSPTRELAMQTYGVLKELMTH 249          
BLAST of SMED30002950 vs. Ensembl Medaka
Match: ddx54 (DEAD-box helicase 54 [Source:NCBI gene;Acc:101162145])

HSP 1 Score: 68.9366 bits (167), Expect = 6.255e-14
Identity = 42/89 (47.19%), Postives = 53/89 (59.55%), Query Frame = -1
Query:  104 FEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSNFNGSKPNLIL 370
            ++ PTPIQ   IP  L  KD+VA A TGSGKT AF++P+ E L    +  S    ++I+SPT ELA QT + F   L  F G K  LIL
Sbjct:   97 YKVPTPIQRKTIPVILDGKDVVAMARTGSGKTAAFLVPMFEKLKAPQA--SAGARALIMSPTRELALQTMK-FTKELGKFAGLKTALIL 182          
BLAST of SMED30002950 vs. Ensembl Medaka
Match: ddx46 (DEAD-box helicase 46 [Source:NCBI gene;Acc:101161571])

HSP 1 Score: 68.5514 bits (166), Expect = 8.299e-14
Identity = 35/84 (41.67%), Postives = 53/84 (63.10%), Query Frame = -1
Query:  167 CKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPII-ELLNEMDSFKSTDVFSVILSPTSELANQ 415
            C +S    +ALK   ++KPTPIQ   IP  +  +DL+  A TGSGKT+AF++P+   ++++    +S    SVI++PT ELA Q
Sbjct:  282 CGVSMKILSALKKQGYDKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHIMDQRPLEESEGPISVIMTPTRELALQ 365          
BLAST of SMED30002950 vs. Ensembl Medaka
Match: ddx46 (DEAD-box helicase 46 [Source:NCBI gene;Acc:101161571])

HSP 1 Score: 68.1662 bits (165), Expect = 9.152e-14
Identity = 35/84 (41.67%), Postives = 53/84 (63.10%), Query Frame = -1
Query:  167 CKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPII-ELLNEMDSFKSTDVFSVILSPTSELANQ 415
            C +S    +ALK   ++KPTPIQ   IP  +  +DL+  A TGSGKT+AF++P+   ++++    +S    SVI++PT ELA Q
Sbjct:  392 CGVSMKILSALKKQGYDKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHIMDQRPLEESEGPISVIMTPTRELALQ 475          
BLAST of SMED30002950 vs. Planmine SMEST
Match: SMESG000009812.1 (SMESG000009812.1)

HSP 1 Score: 251.521 bits (641), Expect = 1.766e-80
Identity = 121/122 (99.18%), Postives = 121/122 (99.18%), Query Frame = -1
Query:   92 MTIDTKDISWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSNFNGSKPNLILFNKK 457
            MT DTKDISWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSNFNGSKPNLILFNKK
Sbjct:    1 MTSDTKDISWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSNFNGSKPNLILFNKK 122          
BLAST of SMED30002950 vs. Planmine SMEST
Match: SMESG000064743.1 (SMESG000064743.1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.531e-15
Identity = 41/100 (41.00%), Postives = 59/100 (59.00%), Query Frame = -1
Query:  143 GCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELL---NEMDS-----FKSTDVFSVILSPTSELANQTYEMFNNF 418
            G K++K   + +  L + KPTP+Q   IP  LQ++DL+A A TGSGKT AF+IPI+ ++      DS     ++     ++IL+PT ELA Q YE    F
Sbjct:  116 GLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDSQIPGNYEKQYPVALILAPTRELACQIYEEIRKF 215          
BLAST of SMED30002950 vs. Planmine SMEST
Match: SMESG000018018.1 (SMESG000018018.1)

