PKD1L-1

Overview
NamePKD1L-1 (AKN21724.1)
Smed IDSMED30002946
Length (bp)10938
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PKD1L-1 (SMED30002946) t-SNE clustered cells

Violin plots show distribution of expression levels for PKD1L-1 (SMED30002946) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PKD1L-1 (SMED30002946) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PKD1L-1 (SMED30002946) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002946

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30002946SMESG000067002.1 SmedASXL_017039SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30002946SMESG000067002.1 SmedASXL_008418SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30002946SMESG000067002.1 dd_Smed_v4_27650_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30002946SMESG000067002.1 dd_Smed_v4_15525_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002946SMESG000067002.1 dd_Smed_v4_15525_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002946SMESG000067002.1 dd_Smed_v4_15525_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30002946SMESG000067002.1 dd_Smed_v4_15525_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002946SMESG000067002.1 Contig41915uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002946SMESG000067002.1 Contig41915newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002946SMESG000067002.1 Contig49287uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002946SMESG000067002.1 Contig49287newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30002946SMESG000067002.1 dd_Smed_v6_27650_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30002946SMESG000067002.1 dd_Smed_v6_15525_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30002946SMESG000067002.1 SMED30022392smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30002946SMESG000067002.1 OX_Smed_1.0.07803ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30002946SMESG000067002.1 OX_Smed_1.0.13448ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30002946SMESG000067002.1 OX_Smed_1.0.09203ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PKD1L-1 vs. Ensembl Human
Match: PKD2L1 (polycystin 2 like 1, transient receptor potential cation channel [Source:HGNC Symbol;Acc:HGNC:9011])

HSP 1 Score: 221.09 bits (562), Expect = 1.747e-58
Identity = 145/503 (28.83%), Postives = 254/503 (50.50%), Query Frame = 3
Query: 9366 KELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKT-SNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFV 10871
            +EL +    RE+  YIVF   +  +TY     +AY     ++ +F+ T S+    F  I+    FW +A   L+ +L    WYNN    +         N L+G   +RQ++ + +SC V +  +    +CY  Y+   +++  +G        N T    +++ S+ EL G S+ GR+  YSGGGY      +       + AL++  W+D  TR +FI+F+ YN NINLF +   VVE P +GG    +++    L+  Y      F + C+V++ +FI   +V+EI  +   + +Y +  WN++++ +++ S +AV   ++  +  ++L  K  Q   + Y +F ++AF       M +  +F A +K  K + FN+ +  L S L   +KD+  F ++F I+F A+  + Y LF   +  + TF+       +I LG F +  +     I GP  F  YV F+ FVLLNMF+AI+ D ++ VK ++  Q+++ +L   +
Sbjct:   93 RELYIKTTLRELLVYIVFLVDICLLTYGMTSSSAYYYTKVMSELFLHTPSDTGVSFQAISSMADFWDFAQGPLLDSLYWTKWYNNQSLGHGSHSFIYYENMLLGVPRLRQLKVRNDSCVVHEDFREDILSCYDVYSPDKEEQLPFGP------FNGTA---WTYHSQDELGGFSHWGRLTSYSGGGYYLDLPGSRQGSAEALRALQEGLWLDRGTRVVFIDFSVYNANINLFCVLRLVVEFPATGGAIPSWQIRTVKLI-RYVSNWDFFIVGCEVIFCVFIFYYVVEEILELHIHRLRYLSSIWNILDLVVILLSIVAVGFHIFRTLEVNRLMGKLLQQP-NTYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGFAVMFFIVFFAYAQLGYLLFGTQVENFSTFIKCIFTQFRIILGDFDYNAIDNANRILGPAYFVTYVFFVFFVLLNMFLAIINDTYSEVKEELAGQKDELQLSDLL 584          
BLAST of PKD1L-1 vs. Ensembl Human
Match: PKD2 (polycystin 2, transient receptor potential cation channel [Source:HGNC Symbol;Acc:HGNC:9009])

HSP 1 Score: 215.312 bits (547), Expect = 7.721e-56
Identity = 153/511 (29.94%), Postives = 253/511 (49.51%), Query Frame = 3
Query: 9366 KELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKT---SNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYG-KGWTALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIF---CQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGD--VYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFV 10871
            +E  +  V RE+  Y++F   L  +TY     N Y     ++ +F+ T         F  ++  E FW +    L+  L   +  +N  +   R FI    N L+G   +RQ+R +  SC++    +   K CY  Y++ ++D   +G +  TA          + + SEK+LNG S+ G I  YSG GY             ++ +LK N W+D  TRA FI+F+ YN NINLF +   +VE P +GG+   ++ +P  L+      V  F+ F   C++++  FI   +V+EI  I   K  YF  FWN ++V IV+ S +A+     + I  +   E   Q+  D   + NF ++A+       + +  VF   +K  K + FNR +  L + ++  +KD+  F I+F I+FLA+  + Y +F   +  + TF        +I LG   F E+ +   + GPI F  +V F+ F+LLNMF+AI+ D ++ VK+D+  Q+ + EL   +
Sbjct:  213 REKYLKSVLRELVTYLLFLIVLCILTYGMMSSNVYYYTRMMSQLFLDTPVSKTEKTNFKTLSSMEDFWKFTEGSLLDGLYWKMQPSNQTEADNRSFIFY-ENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGPRNGTA----------WIYTSEKDLNGSSHWGIIATYSGAGYYLDLSRTREETAAQVASLKKNVWLDRGTRATFIDFSVYNANINLFCVVRLLVEFPATGGVIPSWQFQPLKLIRY----VTTFDFFLAACEIIFCFFIFYYVVEEILEIRIHKLHYFRSFWNCLDVVIVVLSVVAIG----INIYRTSNVEVLLQFLEDQNTFPNFEHLAYWQIQFNNIAAVTVFFVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFAIMFFIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKSDLAQQKAEMELSDLI 704          
BLAST of PKD1L-1 vs. Ensembl Human
Match: PKD2L2 (polycystin 2 like 2, transient receptor potential cation channel [Source:HGNC Symbol;Acc:HGNC:9012])

HSP 1 Score: 192.2 bits (487), Expect = 3.265e-50
Identity = 158/531 (29.76%), Postives = 261/531 (49.15%), Query Frame = 3
Query: 9297 KPHRFHVQPPPKEELEKAREIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTSNPNWQ---FTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISN--RNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQEN-DHELVKFV 10871
            +  R+H     K +L        KE+++    +E+  Y +F   L  +T+   +P+ Y L   ++++F+ TS P  +   F  I     FW +    L+  L    WYNN  QLY     S     N L+G   +RQ++ + N+C V+   +S+   CY  Y   N+D  ++G     L  N     E+ + S    N   + G +G+Y  GGY++    + S    +   L+ N WI   TR IFI+F+ YN N+NLF I   V E P +GG+ T ++     LL  Y      F   C++ + IF+ V   +E++ I + K  YF   WN +E+ +++  F+AV+   Y  +    L  +  +   + Y +F ++A  +     +++  +F A +K  K + FN+ +  L S L+   KD+  F I+F I+F A+  + + +F   +  + TF  +  A  +I LG F F  + Q  PI GPI F  ++ F+ FVLLNMF+AI+ D ++ VKAD  +    D EL K +
Sbjct:    3 EASRWHRGGASKHKLHYR-----KEVEITTTLQELLLYFIFLINLCILTFGMVNPHMYYLNKVMSSLFLDTSVPGEERTNFKSIRSITDFWKFMEGPLLEGLYWDSWYNNQ-QLYNLKNSSRIYYENILLGVPRVRQLKVRNNTCKVYSSFQSLMSECYGKYTSANEDLSNFG-----LQIN----TEWRY-STSNTNSPWHWGFLGVYRNGGYIFTLSKSKSETKNKFIDLRLNSWITRGTRVIFIDFSLYNANVNLFCIIRLVAEFPATGGILTSWQFYSVKLLR-YVSYYDYFIASCEITFCIFLFVFTTQEVKKIKEFKSAYFKSIWNWLELLLLLLCFVAVSFNTYYNVQIFLLLGQLLK-STEKYSDFYFLACWHIYYNNIIAITIFFAWIKIFKFISFNKTMSQLSSTLSRCVKDIVGFAIMFFIIFFAYAQLGFLVFGSQVDDFSTFQNSIFAQFRIVLGDFNFAGIQQANPILGPIYFITFIFFVFFVLLNMFLAIINDTYSEVKADYSIGRRLDFELGKMI 515          
BLAST of PKD1L-1 vs. Ensembl Human
Match: PKD2L2 (polycystin 2 like 2, transient receptor potential cation channel [Source:HGNC Symbol;Acc:HGNC:9012])

HSP 1 Score: 191.815 bits (486), Expect = 5.704e-50
Identity = 158/531 (29.76%), Postives = 261/531 (49.15%), Query Frame = 3
Query: 9297 KPHRFHVQPPPKEELEKAREIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTSNPNWQ---FTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISN--RNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQEN-DHELVKFV 10871
            +  R+H     K +L        KE+++    +E+  Y +F   L  +T+   +P+ Y L   ++++F+ TS P  +   F  I     FW +    L+  L    WYNN  QLY     S     N L+G   +RQ++ + N+C V+   +S+   CY  Y   N+D  ++G     L  N     E+ + S    N   + G +G+Y  GGY++    + S    +   L+ N WI   TR IFI+F+ YN N+NLF I   V E P +GG+ T ++     LL  Y      F   C++ + IF+ V   +E++ I + K  YF   WN +E+ +++  F+AV+   Y  +    L  +  +   + Y +F ++A  +     +++  +F A +K  K + FN+ +  L S L+   KD+  F I+F I+F A+  + + +F   +  + TF  +  A  +I LG F F  + Q  PI GPI F  ++ F+ FVLLNMF+AI+ D ++ VKAD  +    D EL K +
Sbjct:    3 EASRWHRGGASKHKLHYR-----KEVEITTTLQELLLYFIFLINLCILTFGMVNPHMYYLNKVMSSLFLDTSVPGEERTNFKSIRSITDFWKFMEGPLLEGLYWDSWYNNQ-QLYNLKNSSRIYYENILLGVPRVRQLKVRNNTCKVYSSFQSLMSECYGKYTSANEDLSNFG-----LQIN----TEWRY-STSNTNSPWHWGFLGVYRNGGYIFTLSKSKSETKNKFIDLRLNSWITRGTRVIFIDFSLYNANVNLFCIIRLVAEFPATGGILTSWQFYSVKLLR-YVSYYDYFIASCEITFCIFLFVFTTQEVKKIKEFKSAYFKSIWNWLELLLLLLCFVAVSFNTYYNVQIFLLLGQLLK-STEKYSDFYFLACWHIYYNNIIAITIFFAWIKIFKFISFNKTMSQLSSTLSRCVKDIVGFAIMFFIIFFAYAQLGFLVFGSQVDDFSTFQNSIFAQFRIVLGDFNFAGIQQANPILGPIYFITFIFFVFFVLLNMFLAIINDTYSEVKADYSIGRRLDFELGKMI 515          
BLAST of PKD1L-1 vs. Ensembl Human
Match: PKD1L3 (polycystin 1 like 3, transient receptor potential channel interacting [Source:HGNC Symbol;Acc:HGNC:21716])