HSP 1 Score: 71.2478 bits (173), Expect = 5.781e-15
Identity = 45/107 (42.06%), Postives = 63/107 (58.88%), Query Frame = -1
Query:   89 TNNALKCL---KFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIE-LLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFLSNFNGSKPNLILFNKKI 397
            T + +K L   K  KPT +Q H IP  LQ KD++A A TGSGKT AF+IPII+ L+ ++  +     + VIL+PT ELA+Q  E     L + N +K  +I   K +
Sbjct:    8 TEDVIKLLENKKIIKPTEVQEHCIPLVLQGKDVIACAKTGSGKTAAFLIPIIQNLIVDIKPY-----YCVILTPTRELAHQIGEQAKGLLVSQNLAKTIVITGGKDL 109          
BLAST of SMED30002950 vs. Planmine SMEST
Match: SMESG000072404.1 (SMESG000072404.1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.507e-14
Identity = 45/93 (48.39%), Postives = 56/93 (60.22%), Query Frame = -1
Query:  155 LGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELL----NEMDSFKSTDVFSVILSPTSELANQTYEM 421
            +  K+SK    AL      KPTPIQ   IP  L+ KD+ A A TGSGKTLAF+IPI+E L    N+   +  T   +V+LSPT ELA Q YE+
Sbjct:  101 MDMKISKPILKALMDSNITKPTPIQEACIPIGLKNKDICACAKTGSGKTLAFLIPIVEKLIRSPNQQGRY--TVPRAVVLSPTRELALQIYEV 191          
BLAST of SMED30002950 vs. Planmine SMEST
Match: SMESG000080928.1 (SMESG000080928.1)