HSP 1 Score: 199.134 bits (505), Expect = 6.998e-50
Identity = 120/339 (35.40%), Postives = 179/339 (52.80%), Query Frame = 3
Query: 7722 TGCYFNSNNFQGGWGTAGCVVGPLTTTKVTQCICNHLTSFASGWIVAPNTIDFDYVFSNFDFTKNLTLFVTEXXXXXX-XXXXXXWARRMDIKDIEKVGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVA*GPT-----------------KTTESVLTVGPFALTSREIWIGFVTNIISFVPLFVIIEMF 8684
            T CY+   + Q  W +AGC VGP +T   TQC+CNHLT FAS + V P T++ +     F    N  + V+ +   L  ++   +WAR+ D  D++KV VT L  ND +  + Y + + T  R +A T++ V   L G +  ++P HL D ++ + +RG +D FLL    SLG L  +RLWHDNS  G + SWY +   V D+  K K+HFL N W AV+  D ++DR+    S  EL  F  +FS  +    ++D+LWLSI  R P ++FTRV+R++   T                  T +    + PFA+   E+ +   T +I F    VI  +F
Sbjct:  633 TQCYYWEIHNQT-WSSAGCQVGPQSTILRTQCLCNHLTFFASDFFVVPRTVNVEDTIKLFLRVTNNPVGVSLLASLLGFYVITVVWARKKDQADMQKVKVTVLADNDPSAQFHYLIQVYTGYRRSAATTAKVVITLYGSEGRSEPHHLCDPQKTVFERGGLDVFLLTTWTSLGNLHSLRLWHDNS--GVSPSWYVSQVIVCDMAVKRKWHFLCNCWLAVDLGDCELDRVFIPVSKRELFSFRHLFSSMIVEKFTQDYLWLSIATRHPWNQFTRVQRLSCCMTLLLCNMVINVMFWKINSTTAKRDEQMRPFAVAWSELLVSIHTAVILFPINLVIGRLF 968          

HSP 2 Score: 74.3294 bits (181), Expect = 4.814e-12
Identity = 59/270 (21.85%), Postives = 125/270 (46.30%), Query Frame = 3
Query: 10095 GGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFVVTKFIMWTGIS 10904
            G  +T  R+E    L +   G   + I  QV+Y + +      +   + +QKW++FT   N+++  I++ SFI + G     I+  +      +   D +++F      N    ++V F V LAT++   +LR + R+ ++   L+    ++  F +I  I+   + + F  LF  S+  Y TF  +    + + +G     E++  +P+ G  +    V+ ++ V++N+F++ +   F   +  +   + +  L+  ++ K     GIS
Sbjct: 1442 GAFFTSLRLESFTSLQMSKKGC-VWSIISQVIYYLLVCYYAFIQGCQLKQQKWRFFTGKRNILDTSIILISFILL-GLDMKSISLHKKNMARYRDDQDRFISFYEAVKVNSAATHLVGFPVLLATVQLWNLLRHSPRLRVISRTLSRAWDEVVGFLLIILILLTGYAIAFNLLFGCSISDYRTFFSSAVTVVGLLMGISHQEEVFALDPVLGTFLILTSVILMVLVVINLFVSAILMAFGKERKSL---KKEAALIDTLLQKLSNLLGIS 1706          

HSP 3 Score: 56.6102 bits (135), Expect = 1.273e-6
Identity = 53/240 (22.08%), Postives = 105/240 (43.75%), Query Frame = 3
Query: 8874 QIPEYEVENQDSDANEKYKKRVIKRKLLPWWMRIIVWGFLTFLVIISVVFTTFYGIQFGDIACKKWISSMFISFFTSVLLTQPIKVVLLAIFFALVCKKSSSFXXXXXXXXXXXXXXXLGRRNALMQNEEFLHNELYSAPIKPHRFHVQPPPKEELEKAREIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTSNPNWQFTGITREEQFWTWALNVLVPNL 9593
            Q P  EV +    ++E+ KK +     L  W+  + W  L F  + S  FT  Y ++        W+ S+ +S   ++ ++QP+KVV     ++L+  +     N E   + + ++  L + ++ +      +N +Y AP       +  P K   E+  + +       D+  +    I+F   L+   YS ++ N + L   +   F      + QF+ I   + F+ WA ++L+P+L
Sbjct: 1124 QEPSREVTSFAILSSEEGKKPISNG--LSKWLTSVCWLLLGFTSLASAFFTALYSLELSKDQATSWMISIILSVLQNIFISQPVKVVFFTFLYSLMMSRMPRL-NKENEQQTKRILALLAKCSSSVPGSRDKNNPVYVAPA------INSPTKHP-ERTLKKKKLFKLTGDILVQ----ILFLTLLMTAIYSAKNSNRFYLHQAIWKTF------SHQFSEIKLLQDFYPWANHILLPSL 1343          
BLAST of PKD1L-1 vs. Ensembl Celegans
Match: lov-1 (Location of vulva defective 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09624])

HSP 1 Score: 193.741 bits (491), Expect = 1.868e-48
Identity = 171/680 (25.15%), Postives = 302/680 (44.41%), Query Frame = 3
Query: 8958 PWWMRIIVWGFLTFLVIISVVFTTFYGIQFGDIACKKWISSMFISFFTSVLLTQPIKVVLLAIFFALVCKKSSSFXXXXXXXXXXXXXXXLGRRNALMQNEEFLHNELYSAPIKPHRFHVQPPPKEELEKAREIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIF-IKTSN-PNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNS-CAVFDYAKSISKNCYSTYNIFNQDEGSYGK-GWTAL-SANDTPAP-EFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQF--------------------WNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPI--FGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFVVTKFIMWTGISETK 10913
            P +M  +    + F V++ +++ +  G+   D     +     IS     ++ +PIK ++ A F  L  +KS    N            E   RN   + E+ L  E+                  +L      ++++ Q++   R++  +      ++ +TY  +D + Y  + E++ I  I   N  +  F  I   + FW WA   L   L A  WY+ +P    R +++++ +R +G   +RQVRTKK++ C +F   +    +C       N+++  Y + GWT L S N T A  E+++K+ +EL+  +  G +  YSGGGY        + + T  N L    WID  TRA+ IEF+ YN  IN F++   +VE P SG       VE   L+    G       + ++LY  F ++I VKEI   +  ++K  T                      WN +++ +   +  +V  +   Q  T++  E F    G+ Y+N            Y ++  VF  + K I+ILRFNRRIG+L + L+     +  F I F    + F  V Y++  + +  Y + +   + ++   LGK   L++   +PI  F  +V   Y++    ++L +++ I+   F  ++ D E Q ND+E++  +  K     G+ E K
Sbjct: 2547 PMFMAGMARTIIVFPVLMGLIYISGAGMSLMDDLANSFYIRFLISLILWAVVFEPIKGLIWA-FLILKTRKSHKIINKLEEALLRAKPAETFLRNPYGKIEKGLGTEIADVT--------------KLRDTENRKMRDEQLFITIRDMLCFFASLYIMVMLTYYCKDRHGYWYQLEMSTILNINQKNYGDNTFMSIQHADDFWDWARESLATALLAS-WYDGNPAYGMRAYMNDKVSRSMGIGTIRQVRTKKSAECTMFKQFQGYINDCGEELTSKNEEKTLYMQAGWTELESENGTDASDEYTYKTSEELSTETVSGLLYSYSGGGYTISMSGTQAEIITLFNKLDSERWIDDHTRAVIIEFSAYNAQINYFSVVQLLVEIPKSGIYLPNSWVESVRLIK-SEGSDGTVVKYYEMLYIFFSVLIFVKEIVFYLYGRYKVITTMKPTRNPFKIVYQLALGNFSPWNFMDLIVGALAVASVLAYTIRQRTTNRAMEDFNANNGNSYINLTEQRNWEIVFSYCLAGAVFFTSCKMIRILRFNRRIGVLAATLDNALGAIVSFGIAFLFFSMTFNSVLYAVLGNKMGGYRSLMATFQTALAGMLGK---LDVTSIQPISQFAFVVIMLYMIAGSKLVLQLYVTIIMFEFEEIRNDSEKQTNDYEIIDHIKYKTKRRLGLLEPK 3206          

HSP 2 Score: 98.2117 bits (243), Expect = 1.436e-19
Identity = 71/247 (28.74%), Postives = 117/247 (47.37%), Query Frame = 3
Query: 7701 FRVRIFSTGCYFNSN-----NFQGGWGTAGCVVGPLTTTKVTQCICNHLTSFASGWIVAPNTIDFDYVFSNFDFTKNLTLFVTEXXXXXXXXXXXXWARRMDIKDIEKVGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRP----ILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAV 8414
            ++V   S GCYF        N +G + + G  +      +   C  +HLT F+ G        DF Y ++  +  KN+ + +  + + +V+  + I A     KD  +  +  L  N+ +D Y+Y + ++T  R  A T S + F LSG + +   R     +          G  DRF++     LG L+Y+RLW D++G     SWYCN   V DLQT++ ++F  N+W   +  DG+ +RL  V
Sbjct: 2172 YQVAAVSKGCYFYQKTSDVFNSEGMYPSDGQGM------QFVNCSTDHLTMFSVGAFNPTIDADFSYNYNVNEIEKNVKVMIAAVFMLVVYGCLTINAIICQRKDASRGRLRFLKDNEPHDGYMYVIAVETGYRMFATTDSTICFNLSGNEGDQIFRSFRSEEDGNWEFPFSWGTTDRFVMTTAFPLGELEYMRLWLDDAGLDHRESWYCNRIIVKDLQTQDIYYFPFNNWLGTKNGDGETERLARV 2412          
BLAST of PKD1L-1 vs. Ensembl Celegans
Match: pkd-2 (Polycystin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9U1S7])

HSP 1 Score: 178.718 bits (452), Expect = 2.037e-45
Identity = 142/518 (27.41%), Postives = 240/518 (46.33%), Query Frame = 3
Query: 9390 FREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTSNPNWQ--FTGITREEQFWTWALNVLVPNL---RAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFR-SNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFVVTKFIMWTGISETKFGKK 10925
            F E+  Y VF   L++V ++     +Y     ++++F+ ++  +    F   T  +  W W   VL+P +         +N+  +Y         NRL+G   +R ++   +SC V    +   K C++ Y    +D+   G G             F + + KEL  +  +G I  Y GGG+V +   +  +   + +  LK N WID  +RAI ++F  YN NINLF +   + E P SGG+ T  ++   +LL   + G     IF  +  G FIL  I +E+  I + +  Y TQFWNL++V +++G  +A       +  T           G     F  V     +   + + +VF+A +K  K +  N+ +  L S L  ++KD+  F ++F + F AF    Y  F   +  Y     +  A +++ LG F F  L      FGP  F  YV F+ F+LLNMF+AI+ D +  VKA++  +++   ++ + + K     G+  TK GK+
Sbjct:   74 FMEVGGYAVFLIVLVYVAFAQNSIQSYYYSKVMSDLFVASTGASGAPAFGSCTSMDNIWDWLSQVLIPGIYWTETSNSTDNENMIYYE-------NRLLGEPRIRMLKVTNDSCTVMKSFQREIKECFANYEEKLEDKTMVGDG---------SVDAFIYATAKELENLKTVGTIASYGGGGFVQRLPVAGSTEAQSAIATLKANRWIDRGSRAIIVDFALYNANINLFCVVKLLFELPASGGVITTPKLMTYDLLTYQTSGGTRMMIFEGIFCG-FILYFIFEELFAIGRHRLHYLTQFWNLVDV-VLLGFSVATIILSVNRTKTGVNRVNSVIENGLTNAPFDDVTSSENSYLNIKACVVFVAWVKVFKFISVNKTMSQLSSTLTRSAKDIGGFAVMFAVFFFAFAQFGYLCFGTQIADYSNLYNSAFALLRLILGDFNFSALESCNRFFGPAFFIAYVFFVSFILLNMFLAIINDSYVEVKAELARKKDGEGILDWFMNKV---RGL--TKRGKR 568          
BLAST of PKD1L-1 vs. Ensembl Fly
Match: Pkd2 (gene:FBgn0041195 transcript:FBtr0080365)