HSP 1 Score: 69.707 bits (169), Expect = 2.405e-14
Identity = 45/91 (49.45%), Postives = 61/91 (67.03%), Query Frame = -1
Query:  140 KLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDLVAQAVTGSGKTLAFIIPIIELLNEMDSFKSTDVFSVILSPTSELANQTYEMFNNFL 412
            KLS N  NALK + F KPT +Q   IP  L+ KD+V QA TGSGKTLAF++P++E L  + S  S  + ++IL PT+ELA+QT  + +  L
Sbjct:   11 KLSSNIINALKEMNFLKPTKVQLKTIPVCLKGKDVVVQAKTGSGKTLAFLLPLLENLLRLKSNSSFGIQAIILVPTAELASQTLNVLSKLL 101          
The following BLAST results are available for this feature:
BLAST of SMED30002950 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDX554.410e-2345.10DEAD-box helicase 55 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX551.021e-2045.10DEAD-box helicase 55 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX551.021e-2045.10DEAD-box helicase 55 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX541.957e-1544.68DEAD-box helicase 54 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX465.089e-1542.22DEAD-box helicase 46 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of SMED30002950 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F53H1.19.383e-1639.80pep chromosome:WBcel235:IV:1297222:1309652:-1 gene... [more]
F53H1.19.531e-1639.80pep chromosome:WBcel235:IV:1297400:1309644:-1 gene... [more]
Y94H6A.52.130e-1539.22ATP-dependent RNA helicase [Source:UniProtKB/TrEM... [more]
B0511.64.215e-1540.82RNA helicase [Source:UniProtKB/TrEMBL;Acc:O61815][more]
ddx-522.772e-1436.79DEAD boX helicase homolog [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of SMED30002950 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG58006.164e-1741.38gene:FBgn0030855 transcript:FBtr0074453[more]
pit2.674e-1636.45gene:FBgn0266581 transcript:FBtr0084174[more]
pit2.674e-1636.45gene:FBgn0266581 transcript:FBtr0346345[more]
pit2.674e-1636.45gene:FBgn0266581 transcript:FBtr0084175[more]
CG96307.444e-1638.95gene:FBgn0037561 transcript:FBtr0081866[more]
back to top
BLAST of SMED30002950 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx556.990e-2146.15DEAD (Asp-Glu-Ala-Asp) box polypeptide 55 [Source:... [more]
ddx181.573e-1538.83DEAD (Asp-Glu-Ala-Asp) box polypeptide 18 [Source:... [more]
ddx465.839e-1542.86DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:... [more]
ddx542.410e-1446.07DEAD (Asp-Glu-Ala-Asp) box polypeptide 54 [Source:... [more]
ddx313.060e-1333.64DEAD (Asp-Glu-Ala-Asp) box polypeptide 31 [Source:... [more]
back to top
BLAST of SMED30002950 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx551.960e-2043.14DEAD-box helicase 55 [Source:NCBI gene;Acc:1001452... [more]
ddx552.451e-2043.14DEAD-box helicase 55 [Source:NCBI gene;Acc:1001452... [more]
ddx552.455e-2043.14DEAD-box helicase 55 [Source:NCBI gene;Acc:1001452... [more]
DDX541.466e-1650.00DEAD-box helicase 54 [Source:NCBI gene;Acc:733994][more]
DDX542.291e-1550.00DEAD-box helicase 54 [Source:NCBI gene;Acc:733994][more]
back to top
BLAST of SMED30002950 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ddx553.518e-2043.14DEAD (Asp-Glu-Ala-Asp) box polypeptide 55 [Source:... [more]
Ddx553.525e-2043.14DEAD (Asp-Glu-Ala-Asp) box polypeptide 55 [Source:... [more]
Ddx181.389e-1538.83DEAD (Asp-Glu-Ala-Asp) box polypeptide 18 [Source:... [more]
Ddx552.951e-1550.00DEAD (Asp-Glu-Ala-Asp) box polypeptide 55 [Source:... [more]
Ddx464.129e-1542.22DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:... [more]
back to top
BLAST of SMED30002950 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6CN92|SPB4_KLULA1.281e-2143.12ATP-dependent rRNA helicase SPB4 OS=Kluyveromyces ... [more]
sp|Q54EC2|DDX55_DICDI3.650e-2146.60Probable ATP-dependent RNA helicase ddx55 OS=Dicty... [more]
sp|Q8NHQ9|DDX55_HUMAN4.901e-2045.10ATP-dependent RNA helicase DDX55 OS=Homo sapiens O... [more]
sp|Q8JHJ2|DDX55_DANRE5.176e-2046.15ATP-dependent RNA helicase DDX55 OS=Danio rerio OX... [more]
sp|Q5ZLN8|DDX55_CHICK8.070e-2045.54ATP-dependent RNA helicase DDX55 OS=Gallus gallus ... [more]
back to top
BLAST of SMED30002950 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D6WYU01.698e-2549.51RNA helicase OS=Tribolium castaneum OX=7070 GN=Tca... [more]
A0A180GHF66.199e-2351.55RNA helicase OS=Puccinia triticina (isolate 1-1 / ... [more]
A0A1B6KBR81.319e-2250.94Uncharacterized protein (Fragment) OS=Graphocephal... [more]
A0A0L0VLZ93.872e-2250.00RNA helicase OS=Puccinia striiformis f. sp. tritic... [more]
A0A2S4UDG94.149e-2250.00RNA helicase OS=Puccinia striiformis OX=27350 GN=P... [more]
back to top
BLAST of SMED30002950 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx551.440e-1943.56DEAD (Asp-Glu-Ala-Asp) box polypeptide 55 [Source:... [more]
ENSAMXT00000040066.11.465e-1641.58pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000031571.12.237e-1641.58pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ddx182.892e-1641.58DEAD (Asp-Glu-Ala-Asp) box polypeptide 18 [Source:... [more]
ddx461.609e-1442.86DEAD-box helicase 46 [Source:NCBI gene;Acc:1030417... [more]
back to top
BLAST of SMED30002950 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDX544.699e-1541.49DEAD-box helicase 54 [Source:HGNC Symbol;Acc:HGNC:... [more]
ENSPMAT00000010109.17.085e-1537.86pep scaffold:Pmarinus_7.0:GL476492:615610:626431:-... [more]
ddx232.463e-1447.50DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:... [more]
ddx493.426e-1444.87DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 [Source:... [more]
ddx461.476e-1339.29DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:... [more]
back to top
BLAST of SMED30002950 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
DBP107.426e-1847.19Putative ATP-dependent RNA helicase of the DEAD-bo... [more]
DBP92.327e-1744.32DEAD-box protein required for 27S rRNA processing;... [more]
SPB45.459e-1735.78Putative ATP-dependent RNA helicase; nucleolar pro... [more]
DBP81.305e-1541.58ATPase, putative RNA helicase of the DEAD-box fami... [more]
DBP72.018e-1432.43Putative ATP-dependent RNA helicase of the DEAD-bo... [more]
back to top
BLAST of SMED30002950 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO413352.905e-2038.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419698.178e-1539.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387313.256e-1438.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO392533.869e-1441.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO257168.045e-1438.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of SMED30002950 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx556.058e-2144.12DEAD-box helicase 55 [Source:NCBI gene;Acc:1011616... [more]
ddx181.854e-1436.89DEAD-box helicase 18 [Source:NCBI gene;Acc:1011581... [more]
ddx546.255e-1447.19DEAD-box helicase 54 [Source:NCBI gene;Acc:1011621... [more]
ddx468.299e-1441.67DEAD-box helicase 46 [Source:NCBI gene;Acc:1011615... [more]
ddx469.152e-1441.67DEAD-box helicase 46 [Source:NCBI gene;Acc:1011615... [more]
back to top
BLAST of SMED30002950 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009812.11.766e-8099.18SMESG000009812.1[more]
SMESG000064743.12.531e-1541.00SMESG000064743.1[more]
SMESG000018018.15.781e-1542.06SMESG000018018.1[more]
SMESG000072404.11.507e-1448.39SMESG000072404.1[more]
SMESG000080928.12.405e-1449.45SMESG000080928.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002950 ID=SMED30002950|Name=SMED30002950|organism=Schmidtea mediterranea sexual|type=transcript|length=469bp
TTCGTCAATTTCTTCGATGGCTTTAGCAAAGGACCCAGGTGTGGAAATTA
TAACAATACCCTTATTCGACTCTGAATTTGAGGATTCTGATTTTTTTGTT
GAATAGTATTAAATTTGGTTTAGATCCATTAAAATTGGATAGGAAATTAT
TAAACATTTCATATGTTTGGTTGGCAAGCTCTGATGTCGGTGACAAAATG
ACAGAGAAGACGTCTGTTGATTTAAAGGAATCCATTTCATTTAATAACTC
AATTATTGGAATAATGAATGCCAAAGTTTTTCCAGAACCGGTTACAGCTT
GTGCAACTAGGTCTTTCTTTTGAAGAAATTTTGGAATTACATGAGTCTGA
ATAGGAGTAGGCTTTTCAAATTTTAAACATTTAAGTGCATTATTCGTATT
TTTCGATAATTTACATCCTAAATCTTTCCAAGAAATATCTTTGGTATCAA
TAGTCATGCTGTAGTATTA
back to top