HSP 1 Score: 139.428 bits (350), Expect = 2.224e-32
Identity = 102/393 (25.95%), Postives = 181/393 (46.06%), Query Frame = 3
Query: 9660 NRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWK-YFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDV-YLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADI 10832
            N L+G   +RQ+R +K SC V D        CY+ Y+   +D     KG          +P   F++  +L+       +  Y  GGY      +       +N LKD HW+D  +R   +EF  +N N ++F     + E P +GG+     ++   +   ++       +   + + I ++   + EI  I K   K YF    N+++  I++G ++A+   ++       LT   A+   DV Y +   + F N     M++ + FL  +K  K + FN+ +    + L   SKD+  F ++F I+FLA+  +   LF      +  F+ +    +++ LG F +  + Q   + GPI F  Y+L + F+LLNMF+AI+ + +  VK +I
Sbjct:  432 NLLLGPPRLRQIRVRKESCYVNDAFIRYFNTCYAAYSSGAEDRKPMHKG----------SP---FRTMHDLDSTPIWTVLAFYRTGGYTVNLDYDKDRNVKIINDLKDIHWLDRGSRLCLVEFNLFNENTDIFQSIKLIAEIPPTGGVIPQAHLQTVKMYSFFTDRSMLMTVIY-IFWYIMVIYYTIYEITEIRKSGIKIYFCSMLNILDCAILLGCYLALVYNIWHSFKVMSLT---ARAHSDVTYQSLDVLCFWNIIYVDMMAILAFLVWIKIFKFISFNKTLVQFTTTLKRCSKDLAGFSLMFGIVFLAYAQLGLLLFGTKHPDFRNFITSILTMIRMILGDFQYNLIEQANRVLGPIYFLTYILLVFFILLNMFLAIIMETYNTVKGEI 807          
BLAST of PKD1L-1 vs. Ensembl Fly
Match: brv3 (gene:FBgn0040333 transcript:FBtr0300708)

HSP 1 Score: 75.485 bits (184), Expect = 8.282e-13
Identity = 78/353 (22.10%), Postives = 151/353 (42.78%), Query Frame = 3
Query: 9870 LNGMSYIGRIGLYSG-GGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLG-----LYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKY----FTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFL---ELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKA--DIELQENDHELVKFVVTKF 10883
            L    ++G +  Y    GYV     + +N    ++ L +NHW+   T A+FI+FT YN ++NLF+I T  VE    GG+    +V+ A LL       Y+G           L  + I V++  +    +  K  Y        WN +++FI + + + V   V  +   + + +K        +++F   +  ++     + F++ + TL+  ++L+F     +    L      +    I   I  + F     ++  +    ++  + +    M  + G  A +   EL+      G + +      II +L+N+F++++ D F V K   D E +EN     +F+V +F
Sbjct:  279 LMNFDHVGSLNSYPELAGYVSLLARSAANSMKVIDYLSENHWLTLNTSAVFIDFTLYNVDVNLFSICTLRVEKTPFGGIVPDVQVDSAKLLENVDQMPYTG-----------LLALLIYVLVFIQFAQTLAVKLWYEPHLLKSVWNKLDLFIFMVNVLVVVLVVLRESLVASMMKKVEGASKMEFIDFRRPSRMHQLTTITIGFLICITTLRLWRVLQFASVFKLFTRTLYLAWSAVASTAIAIVIFLIGFCFAVVTINGNYSSNFNKLVKSMVMCMCYSFGFSAQVKPSELFHGGKWLGILCYGVLAFVIIVLLINVFVSLINDYFTVAKTIRDSE-RENRITFFEFLVVEF 619          
BLAST of PKD1L-1 vs. Ensembl Fly
Match: brv3 (gene:FBgn0040333 transcript:FBtr0340092)

HSP 1 Score: 75.0998 bits (183), Expect = 1.014e-12
Identity = 78/353 (22.10%), Postives = 151/353 (42.78%), Query Frame = 3
Query: 9870 LNGMSYIGRIGLYSG-GGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLG-----LYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKY----FTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFL---ELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKA--DIELQENDHELVKFVVTKF 10883
            L    ++G +  Y    GYV     + +N    ++ L +NHW+   T A+FI+FT YN ++NLF+I T  VE    GG+    +V+ A LL       Y+G           L  + I V++  +    +  K  Y        WN +++FI + + + V   V  +   + + +K        +++F   +  ++     + F++ + TL+  ++L+F     +    L      +    I   I  + F     ++  +    ++  + +    M  + G  A +   EL+      G + +      II +L+N+F++++ D F V K   D E +EN     +F+V +F
Sbjct:  279 LMNFDHVGSLNSYPELAGYVSLLARSAANSMKVIDYLSENHWLTLNTSAVFIDFTLYNVDVNLFSICTLRVEKTPFGGIVPDVQVDSAKLLENVDQMPYTG-----------LLALLIYVLVFIQFAQTLAVKLWYEPHLLKSVWNKLDLFIFMVNVLVVVLVVLRESLVASMMKKVEGASKMEFIDFRRPSRMHQLTTITIGFLICITTLRLWRVLQFASVFKLFTRTLYLAWSAVASTAIAIVIFLIGFCFAVVTINGNYSSNFNKLVKSMVMCMCYSFGFSAQVKPSELFHGGKWLGILCYGVLAFVIIVLLINVFVSLINDYFTVAKTIRDSE-RENRITFFEFLVVEF 619          
BLAST of PKD1L-1 vs. Ensembl Fly
Match: brv2 (gene:FBgn0036712 transcript:FBtr0075242)

HSP 1 Score: 60.4622 bits (145), Expect = 3.496e-8
Identity = 47/197 (23.86%), Postives = 86/197 (43.65%), Query Frame = 3
Query: 9915 GGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFT---QFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRF 10496
             GYV    S   N   ++  L+D  W+D  T A+FI+ T YN + NLF + T  VE+   G       V+  ++LG       + E+    +Y + +++      R +  + W +     + W ++++ I I +       +   I T  L +         YL+F      ++ L  +  F+V + TL+  K+L+F
Sbjct:  294 AGYVVLMMSTKINCLKQIEYLRDYSWLDKNTSALFIDLTMYNADANLFTLITLRVENSPFGIQLPRVHVDSVSMLGNVETRSNS-ELLILFVYTVLVILF----ARGVFTKIWHHPAAAHEAWTMVDLAIYILNVFLTVLAIMRDIETDALLQIIETATKGQYLDFQRPLRLHQMLFIVKGFLVCITTLRLWKVLQF 485          
BLAST of PKD1L-1 vs. Ensembl Fly
Match: brv2 (gene:FBgn0036712 transcript:FBtr0331846)

HSP 1 Score: 60.077 bits (144), Expect = 4.183e-8
Identity = 47/197 (23.86%), Postives = 86/197 (43.65%), Query Frame = 3
Query: 9915 GGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFT---QFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRF 10496
             GYV    S   N   ++  L+D  W+D  T A+FI+ T YN + NLF + T  VE+   G       V+  ++LG       + E+    +Y + +++      R +  + W +     + W ++++ I I +       +   I T  L +         YL+F      ++ L  +  F+V + TL+  K+L+F
Sbjct:  272 AGYVVLMMSTKINCLKQIEYLRDYSWLDKNTSALFIDLTMYNADANLFTLITLRVENSPFGIQLPRVHVDSVSMLGNVETRSNS-ELLILFVYTVLVILF----ARGVFTKIWHHPAAAHEAWTMVDLAIYILNVFLTVLAIMRDIETDALLQIIETATKGQYLDFQRPLRLHQMLFIVKGFLVCITTLRLWKVLQF 463          
BLAST of PKD1L-1 vs. Ensembl Zebrafish
Match: pkd1l2a (polycystic kidney disease 1 like 2a [Source:ZFIN;Acc:ZDB-GENE-050208-89])

HSP 1 Score: 317.005 bits (811), Expect = 3.336e-88
Identity = 215/699 (30.76%), Postives = 354/699 (50.64%), Query Frame = 3
Query: 8907 SDANEKYKKRVIKRKLLPWWMRIIVWGFLTFLVIISVVFTTFYGIQFGDIACKKWISSMFISFFTSVLLTQPIKVVLLAIFFALVCKKSSSFXXXXXXXXXXXXXXXLGRRNALMQNEEFL---HNELYS---------APIKPHRFHV----------QPPPKEELEKAREIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTSNPNWQFTGITR---EEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTA---LSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLY--SGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFVVTKFIMWTGISETK 10913
            S+A+EK   R  + K LPWW   + W  +     +S  FT  YG+ +G      W+ SM +SFF S+ +TQP+KV+  A+FFALV K        +   +           N +++N  +L    + L S         +   P    +          +PPP  ++EK R   +KE +++ + REI  Y+ F   LL V Y  RDPNAY L + +   F          TGI+     +  + WA + L+ NL     Y   P     GFI++ N++L+G A +RQVR ++++C + +  +   ++C++ Y+  ++D GSY  GW     ++ + T    + ++++ +L      G + LY GGG+V     +  N    +  L DN W+D  TRA+F+EFT YN N+NLF I T + E+ G G     YR E    + LY  +GG   F +  + +Y IFIL  +V + + + +QKW YF   WNL+E+ I+I S+ A++ FV   I  ++  E F Q   D++++F   A  +  LGY+++F+V LAT+K   +LR N ++ M+ S L     D+  F ++ TIMFLA+ +    ++   L  Y T L A +  + + LG F + E+    P+ G  +    ++F+ FV+LN+FI+++   F   +      E + E+V+ ++ K     GI   K
Sbjct:  439 SEASEKEGSRKCQ-KGLPWWFVFVGWFLVLATSGVSAYFTMLYGLTYGKERSISWLISMVVSFFESLFITQPVKVLGFAVFFALVLKTVDQDEYGDVSIDGTLSNTG----NRIIRNMNYLSIFDDHLISVVKLQLKCLSTDDPDAVRIARRDSTCSFYKPPPPTDIEKMRNNMIKEQKVFALIREILIYVGFLWMLLLVAYGQRDPNAYYLTHHIRQSF---------STGISETLNHKDIFIWANSSLLRNL-----YGQYP-----GFITDGNSKLVGNARIRQVRVRRDTCKIANPMQYSVRDCHAPYSWESEDMGSYSPGWNQTRNVNGSKTVLKPWYYQTQAKLRANPVWGGLALYKGGGFVVDLGPDQKNASRLLQYLFDNTWLDVYTRAVFVEFTVYNANVNLFCIVTLIFETTGVGTFQ--YRSE-VQAVHLYQSTGGFHVFVMASEAIYYIFILYYMVVQGKLMKQQKWAYFKSKWNLLELAIIILSWSALSVFVKRTILGNRDIE-FYQNNKDMFVSFNETATADAVLGYLIAFLVLLATIKLWHLLRLNPKLHMITSTLQRAWTDISGFIVVMTIMFLAYSIACNLMYGWRLNSYRTLLEAAQTIICLQLGIFNYDEVLDYNPVLGAFLIGSCIIFMTFVVLNLFISVILVAFNEEQLHPTPSE-EEEIVELMLMKVCSLLGIKCKK 1108          

HSP 2 Score: 148.673 bits (374), Expect = 6.916e-35
Identity = 118/410 (28.78%), Postives = 172/410 (41.95%), Query Frame = 3
Query: 7782 VGPLTTTKVTQCICNHLTSFASGWIVAPNTIDFDYVFSNFDFTKNLTLFVTEXXXXXXXXXXXXWARRMDIKDIEKVGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWY--CNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVA*G-----------------PTKTTESVLTVGPFALTSREIWIGFVTNIISFVPLFVIIEMFRRSQLKHGHANKLRQAVENHLQISLESKENKGYQGSTATLVRNEDV--NSRPTTPSYRSTDQINIQ----------IPEYEVENQDSDAN 8918
            VGP TTT VTQC+C HLT F S + V PN +D          ++   LF T                   + +   V VT L  ND    Y Y ++I+T  R  A TSS V   L G + E++P HL D ++P+ +RG +D FLL  P SLG LQ IRLWHDNSG      +Y  CN F                                              F++  K +  + H+W S+++RPP S FTRV+RV+                   P+  +E  + +G    T +++ IG  ++II F    +I+ +FR       +A    Q  E+ L+   +SK +   QG T  +  N+ +  N +  TP     D   I           +P  E++   +D N
Sbjct:    1 VGPRTTTLVTQCLCTHLTFFGSSFFVMPNVVDV---------SRTAELFATF------------------VNNPVVVKVTVLEDNDPLAEYRYLLSINTGQRRGASTSSQVTVTLQGSEGESEPHHLTDPEKPVFERGGLDLFLLTTPFSLGELQSIRLWHDNSG------YYPACNLF----------------------------------------------FAKTAK-DFRDGHIWFSVISRPPSSNFTRVQRVSCCFSLLLCTMLTSIMFWGIPSDPSEQTMDLGKIEFTWQQVMIGIQSSIIMFPINLLIVSIFR-------NARPREQKSESSLK--QQSKLDSTKQGKTGRVSPNQPLHDNQKEITPDTVMKDIKRIAQSLYKVMRRPVPRIELDPTKTDIN 321          
BLAST of PKD1L-1 vs. Ensembl Zebrafish
Match: pkd1l2a (polycystic kidney disease 1 like 2a [Source:ZFIN;Acc:ZDB-GENE-050208-89])

HSP 1 Score: 317.39 bits (812), Expect = 6.998e-86
Identity = 213/683 (31.19%), Postives = 350/683 (51.24%), Query Frame = 3
Query: 8907 SDANEKYKKRVIKRKLLPWWMRIIVWGFLTFLVIISVVFTTFYGIQFGDIACKKWISSMFISFFTSVLLTQPIKVVLLAIFFALVCKK------SSSFXXXXXXXXXXXXXXXLGRRNALMQNEEFLHNELYSAPIKPHRFHVQPPPKEELEKAREIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTSNPNWQFTGITR---EEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTA---LSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLY--SGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFVVTKFIMWTGISETK 10913
            S+A+EK   R  + K LPWW   + W  +     +S  FT  YG+ +G      W+ SM +SFF S+ +TQP+KV+  A+FFALV K            +    N ++     + RR++                     F+ +PPP  ++EK R   +KE +++ + REI  Y+ F   LL V Y  RDPNAY L + +   F          TGI+     +  + WA + L+ NL     Y   P     GFI++ N++L+G A +RQVR ++++C + +  +   ++C++ Y+  ++D GSY  GW     ++ + T    + ++++ +L      G + LY GGG+V     +  N    +  L DN W+D  TRA+F+EFT YN N+NLF I T + E+ G G     YR E    + LY  +GG   F +  + +Y IFIL  +V + + + +QKW YF   WNL+E+ I+I S+ A++ FV   I  ++  E F Q   D++++F   A  +  LGY+++F+V LAT+K   +LR N ++ M+ S L     D+  F ++ TIMFLA+ +    ++   L  Y T L A +  + + LG F + E+    P+ G  +    ++F+ FV+LN+FI+++   F   +      E + E+V+ ++ K     GI   K
Sbjct: 1830 SEASEKEGSRKCQ-KGLPWWFVFVGWFLVLATSGVSAYFTMLYGLTYGKERSISWLISMVVSFFESLFITQPVKVLGFAVFFALVLKTVDQDEYGDVSIDGTLSNTDDPDAVRIARRDSTCS------------------FY-KPPPPTDIEKMRNNMIKEQKVFALIREILIYVGFLWMLLLVAYGQRDPNAYYLTHHIRQSF---------STGISETLNHKDIFIWANSSLLRNL-----YGQYP-----GFITDGNSKLVGNARIRQVRVRRDTCKIANPMQYSVRDCHAPYSWESEDMGSYSPGWNQTRNVNGSKTVLKPWYYQTQAKLRANPVWGGLALYKGGGFVVDLGPDQKNASRLLQYLFDNTWLDVYTRAVFVEFTVYNANVNLFCIVTLIFETTGVGTFQ--YRSE-VQAVHLYQSTGGFHVFVMASEAIYYIFILYYMVVQGKLMKQQKWAYFKSKWNLLELAIIILSWSALSVFVKRTILGNRDIE-FYQNNKDMFVSFNETATADAVLGYLIAFLVLLATIKLWHLLRLNPKLHMITSTLQRAWTDISGFIVVMTIMFLAYSIACNLMYGWRLNSYRTLLEAAQTIICLQLGIFNYDEVLDYNPVLGAFLIGSCIIFMTFVVLNLFISVILVAFNEEQLHPTPSE-EEEIVELMLMKVCSLLGIKCKK 2468          

HSP 2 Score: 233.417 bits (594), Expect = 2.047e-60
Identity = 139/387 (35.92%), Postives = 204/387 (52.71%), Query Frame = 3
Query: 7743 NNFQGGWGTAGCVVGPLTTTKVTQCICNHLTSFASGWIVAPNTIDFDYVFSNF-DFTKNLTLFVTEXXXXXXXXXXXXWARRMDIKDIEKVGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVA*G-----------------PTKTTESVLTVGPFALTSREIWIGFVTNIISFVPLFVIIEMFRRSQLKHGHANKLRQAVENHLQISLESKENKGYQGSTATLVRNEDV--NSRPTTP 8843
            +  +  W   GC VGP TTT VTQC+C HLT F S + V PN +D       F  F  N  +      + L ++ + IWARR DI+D  KV VT L  ND    Y Y ++I+T  R  A TSS V   L G + E++P HL D ++P+ +RG +D FLL  P SLG LQ IRLWHDNS  G   +WY N   V DL+  +K+HFL NSW +++  +  +D++  VA+  +L  F  +F  K   +  + H+W S+++RPP S FTRV+RV+                   P+  +E  + +G    T +++ IG  ++II F    +I+ +FR       +A    Q  E+ L+   +SK +   QG T  +  N+ +  N +  TP
Sbjct: 1302 DEIKANWSGEGCRVGPRTTTLVTQCLCTHLTFFGSSFFVMPNVVDVSRTAELFATFVNNPVVVCFVGAIILAYLLVVIWARRKDIQDAVKVKVTVLEDNDPLAEYRYLLSINTGQRRGASTSSQVTVTLQGSEGESEPHHLTDPEKPVFERGGLDLFLLTTPFSLGELQSIRLWHDNS--GYYPAWYVNKVTVQDLENGQKWHFLCNSWLSIDLGECTLDKVFPVATEMDLKRFSNLFFAKTAKDFRDGHIWFSVISRPPSSNFTRVQRVSCCFSLLLCTMLTSIMFWGIPSDPSEQTMDLGKIEFTWQQVMIGIQSSIIMFPINLLIVSIFR-------NARPREQKSESSLK--QQSKLDSTKQGKTGRVSPNQPLHDNQKEITP 1677          
BLAST of PKD1L-1 vs. Ensembl Zebrafish
Match: pkd1l2b (polycystic kidney disease 1 like 2b [Source:ZFIN;Acc:ZDB-GENE-141222-87])

HSP 1 Score: 270.011 bits (689), Expect = 1.201e-71
Identity = 185/672 (27.53%), Postives = 324/672 (48.21%), Query Frame = 3
Query: 8913 ANEKYKKRVIKRKLLPWWMRIIVWGFLTFLVIISVVFTTFYGIQFGDIACKKWISSMFISFFTSVLLTQPIKVVLLAIFFALVCKKSSSFXXXXXXXXXXXXXXXLGRRNALMQNEEFLHNELYSAPIKPHRFHVQPPPKEELEKAREIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTSNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGW---TALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYS--GGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFVVTKFIMWTGISETK 10913
            +N K KK   ++   PWW   + W  +    +IS  FT  YG+++G      WI S    F  S+  T+P+KVV + IFFALV KK  + +      +++      G         +   +            + QPPP  ++EK R   +K+ +   +  E+  ++ F   LL V Y  +DPNA+ L   +   F K        +   +    + WA  VL+ NL     +   P     GFI++ N++L+G A +RQVR KK++C V          C + Y+  N+D  SYG GW    +++ ++     + ++S+  L  +   G   LY GGGYV     +  N   ++  L ++ W+D  TRA+F+EFT YN N++LF I T ++ES   G     +R    N + LYS  G   +F +  +V+Y +F++  +  + + + +QKW YF   WNL+++ I+I S+ +++ F+  +     +  ++ Q   + + +F   A  +  L Y+++F+V L  +K   +LR + ++ ++ S L     DM    ++  I+ LA+ +    +F   LY Y T   A  A   + +G F + E+    P  G ++ +  VL   FV+L++FI+I+       + + +  E + E V+ V+ K + + GI   K
Sbjct: 1254 SNSKPKKHGCQKDP-PWWFVYVGWVLVIGTSVISGYFTMLYGLKYGKDRSVSWIISNVTGFTQSLCFTEPVKVVFIGIFFALVMKKVEAEDEEVDTLQKKTTAGSDGLSEVCFAQRDCTQS------------YYQPPPPGDIEKLRRNMIKQQKAQALVMEVLIFLGFLSMLLLVAYGQQDPNAFYLTQHIQQSFSKG------ISDSMKTNDVFVWANTVLLKNL-----FGQYP-----GFITDGNSKLVGNARIRQVRVKKDTCKVAKVMLHTVSQCNTPYSWGNEDMMSYGPGWEEFNSVNGSEEGITAWQYQSQSTLKALPVWGLTALYRGGGYVMDLGPDKQNATMKLQYLFNSTWLDEYTRAVFVEFTVYNANVDLFCIVTLILESSAVGAFQ--FRSVLQN-VSLYSSVGSFMSFLMASRVIYFLFVVYYMFLQGKLLKRQKWAYFRNKWNLLDMAIIILSWSSLSLFIQ-KTVQGNIDIQYYQKHKNQFPSFHDTAAVDATLRYVMAFLVLLGCVKLWHLLRLSPKLYVIASSLQRAWDDMSTLTVVIFIILLAYSLACNLIFGWELYTYRTLPDAFTAIFSLQIGIFNYDEVMNSNPALGAVIISSCVLIATFVVLSLFISIILMAVTEERENHQPSE-EEETVELVMMKIMSFFGIKSKK 1891          

HSP 2 Score: 233.417 bits (594), Expect = 1.855e-60
Identity = 137/375 (36.53%), Postives = 199/375 (53.07%), Query Frame = 3
Query: 7656 RPPVPYTISAQINNTFRVRIFSTGCYFNSNNFQGGWGTAGCVVGPLTTTKVTQCICNHLTSFASGWIVAPNTID---FDYVFSNFDFTKNLTLFVTEXXXXXXXXXXXXWARRMDIKDIEKVGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVA*G-----------------PTKTTESVLTVGPFALTSREIWIGFVTNIISFVPLFVIIEMFRRSQLKHGHANK 8720
            RP VP  + + IN +  V   +  C F     +  W   GC VGP TT  VTQC+C HLT F + + V PNT+D      +FSNF     +  F+    + + FI    WARR D+KD  KV VT L  ND    Y Y V I T  R  + TSS V   + G + + +P HL D ++P+ +RG VD FLL  P SLG LQ IRLWHDNS  G + +W+ +   + DLQT++K++FL NSW +V+ +D  ++++  VAS  ++  F  VF  K   +  + HLW S++ RP  S FT V+RV+                   PT  +E  + +G   LT  ++ IGF + ++ F    +I+ +FRR++ +     K
Sbjct:  738 RPKVPPGVKS-INASVTVTSVTAQCIF-WEEARANWSDYGCRVGPKTTPYVTQCLCTHLTFFGNSFFVMPNTVDPTKSAQLFSNFAQNPVVVCFI--GAIFVAFILTAAWARRKDLKDKAKVKVTVLDDNDPFAEYCYLVKISTGHRPGSSTSSRVIVTVQGMEGDCEPHHLTDPEKPVFERGGVDLFLLTTPYSLGDLQSIRLWHDNS--GNHPAWFVSTVVIKDLQTEQKWNFLCNSWLSVDVDDCTVEKVFPVASEVDMKGFSNVFFSKTTTDFCDKHLWYSVVCRPVNSSFTCVQRVSCCFSVLLCSMLTSIMFYGIPTDPSEQTMDMGQIQLTWSQVMIGFESTLLVFPINLIIVGIFRRTRPRKKTTKK 1106          
BLAST of PKD1L-1 vs. Ensembl Zebrafish
Match: pkd1l2b (polycystic kidney disease 1 like 2b [Source:ZFIN;Acc:ZDB-GENE-141222-87])