protein sequence of SMED30002950-orf-1

>SMED30002950-orf-1 ID=SMED30002950-orf-1|Name=SMED30002950-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=132bp
MTIDTKDISWKDLGCKLSKNTNNALKCLKFEKPTPIQTHVIPKFLQKKDL
VAQAVTGSGKTLAFIIPIIELLNEMDSFKSTDVFSVILSPTSELANQTYE
MFNNFLSNFNGSKPNLILFNKKIRILKFRVE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR011545DEAD/DEAH_box_helicase_dom
IPR027417P-loop_NTPase
IPR014001Helicase_ATP-bd
IPR014014RNA_helicase_DEAD_Q_motif
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0003676nucleic acid binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 2..128
e-value: 1.5E-30
score: 108.1
NoneNo IPR availablePANTHERPTHR24031RNA HELICASEcoord: 16..112
NoneNo IPR availablePANTHERPTHR24031:SF676ATP-DEPENDENT RNA HELICASE DDX49-RELATEDcoord: 16..112
NoneNo IPR availableCDDcd00268DEADccoord: 23..110
e-value: 2.50461E-33
score: 113.306
IPR011545DEAD/DEAH box helicase domainPFAMPF00270DEADcoord: 34..119
e-value: 8.8E-21
score: 74.4
IPR014014RNA helicase, DEAD-box type, Q motifPROSITEPS51195Q_MOTIFcoord: 10..38
score: 8.354
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 41..131
score: 13.282
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 7..110