HSP 1 Score: 249.21 bits (635), Expect = 9.477e-67
Identity = 181/678 (26.70%), Postives = 322/678 (47.49%), Query Frame = 3
Query: 8901 QDSDANEKYKKRVIKRKLLPWWMRIIVWGFLTFLVIISVVFTTFYGIQFGDIACKKWISSMFISFFTSVLLTQPIKVVLLAIFFA--LVCKKSSSFXXXXXXXXXXXXXXXLGRRNALMQNEEFLHNELYSAPIKPHRFHVQPPPKEELEKAREIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTSNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGW---TALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYS--GGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFVVTKFIMWTGISETK 10913
            +   +N K KK   ++   PWW   + W  +    +IS  FT  YG+++G      WI S    F  S+  T+P+K+     F     V  K+  F                    ++  + + L +E+  A     + + QPPP  ++EK R   +K+ +   +  E+  ++ F   LL V Y  +DPNA+ L   +   F K        +   +    + WA  VL+ NL     +   P     GFI++ N++L+G A +RQVR KK++C V          C + Y+  N+D  SYG GW    +++ ++     + ++S+  L  +   G   LY GGGYV     +  N   ++  L ++ W+D  TRA+F+EFT YN N++LF I T ++ES   G     +R    N + LYS  G   +F +  +V+Y +F++  +  + + + +QKW YF   WNL+++ I+I S+ +++ F+  +     +  ++ Q   + + +F   A  +  L Y+++F+V L  +K   +LR + ++ ++ S L     DM    ++  I+ LA+ +    +F   LY Y T   A  A   + +G F + E+    P  G ++ +  VL   FV+L++FI+I+       + + +  E + E V+ V+ K + + GI   K
Sbjct:  377 EQQTSNSKPKKHGCQKDP-PWWFVYVGWVLVIGTSVISGYFTMLYGLKYGKDRSVSWIISNVTGFTQSLCFTEPVKLSWSLRFRIKNFVSHKADVF--------------------SICNSTDGL-SEVCFAQRDCTQSYYQPPPPGDIEKLRRNMIKQQKAQALVMEVLIFLGFLSMLLLVAYGQQDPNAFYLTQHIQQSFSKG------ISDSMKTNDVFVWANTVLLKNL-----FGQYP-----GFITDGNSKLVGNARIRQVRVKKDTCKVAKVMLHTVSQCNTPYSWGNEDMMSYGPGWEEFNSVNGSEEGITAWQYQSQSTLKALPVWGLTALYRGGGYVMDLGPDKQNATMKLQYLFNSTWLDEYTRAVFVEFTVYNANVDLFCIVTLILESSAVGAFQ--FRSVLQN-VSLYSSVGSFMSFLMASRVIYFLFVVYYMFLQGKLLKRQKWAYFRNKWNLLDMAIIILSWSSLSLFIQ-KTVQGNIDIQYYQKHKNQFPSFHDTAAVDATLRYVMAFLVLLGCVKLWHLLRLSPKLYVIASSLQRAWDDMSTLTVVIFIILLAYSLACNLIFGWELYTYRTLPDAFTAIFSLQIGIFNYDEVMNSNPALGAVIISSCVLIATFVVLSLFISIILMAVTEERENHQPSE-EEETVELVMMKIMSFFGIKSKK 1011          

HSP 2 Score: 150.984 bits (380), Expect = 9.112e-36
Identity = 77/227 (33.92%), Postives = 125/227 (55.07%), Query Frame = 3
Query: 8091 NAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVA*G-----------------PTKTTESVLTVGPFALTSREIWIGFVTNIISFVPLFVIIEMFRRSQLKHGHANK 8720
            N  ++  V   + G + + +P HL D ++P+ +RG VD FLL  P SLG LQ IRLWHDNSG   + +W+ +   + DLQT++K++FL NSW +V+ +D  ++++  VAS  ++  F  VF  K   +  + HLW S++ RP  S FT V+RV+                   PT  +E  + +G   LT  ++ IGF + ++ F    +I+ +FRR++ +     K
Sbjct:    9 NVISTLQVIVTVQGMEGDCEPHHLTDPEKPVFERGGVDLFLLTTPYSLGDLQSIRLWHDNSGN--HPAWFVSTVVIKDLQTEQKWNFLCNSWLSVDVDDCTVEKVFPVASEVDMKGFSNVFFSKTTTDFCDKHLWYSVVCRPVNSSFTCVQRVSCCFSVLLCSMLTSIMFYGIPTDPSEQTMDMGQIQLTWSQVMIGFESTLLVFPINLIIVGIFRRTRPRKKTTKK 233          
BLAST of PKD1L-1 vs. Ensembl Zebrafish
Match: pkd2 (polycystic kidney disease 2 [Source:NCBI gene;Acc:432387])

HSP 1 Score: 245.358 bits (625), Expect = 5.260e-66
Identity = 161/540 (29.81%), Postives = 263/540 (48.70%), Query Frame = 3
Query: 9321 PPPKEE-------LEKAR---EIRL-------KELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKT---SNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYG-KGWTALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEK--FAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFV 10871
            PP +E        LEK R   + RL       +E+ +  V RE+  YI+F  TL  +TY     N Y     ++ +F+ T   S     F  ++  E FW +     +  +   +WYNN      +  I    N L+G   +RQ+R +  SC+V +  +    +CY+ Y+  N+D+  +G K  TA          + FK E  L   SY G++  Y GGGY             ++  LK+N W+D  TRA+F++F+ YN N+NLF I   +VE P +GG    ++ +   LL  Y      F   C+V + +F+L  +V+E   I   + +YF   WN ++V IV    ++V   +     TS ++ +  F       Y NF  +A    +   + + IVFL+ +K  K + FN+ +  L + ++  +KD+  F I+F I+FLA+  + Y +F   +  + TF        +I LG F F E+ + + + GPI F  +V FI  +LLNMF+AI+ D ++ VKAD+  Q ++ E+   +
Sbjct:  117 PPAQEHRSCGKRILEKMRVLWDTRLLGESNSNREMYLKTVLREMITYILFLLTLCIITYGMVSTNMYYYTKVMSQLFLDTPLSSGEPTNFKSLSTMEDFWKFTEGPFLNGMYWELWYNNKSLPENQSLIY-YENLLLGVPRLRQLRVRNESCSVHEDLRDEVYDCYNVYSPANEDKAPFGPKNGTA----------WRFKDESSLGESSYWGQVSTYGGGGYYQDLSRTREKSANQLQELKNNLWLDRGTRAVFLDFSIYNGNVNLFCIVRLLVEFPATGGAVPSWQFQTVRLL-RYVSSWDYFVGMCEVSFCLFVLYYLVEEALEIRLHRLRYFKSLWNCLDVLIVA---LSVPAIIMNICRTSAVSHRLHFLLENHSTYPNFEPLARLQVHFNNLAAIIVFLSWVKLFKFINFNKTMNQLSTTMSRCAKDLMGFAIMFFIVFLAYAQLAYLVFGTQVNDFSTFQACIFTQFRIILGDFDFSEIEEADSVLGPIYFTTFVFFIFMILLNMFLAIINDTYSEVKADMAQQRSEMEITDLI 641          
BLAST of PKD1L-1 vs. Ensembl Xenopus
Match: ENSXETT00000038579.1 (polycystin 1 like 2 (gene/pseudogene) [Source:NCBI gene;Acc:100486136])

HSP 1 Score: 305.834 bits (782), Expect = 2.780e-82
Identity = 201/669 (30.04%), Postives = 329/669 (49.18%), Query Frame = 3
Query: 8955 LPWWMRIIVWGFLTFLVIISVVFTTFYGIQFGDIACKKWISSMFISFFTSVLLTQPIKVVLLAIFFALVCKKSSSFXXXXXXXXXXXXXXXLGRRNALMQNEEFLHNELYSAPIKPHRFH--------VQPPPKEELEKAREIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTSNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGW--TALS-ANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQI-ATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFVVTKFIMWTGISETKFGKK 10925
            LPWW   I W  +     +S  FT  YG+ +G  +  KW+ SM ISFF S+ +TQP+KV+  A FFALV KK                             EE   N   S P  P+            QPPP  ++ K +   +KE +++ + REI  Y+ F   LL V Y  RDPN+Y L   + + F         F  +   ++F+TWA   L+ NL     Y + P     GFI++ N++L+G A MRQ+R KK+SC V    +S   NC + Y++  ++ G Y   W  +A++ A D  +P + +++  +L G    G++  Y GGGYV    +        +  L  N W+D  TRA+F+EFT YN N+NLF I   + E+   G  +T   ++   L   ++ G+  F +  +V+Y +F++  +V + + +  +KW YF   WNL+E+ ++I S+ A++ +V   I  T  L  ++ Q   + +++F   A  +  LGY+++F+V L+T+K   +LR N ++ M+ + L     D+  F  +  IMFLA+ +    +F   L  Y T   + +  + + LG F + E+    P+ G  +    ++F+ FV+LN+FI+++   F+        +E  H  V F+  K     G   T   K 
Sbjct: 1545 LPWWFVFIGWLLVAATSGVSAFFTMLYGLHYGKDSSIKWLISMAISFFESLFITQPLKVLGFAAFFALVLKKVEP-----------------------EDEEETTINGNLSTPGDPNPLLGSRRDSNIYQPPPPTDITKMKNNYMKEQKVFALIREILAYLGFLWMLLLVAYGQRDPNSYYLNKHIESSFTD------GFEDLCSYQEFFTWANTTLINNL-----YGSHP-----GFITDGNSKLVGGARMRQIRIKKDSCPVASVLQSTIDNCRAPYSLDAEEMGHYDGSWNFSAITNATDVNSPWY-YQNHSKLRGHPTWGKLATYRGGGYVADLGNERKYAHRVLQDLFSNIWLDSYTRAVFVEFTVYNANVNLFCIVKLMFETNALGTFFTRANLQSVRLYP-FTDGLHIFVVAAEVIYFLFVIYYMVVQGKRMKAEKWGYFRSKWNLLELALIIISWSALSVYVKRTILGTRDL--RYYQEHKNEFVSFNETAAADAALGYLIAFLVLLSTIKLWHLLRLNPKLNMITATLRRAWGDISGFITVIVIMFLAYSIACNLIFGWKLNSYKTVFDSAKTMVSLQLGIFNYEEVLDYNPVLGSFLVGSCIIFMTFVVLNLFISVILVAFS--------EEQKHHQVTFLHGKIRENCGEKNTTISKS 2162          

HSP 2 Score: 228.024 bits (580), Expect = 1.398e-58
Identity = 146/399 (36.59%), Postives = 203/399 (50.88%), Query Frame = 3
Query: 7560 SSMPDYSKTLDTLYFGVRELTPAEYDLYTRSNRPPVPYTISAQINNTFRVRIFSTGCYFNSNNFQGGWGTAGCVVGPLTTTKVTQCICNHLTSFASGWIVAPNTIDFDYVFSNF-DFTKNLTLFVTEXXXXXXXXXXXXWARRMDIKDIEKVGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVA*G-----------------PTKTTESVLTVGPFALTSREIWIGFVTNIISFVPLFVIIEMFRRSQLK 8702
            S M +  K L+ L FG        Y L  RS        ++   N T  V  FST C F     Q  W + GC VGP TT   TQC+CNHLT F S +IV PN +D       F  F  N  +  T   +ALV++ + IWARR DI+D  KV +  L  ND    Y Y VT+ T  R  A T+S V   L G   E+DP HL D + P+ +RG  D FLL     LG +Q IRLWHDNS  G   SWY N   V D++  +K++FL NSW ++E  D  +D++ +VA+ +++  F  +F  K      + H+W S+ +R P S FTRV+RV+                   PT   E  + +G    T +E+ IGF ++++ F    +I+++FR  + K
Sbjct:  997 SKMYNRGKLLEELLFG-----EGTYYLIVRSELE----DLTPNDNLTIVVTCFSTQCMFWDEANQD-WNSTGCHVGPKTTPSSTQCLCNHLTFFGSSFIVMPNAVDVSRTVELFATFVDNPVVVTTVGCIALVYVLVMIWARRKDIQDNAKVKIIALEDNDPFAQYRYLVTVFTGHRRGAATTSKVTITLYGSDGESDPHHLSDPEGPVFERGGEDIFLLTTLFPLGDVQTIRLWHDNS--GDKPSWYVNRVLVHDMELDQKWYFLCNSWLSIEVGDCVLDKVFSVATEEDMKQFSNLFFMKTSKGFRDGHIWYSVFSRSPRSSFTRVQRVSCCFSLLLCTMLTSIMFWGVPTDPAEQKMDMGKIEFTWQEVMIGFESSLLMFPINLLIVQIFRNIRPK 1383          
BLAST of PKD1L-1 vs. Ensembl Xenopus
Match: PKD2L1 (polycystic kidney disease 2-like 1 [Source:NCBI gene;Acc:100495064])

HSP 1 Score: 238.81 bits (608), Expect = 1.307e-66
Identity = 152/498 (30.52%), Postives = 253/498 (50.80%), Query Frame = 3
Query: 9366 KELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKT-SNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHE 10856
            +EL +    RE+  YIVF   +  +TY     N Y   N ++ +F+ T S+    F  I+  + FW++    ++  L    WYNN         +    N L+G   MRQ++ K NSC V+   K     C+  Y+   +D   +G               +++ +E+EL G SY G+I  YSGGGY         +   ++  LK N W+D  TRA+F++F+ YN NINLF +   VVE P +GG    +++    L+  Y  G   F I C++++ IFI   +V+EI  +   K++YFT  WN+++V +++ S +A+   ++  +  ++L     +    +Y +F ++AF       M +  +F A +K  K + FN+ +  L S L   +KD+  F I+F I+F A+  + Y LF   +  + TF+       +I LG F +  +     + GPI F  YV F+ FVLLNMF+AI+ D ++ VK ++  Q+N+ +
Sbjct:   23 RELYIKTTLRELLVYIVFLVDICLLTYGMTSTNTYYYTNVMSKLFLDTQSDSGVTFKAISNMDDFWSYLQGPMLDGLYWTKWYNNVSLTDNTNSLIYYENLLLGVPRMRQLKVKNNSCMVYKDFKDEIVGCFDVYSKDKEDTSQFGL---------INGTAWTYYTEEELGGSSYWGKITTYSGGGYYIDLELTKRDSLRQLQTLKSNLWLDRGTRAVFVDFSVYNANINLFCVLRLVVEFPATGGAIPSWQIRTVKLIR-YVSGWDYFIIGCEIVFCIFIFYYVVEEILELRIHKFRYFTSIWNILDVIVILLSLVAIGFHIFRTMEVNRLMGTLLK-NPTIYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGFAIMFFIVFFAYAQLGYLLFGTQVENFSTFVKCIFTQFRIILGDFDYDAIDNANRVLGPIYFVTYVFFVFFVLLNMFLAIINDTYSEVKEELSNQKNELQ 509          
BLAST of PKD1L-1 vs. Ensembl Xenopus
Match: PKD2L1 (polycystic kidney disease 2-like 1 [Source:NCBI gene;Acc:100495064])

HSP 1 Score: 239.195 bits (609), Expect = 5.957e-66
Identity = 152/496 (30.65%), Postives = 252/496 (50.81%), Query Frame = 3
Query: 9366 KELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKT-SNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQEND 10850
            +EL +    RE+  YIVF   +  +TY     N Y   N ++ +F+ T S+    F  I+  + FW++    ++  L    WYNN         +    N L+G   MRQ++ K NSC V+   K     C+  Y+   +D   +G               +++ +E+EL G SY G+I  YSGGGY         +   ++  LK N W+D  TRA+F++F+ YN NINLF +   VVE P +GG    +++    L+  Y  G   F I C++++ IFI   +V+EI  +   K++YFT  WN+++V +++ S +A+   ++  +  ++L     +    +Y +F ++AF       M +  +F A +K  K + FN+ +  L S L   +KD+  F I+F I+F A+  + Y LF   +  + TF+       +I LG F +  +     + GPI F  YV F+ FVLLNMF+AI+ D ++ VK ++  Q+N+
Sbjct:   37 RELYIKTTLRELLVYIVFLVDICLLTYGMTSTNTYYYTNVMSKLFLDTQSDSGVTFKAISNMDDFWSYLQGPMLDGLYWTKWYNNVSLTDNTNSLIYYENLLLGVPRMRQLKVKNNSCMVYKDFKDEIVGCFDVYSKDKEDTSQFGL---------INGTAWTYYTEEELGGSSYWGKITTYSGGGYYIDLELTKRDSLRQLQTLKSNLWLDRGTRAVFVDFSVYNANINLFCVLRLVVEFPATGGAIPSWQIRTVKLIR-YVSGWDYFIIGCEIVFCIFIFYYVVEEILELRIHKFRYFTSIWNILDVIVILLSLVAIGFHIFRTMEVNRLMGTLLK-NPTIYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGFAIMFFIVFFAYAQLGYLLFGTQVENFSTFVKCIFTQFRIILGDFDYDAIDNANRVLGPIYFVTYVFFVFFVLLNMFLAIINDTYSEVKEELSNQKNE 521          
BLAST of PKD1L-1 vs. Ensembl Xenopus
Match: usp33 (ubiquitin specific peptidase 33 [Source:Xenbase;Acc:XB-GENE-1016674])

HSP 1 Score: 236.113 bits (601), Expect = 6.053e-65
Identity = 158/515 (30.68%), Postives = 261/515 (50.68%), Query Frame = 3
Query: 9351 REIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIK---TSNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYG-KGWTALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIF---CQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVY-VQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFV 10871
              I  +E  +  VFRE+  YIVF   +  +TYS    N +     ++ +F+    + +    F  +   + FW +    L+  L   +WYNN        FI    N L+G   +RQ+R K  SC+V +  K   K+CY +Y++ N+D   +G +  TA          +++  EK+LNG S  G I +YSG GY      N      ++  LK+N W+D  TRA+FI+F+ YN N+NLF +   +VE P +GG+ T ++ +   L+      + +FE F   C++++ IFIL  I++E   I      YF   WN +++ I+  S  A+   +Y +      L ++ +    +V+ N   +A+       + + IVF A +K  K   FNR +  L + ++  +KD+  F I+F I+FLA+    Y +F   +  + TF        +I LG F F E+ +   I GPI F  +V F+ F+LLNMF+AI+ D ++ VK D+  Q+++ EL+  +
Sbjct:   14 ERITTREKYLKIVFRELITYIVFLVIVCVLTYSMVTSNMFYYTKGMSQLFLDGPVSKDERTNFKTLLTMDDFWKFTEGPLMDGLYWDMWYNNRTMAENHSFIY-YENLLLGVPRLRQLRVKNGSCSVPEDLKDEIKDCYDSYSVRNEDTTPFGLRNGTA----------WTYTKEKDLNGSSQWGVISVYSGAGYYIDLSRNREESAAQIAMLKNNLWLDRGTRAVFIDFSVYNANLNLFCVVRLLVEFPATGGLITSWQFQTVKLIHY----ISSFEFFLAACEIIFCIFILYYIIEEFLEIHVHHLHYFRSLWNWLDIVIIGLSLPAIGIHLYKMSSVEGPLNKQLSDL--NVFPNLESLAYWQIQFNSVAAVIVFFAWVKLFKFANFNRTMTQLSTTMSRCAKDILGFAIMFFIIFLAYAQFAYLVFGTQIDDFSTFQHCIFTQFRIILGDFDFTEVEEANRILGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKTDMAQQKSEMELIDLI 511          
BLAST of PKD1L-1 vs. Ensembl Xenopus
Match: usp33 (ubiquitin specific peptidase 33 [Source:Xenbase;Acc:XB-GENE-1016674])

HSP 1 Score: 236.113 bits (601), Expect = 2.294e-64
Identity = 159/515 (30.87%), Postives = 261/515 (50.68%), Query Frame = 3
Query: 9351 REIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIK---TSNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYG-KGWTALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIF---CQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVY-VQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFV 10871
              I  +E  +  VFRE+  YIVF   +  +TYS    N +     ++ +F+    + +    F  +   + FW +    L+  L   +WYNN        FI    N L+G   +RQ+R K  SC+V +  K   K+CY +Y++ N+D   +G +  TA          +++  EK+LNG S  G I +YSG GY      N      ++  LK+N W+D  TRA+FI+F+ YN N+NLF +   +VE P +GG+ T ++ +   L+   S    +FE F   C++++ IFIL  I++E   I      YF   WN +++ I+  S  A+   +Y +      L ++ +    +V+ N   +A+       + + IVF A +K  K   FNR +  L + ++  +KD+  F I+F I+FLA+    Y +F   +  + TF        +I LG F F E+ +   I GPI F  +V F+ F+LLNMF+AI+ D ++ VK D+  Q+++ EL+  +
Sbjct:   37 ERITTREKYLKIVFRELITYIVFLVIVCVLTYSMVTSNMFYYTKGMSQLFLDGPVSKDERTNFKTLLTMDDFWKFTEGPLMDGLYWDMWYNNRTMAENHSFIY-YENLLLGVPRLRQLRVKNGSCSVPEDLKDEIKDCYDSYSVRNEDTTPFGLRNGTA----------WTYTKEKDLNGSSQWGVISVYSGAGYYIDLSRNREESAAQIAMLKNNLWLDRGTRAVFIDFSVYNANLNLFCVVRLLVEFPATGGLITSWQFQTVKLIHYIS----SFEFFLAACEIIFCIFILYYIIEEFLEIHVHHLHYFRSLWNWLDIVIIGLSLPAIGIHLYKMSSVEGPLNKQLSDL--NVFPNLESLAYWQIQFNSVAAVIVFFAWVKLFKFANFNRTMTQLSTTMSRCAKDILGFAIMFFIIFLAYAQFAYLVFGTQIDDFSTFQHCIFTQFRIILGDFDFTEVEEANRILGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKTDMAQQKSEMELIDLI 534          
BLAST of PKD1L-1 vs. Ensembl Mouse
Match: Pkd1l2 (polycystic kidney disease 1 like 2 [Source:MGI Symbol;Acc:MGI:2664668])

HSP 1 Score: 327.02 bits (837), Expect = 8.170e-89
Identity = 203/660 (30.76%), Postives = 335/660 (50.76%), Query Frame = 3
Query: 8931 KRVIKR-KLLPWWMRIIVWGFLTFLVIISVVFTTFYGIQFGDIACKKWISSMFISFFTSVLLTQPIKVVLLAIFFALVCKKSSSFXXXXXXXXXXXXXXXLGRRNALMQNEEFLHNELYSAPIKPHRFHVQPPPKEELEKAREIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTSNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDTPA-PE-FSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFVVTKFIMWTGI 10901
             RV K  + LPWW  ++ W  +     ++  FT  YG+ +G ++  KW+ SM +SF  SV +TQP+KV+  A FFALV K+                         L ++        Y           QPPP   +EK +  RLKE + + + REI  Y+ F   LL V Y  RDPNAY     L   F +  +P   F G      F+ WA   LV NL     Y + P     GF+++ N++L+G A +RQVR +++SCAV    +     C+  Y++  +D   YG+GW A + N++   P+ + ++S+ +  G    G++ LY GGGYV    ++  +    +  L DN W+D  TRA+F+EFT YN N+NLF   T  +E+ G G  ++   ++   L   ++ G   F +  ++ Y +F+   +V + + + KQKW YF   WNL+EV I++ S+ A+  FV   I   +  +++ ++  D  ++F+  A  +  LGY+++F+V L+T+K   +LR N ++ M+ S L     D+  F  +  IM LA+      +F   L  Y T   A E  + + LG F + E+    PI G ++    ++F+ FV+LN+FI+++   F+  +   +L E + E+   ++ K + + GI
Sbjct: 1804 SRVSKSPRGLPWWCVLVGWLLVATTSGVAAFFTMLYGLHYGRVSSLKWLISMAVSFVESVFITQPLKVLGFAAFFALVLKREDDEETLPLFPGHLSSPGP----GVLFRSRRHSSERAY-----------QPPPMAAIEKMKTTRLKEQKAFALIREILAYLAFLWMLLLVAYGQRDPNAYHFHRHLERSFSQGFSPVLGFRG------FFEWANTTLVKNL-----YGHHP-----GFVTDGNSKLVGSAHIRQVRVRESSCAVAQQLQDSLDGCHGPYSLGIEDLVDYGEGWNASAYNNSNGFPQAWRYQSQSQRRGYPMWGKLTLYGGGGYVVPLGTDHQSASRILQYLFDNSWLDALTRAVFVEFTVYNANVNLFCTVTLTLETSGLGTFFSHVTLQSLRLYP-FTDGWHPFVVAAELTYFLFLFYYMVVQGKLMRKQKWGYFCSKWNLLEVAIILASWSALVVFVKRTILADRDLQRYREHR-DEGISFSETAAADAALGYIIAFLVLLSTVKLWHLLRLNPKMNMITSALRRAWGDISGFVAVILIMLLAYSFASNLVFGWKLRSYKTLFDAAETMVSLQLGIFNYEEVLDYSPILGSLLIGSCIVFMTFVVLNLFISVILVAFSEEQKSDQLWE-EGEIADLLLVKILSFLGI 2429          

HSP 2 Score: 203.371 bits (516), Expect = 2.824e-51
Identity = 142/440 (32.27%), Postives = 205/440 (46.59%), Query Frame = 3
Query: 7629 EYDLYTRSNRPPVPYTISAQINNTFRVRIFSTGCYFNSNNFQGGWGTAGCVVGPLTTTKVTQCICNHLTSFASGWIVAPNTIDFDYVFSNF-DFTKNLTLFVTEXXXXXXXXXXXXWARRMDIKDIEKVGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVA*G-----------------PTKTTESVLTVGPFALTSREIWIGFVTNIISFVPLFVIIEMFR--RSQLKHGHANKLRQAVENHLQISLESKEN-----KGYQGSTATLVRNEDVNSRPTTPSYRSTDQINI 8873
            E DL + S R           N T  +  F   C F  +  Q  W  +GC VGP TT   T C+CNHLT F S ++V PN ID       F  F  N  +  T   + ++++ + IWARR DI+D  KV V  L  ND    Y Y VT+ T  R  A TSS V   L G   E++P HL D    + +RG VD FLL+    LG LQ +RLWHDNS  G   SWY +   V D     K++FL NSW +V+  D  +D++  VA+  +   F  +F  K      + H+W S+      S FTRV+RV+                   P    E  + +G    T +E+ IG  ++I+ F    +I+++FR  R +L  G   + +Q   N    +  ++E       G Q   ++L +   V  +P    + S + ++I
Sbjct: 1260 EADLESSSGR-----------NLTVGITTFLAHCVF-WDETQETWDDSGCQVGPRTTPSQTHCLCNHLTFFGSSFLVMPNAIDVRQTAELFATFEDNPVVVTTVGCLCMLYVLVLIWARRKDIQDQAKVKVVVLEDNDPFAQYHYLVTVYTGHRRGAATSSKVTLTLYGSDGESEPHHLSDPDAAVFERGGVDVFLLSTLFPLGELQSLRLWHDNS--GDRPSWYVSRVLVYDSVVDRKWYFLCNSWLSVDVGDCVLDKVFPVATEQDRKQFSHLFFTKTSTGFQDGHIWYSVFCSATRSSFTRVQRVSCCFSMLLCTMLTSIMFWGVPKDPAEQKMDLGKIEFTWQEVMIGLESSILMFPINLLIVQIFRNTRPRLPMGKDGRQKQGPPNLTPSAQPTEEGLLTPETGIQSLISSLFKALKV--QPPASGWDSMNPVDI 1683          
BLAST of PKD1L-1 vs. Ensembl Mouse
Match: Pkd1l2 (polycystic kidney disease 1 like 2 [Source:MGI Symbol;Acc:MGI:2664668])

HSP 1 Score: 327.02 bits (837), Expect = 8.315e-89
Identity = 203/660 (30.76%), Postives = 335/660 (50.76%), Query Frame = 3
Query: 8931 KRVIKR-KLLPWWMRIIVWGFLTFLVIISVVFTTFYGIQFGDIACKKWISSMFISFFTSVLLTQPIKVVLLAIFFALVCKKSSSFXXXXXXXXXXXXXXXLGRRNALMQNEEFLHNELYSAPIKPHRFHVQPPPKEELEKAREIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTSNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDTPA-PE-FSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFVVTKFIMWTGI 10901
             RV K  + LPWW  ++ W  +     ++  FT  YG+ +G ++  KW+ SM +SF  SV +TQP+KV+  A FFALV K+                         L ++        Y           QPPP   +EK +  RLKE + + + REI  Y+ F   LL V Y  RDPNAY     L   F +  +P   F G      F+ WA   LV NL     Y + P     GF+++ N++L+G A +RQVR +++SCAV    +     C+  Y++  +D   YG+GW A + N++   P+ + ++S+ +  G    G++ LY GGGYV    ++  +    +  L DN W+D  TRA+F+EFT YN N+NLF   T  +E+ G G  ++   ++   L   ++ G   F +  ++ Y +F+   +V + + + KQKW YF   WNL+EV I++ S+ A+  FV   I   +  +++ ++  D  ++F+  A  +  LGY+++F+V L+T+K   +LR N ++ M+ S L     D+  F  +  IM LA+      +F   L  Y T   A E  + + LG F + E+    PI G ++    ++F+ FV+LN+FI+++   F+  +   +L E + E+   ++ K + + GI
Sbjct: 1805 SRVSKSPRGLPWWCVLVGWLLVATTSGVAAFFTMLYGLHYGRVSSLKWLISMAVSFVESVFITQPLKVLGFAAFFALVLKREDDEETLPLFPGHLSSPGP----GVLFRSRRHSSERAY-----------QPPPMAAIEKMKTTRLKEQKAFALIREILAYLAFLWMLLLVAYGQRDPNAYHFHRHLERSFSQGFSPVLGFRG------FFEWANTTLVKNL-----YGHHP-----GFVTDGNSKLVGSAHIRQVRVRESSCAVAQQLQDSLDGCHGPYSLGIEDLVDYGEGWNASAYNNSNGFPQAWRYQSQSQRRGYPMWGKLTLYGGGGYVVPLGTDHQSASRILQYLFDNSWLDALTRAVFVEFTVYNANVNLFCTVTLTLETSGLGTFFSHVTLQSLRLYP-FTDGWHPFVVAAELTYFLFLFYYMVVQGKLMRKQKWGYFCSKWNLLEVAIILASWSALVVFVKRTILADRDLQRYREHR-DEGISFSETAAADAALGYIIAFLVLLSTVKLWHLLRLNPKMNMITSALRRAWGDISGFVAVILIMLLAYSFASNLVFGWKLRSYKTLFDAAETMVSLQLGIFNYEEVLDYSPILGSLLIGSCIVFMTFVVLNLFISVILVAFSEEQKSDQLWE-EGEIADLLLVKILSFLGI 2430          

HSP 2 Score: 203.756 bits (517), Expect = 2.801e-51
Identity = 142/440 (32.27%), Postives = 205/440 (46.59%), Query Frame = 3
Query: 7629 EYDLYTRSNRPPVPYTISAQINNTFRVRIFSTGCYFNSNNFQGGWGTAGCVVGPLTTTKVTQCICNHLTSFASGWIVAPNTIDFDYVFSNF-DFTKNLTLFVTEXXXXXXXXXXXXWARRMDIKDIEKVGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVA*G-----------------PTKTTESVLTVGPFALTSREIWIGFVTNIISFVPLFVIIEMFR--RSQLKHGHANKLRQAVENHLQISLESKEN-----KGYQGSTATLVRNEDVNSRPTTPSYRSTDQINI 8873
            E DL + S R           N T  +  F   C F  +  Q  W  +GC VGP TT   T C+CNHLT F S ++V PN ID       F  F  N  +  T   + ++++ + IWARR DI+D  KV V  L  ND    Y Y VT+ T  R  A TSS V   L G   E++P HL D    + +RG VD FLL+    LG LQ +RLWHDNS  G   SWY +   V D     K++FL NSW +V+  D  +D++  VA+  +   F  +F  K      + H+W S+      S FTRV+RV+                   P    E  + +G    T +E+ IG  ++I+ F    +I+++FR  R +L  G   + +Q   N    +  ++E       G Q   ++L +   V  +P    + S + ++I
Sbjct: 1261 EADLESSSGR-----------NLTVGITTFLAHCVF-WDETQETWDDSGCQVGPRTTPSQTHCLCNHLTFFGSSFLVMPNAIDVRQTAELFATFEDNPVVVTTVGCLCMLYVLVLIWARRKDIQDQAKVKVVVLEDNDPFAQYHYLVTVYTGHRRGAATSSKVTLTLYGSDGESEPHHLSDPDAAVFERGGVDVFLLSTLFPLGELQSLRLWHDNS--GDRPSWYVSRVLVYDSVVDRKWYFLCNSWLSVDVGDCVLDKVFPVATEQDRKQFSHLFFTKTSTGFQDGHIWYSVFCSATRSSFTRVQRVSCCFSMLLCTMLTSIMFWGVPKDPAEQKMDLGKIEFTWQEVMIGLESSILMFPINLLIVQIFRNTRPRLPMGKDGRQKQGPPNLTPSAQPTEEGLLTPETGIQSLISSLFKALKV--QPPASGWDSMNPVDI 1684          
BLAST of PKD1L-1 vs. Ensembl Mouse
Match: Pkd2l1 (polycystic kidney disease 2-like 1 [Source:MGI Symbol;Acc:MGI:1352448])

HSP 1 Score: 229.95 bits (585), Expect = 8.683e-62
Identity = 156/505 (30.89%), Postives = 257/505 (50.89%), Query Frame = 3
Query: 9366 KELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKT-SNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFIS--NRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFV 10871
            +EL +    RE+  YIVF   +  +TY     +AY     ++ +F+ T S+    F  I+    FW +A   L+ +L    WYNN  Q   RG  S     N L+G   +RQ+R + +SC V +  +    NCY  Y+   +D+  +G        N T    +++ S+ EL G S+ GR+  YSGGGY      +       +  L++  W+D  TR +FI+F+ YN NINLF I   VVE P +GG    +++    L+  Y      F + C+V++ +FI   +V+EI  I   + +Y +  WN++++ +++ S +AV   ++  +  ++L  K  Q   D Y +F ++AF       M +  +F A +K  K + FN+ +  L S L   +KD+  F I+F I+F A+  + Y LF   +  + TF+       +I LG F +  +     I GP+ F  YV F+ FVLLNMF+AI+ D ++ VK ++  Q++  +L  F+
Sbjct:   93 RELYVKTTLRELVVYIVFLVDICLLTYGMTSSSAYYYTKVMSELFLHTPSDSGVSFQTISSMSDFWDFAQGPLLDSLYWTKWYNN--QSLGRGSHSFIYYENLLLGAPRLRQLRVRNDSCVVHEDFREDILNCYDVYSPDKEDQLPFGP------QNGTA---WTYHSQNELGGSSHWGRLTSYSGGGYYLDLPGSRQASAEALQGLQEGLWLDRGTRVVFIDFSVYNANINLFCILRLVVEFPATGGTIPSWQIRTVKLI-RYVNNWDFFIVGCEVVFCVFIFYYVVEEILEIHLHRLRYLSSVWNILDLVVILLSIVAVGFHIFRTLEVNRLMGKLLQQP-DTYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGFAIMFFIVFFAYAQLGYLLFGTQVENFSTFVKCIFTQFRIILGDFDYNAIDNANRILGPVYFVTYVFFVFFVLLNMFLAIINDTYSEVKEELAGQKDQLQLSDFL 584          
BLAST of PKD1L-1 vs. Ensembl Mouse
Match: Pkd2 (polycystin 2, transient receptor potential cation channel [Source:MGI Symbol;Acc:MGI:1099818])

HSP 1 Score: 220.705 bits (561), Expect = 9.882e-58
Identity = 153/509 (30.06%), Postives = 257/509 (50.49%), Query Frame = 3
Query: 9366 KELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKT---SNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYG-KGWTALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIF---CQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFV 10871
            +E  +  V RE+  Y+ F   L  +TY     N Y     L+ +FI T         F  ++  E FW +     +  L      +N  Q   R FI    N L+G   +RQ+R +  SC++    +   K CY  Y++ ++D   +G +  TA          + + SEKELNG S+ G I  YSG GY             ++  L+ N W+D  TRA FI+F+ YN NINLF +   + E P +GG+   ++ +P  L+      V AF+ F   C++++  FI+  +V+EI  I   +  YF  FWN ++V IV+ S +A+   +Y +++ ++   +F +   + + NF +VA+       + + +VFL  +K  K + FNR +  L + ++  +KD+  F I+F+I+FLA+  + Y +F   +  + TF        +I LG   F E+ +   + GP+ F  +V F+ F+LLNMF+AI+ D ++ VK+D+  Q+ + EL   +
Sbjct:  211 REKYLKSVLRELVTYLFFLVVLCILTYGMMSSNVYYYTRTLSQLFIDTPVSKTEKTNFKTLSSMEDFWKFTEGSFLDGLYWKAQTSNHTQADNRSFIFY-ENLLLGVPRLRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGPRNGTA----------WMYTSEKELNGSSHWGIIASYSGAGYYLDLSRTREETAAQLAGLRRNFWLDRGTRAAFIDFSVYNANINLFCVVRLLAEFPATGGVVPSWQFQPVKLIRY----VTAFDFFLAACEIIFCFFIIYYVVEEILEIRIHRLSYFRSFWNCLDVVIVVLSVVAMVINIY-RMSNAEGLLQFLE-DQNSFPNFEHVAYWQIQFNNISAVMVFLVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFTIMFSIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPLYFTTFVFFMFFILLNMFLAIINDSYSEVKSDLAQQKAEMELSDLI 702          
BLAST of PKD1L-1 vs. Ensembl Mouse
Match: Pkd2l2 (polycystic kidney disease 2-like 2 [Source:MGI Symbol;Acc:MGI:1858231])

HSP 1 Score: 209.149 bits (531), Expect = 5.639e-56
Identity = 153/512 (29.88%), Postives = 259/512 (50.59%), Query Frame = 3
Query: 9366 KELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTSNPNWQ---FTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISN--RNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYG----KGWTALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIEL-QENDHELVKFV 10871
            +E ++     E+  Y +F   L  +T+   +P+ Y L   ++++F+ TS P+ +   F  I    +FW +    L+  L    WY N  QLY     S     N L+G   +RQ+R + N+C V+   +S+  +CYS Y + N+D   +G      WT   ++ T    + F              +G+Y  GGY+     + S    +   L+ N+WI   TRA+FI+F+ YN N+NLF I   + E P +GG+ T ++     LL  Y      F   C+V++ IF+ V I++E+R + + K  YF   WN +E+ +++  F+AV+ + Y  + +  L  +  +   D Y +F ++A+ +     +++  +F A +K  K + FN  +  L S L+   KD+  F I+F I+F A+  + + +F   +  + TF  +  A  +I LG F F  + Q   I GPI F  ++ F+ FVLLNMF+AI+ D ++ VKAD  + +  D EL K +
Sbjct:   21 REAEVNTTLEELLLYFIFLINLCILTFGMVNPHMYYLNKVMSSLFVDTSLPDDERSSFRSIRSITEFWKFMEGPLIDGLYWDSWYGN-KQLYSVKNSSRIYYENVLLGIPRVRQLRVRNNTCKVYPAFQSLVSDCYSKYTVENEDFSDFGLKRNPEWTHTPSSRTAPWHWGF--------------VGVYRDGGYIVTLSKSKSETKAKFVDLRLNNWISRGTRAVFIDFSLYNANVNLFCIIRLLAEFPATGGLLTSWQFYSVKLLR-YVSYYDYFIASCEVIFCIFLFVFIIQELRKVNEFKSAYFRSVWNWLEMLLLLLCFLAVSFYAYCNMQSFLLLGQLLK-NTDSYPDFYFLAYWHIYYNNVIAITIFFAWIKIFKFISFNETMSQLSSTLSRCMKDIVGFAIMFFIIFSAYAQLGFLVFGSQVDDFSTFQNSIFAQFRIVLGDFNFAGIQQANWILGPIYFITFIFFVFFVLLNMFLAIINDTYSEVKADYSIGRRPDFELGKII 515          
BLAST of PKD1L-1 vs. UniProt/SwissProt
Match: sp|Q7TN88|PK1L2_MOUSE (Polycystic kidney disease protein 1-like 2 OS=Mus musculus OX=10090 GN=Pkd1l2 PE=2 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 1.085e-87
Identity = 202/660 (30.61%), Postives = 334/660 (50.61%), Query Frame = 3
Query: 8931 KRVIKR-KLLPWWMRIIVWGFLTFLVIISVVFTTFYGIQFGDIACKKWISSMFISFFTSVLLTQPIKVVLLAIFFALVCKKSSSFXXXXXXXXXXXXXXXLGRRNALMQNEEFLHNELYSAPIKPHRFHVQPPPKEELEKAREIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTSNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDTPA-PE-FSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFVVTKFIMWTGI 10901
             RV K  + LPWW  ++ W  +     ++  FT  YG+ +G ++  KW+ SM +SF  SV +TQP+KV+  A FFALV K+                         L ++        Y           QPPP   +EK +  RLKE + + + REI  Y+ F   LL V Y  RDPNAY     L   F +  +P   F G      F+ WA   LV NL     Y + P     GF+++ N++L+G A +RQVR +++SCAV    +     C+  Y++  +D   YG+GW A + N++   P+ + ++S+ +  G    G++ LY GGGYV    ++  +    +  L DN W+D  TRA+F+EFT YN N+NLF   T  +E+ G G  ++   ++   L   ++ G   F +  ++ Y +F+   +V + + + KQKW YF   WNL+EV I++ S+ A+  FV   I   +  +++ ++   +  +F+  A  +  LGY+++F+V L+T+K   +LR N ++ M+ S L     D+  F  +  IM LA+      +F   L  Y T   A E  + + LG F + E+    PI G ++    ++F+ FV+LN+FI+++   F+  +   +L E + E+   ++ K + + GI
Sbjct: 1805 SRVSKSPRGLPWWCVLVGWLLVATTSGVAAFFTMLYGLHYGRVSSLKWLISMAVSFVESVFITQPLKVLGFAAFFALVLKREDDEETLPLFPGHLSSPGP----GVLFRSRRHSSERAY-----------QPPPMAAIEKMKTTRLKEQKAFALIREILAYLAFLWMLLLVAYGQRDPNAYHFHRHLERSFSQGFSPVLGFRG------FFEWANTTLVKNL-----YGHHP-----GFVTDGNSKLVGSAHIRQVRVRESSCAVAQQLQDSLDGCHGPYSLGIEDLVDYGEGWNASAYNNSNGFPQAWRYQSQSQRRGYPMWGKLTLYGGGGYVVPLGTDHQSASRILQYLFDNSWLDALTRAVFVEFTVYNANVNLFCTVTLTLETSGLGTFFSHVTLQSLRLYP-FTDGWHPFVVAAELTYFLFLFYYMVVQGKLMRKQKWGYFCSKWNLLEVAIILASWSALVVFVKRTILADRDLQRYREHREGI--SFSETAAADAALGYIIAFLVLLSTVKLWHLLRLNPKMNMITSALRRAWGDISGFVAVILIMLLAYSFASNLVFGWKLRSYKTLFDAAETMVSLQLGIFNYEEVLDYSPILGSLLIGSCIVFMTFVVLNLFISVILVAFSEEQKSDQLSE-EGEIADLLLVKILSFLGI 2429          

HSP 2 Score: 203.756 bits (517), Expect = 1.847e-50
Identity = 142/440 (32.27%), Postives = 205/440 (46.59%), Query Frame = 3
Query: 7629 EYDLYTRSNRPPVPYTISAQINNTFRVRIFSTGCYFNSNNFQGGWGTAGCVVGPLTTTKVTQCICNHLTSFASGWIVAPNTIDFDYVFSNF-DFTKNLTLFVTEXXXXXXXXXXXXWARRMDIKDIEKVGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVA*G-----------------PTKTTESVLTVGPFALTSREIWIGFVTNIISFVPLFVIIEMFR--RSQLKHGHANKLRQAVENHLQISLESKEN-----KGYQGSTATLVRNEDVNSRPTTPSYRSTDQINI 8873
            E DL + S R           N T  +  F   C F  +  Q  W  +GC VGP TT   T C+CNHLT F S ++V PN ID       F  F  N  +  T   + ++++ + IWARR DI+D  KV V  L  ND    Y Y VT+ T  R  A TSS V   L G   E++P HL D    + +RG VD FLL+    LG LQ +RLWHDNS  G   SWY +   V D     K++FL NSW +V+  D  +D++  VA+  +   F  +F  K      + H+W S+      S FTRV+RV+                   P    E  + +G    T +E+ IG  ++I+ F    +I+++FR  R +L  G   + +Q   N    +  ++E       G Q   ++L +   V  +P    + S + ++I
Sbjct: 1261 EADLESSSGR-----------NLTVGITTFLAHCVF-WDETQETWDDSGCQVGPRTTPSQTHCLCNHLTFFGSSFLVMPNAIDVRQTAELFATFEDNPVVVTTVGCLCMLYVLVLIWARRKDIQDQAKVKVVVLEDNDPFAQYHYLVTVYTGHRRGAATSSKVTLTLYGSDGESEPHHLSDPDAAVFERGGVDVFLLSTLFPLGELQSLRLWHDNS--GDRPSWYVSRVLVYDSVVDRKWYFLCNSWLSVDVGDCVLDKVFPVATEQDRKQFSHLFFTKTSTGFQDGHIWYSVFCSATRSSFTRVQRVSCCFSMLLCTMLTSIMFWGVPKDPAEQKMDLGKIEFTWQEVMIGLESSILMFPINLLIVQIFRNTRPRLPMGKDGRQKQGPPNLTPSAQPTEEGLLTPETGIQSLISSLFKALKV--QPPASGWDSMNPVDI 1684          
BLAST of PKD1L-1 vs. UniProt/SwissProt
Match: sp|Q7Z442|PK1L2_HUMAN (Polycystic kidney disease protein 1-like 2 OS=Homo sapiens OX=9606 GN=PKD1L2 PE=1 SV=5)

HSP 1 Score: 313.153 bits (801), Expect = 1.101e-83
Identity = 192/653 (29.40%), Postives = 334/653 (51.15%), Query Frame = 3
Query: 8955 LPWWMRIIVWGFLTFLVIISVVFTTFYGIQFGDIACKKWISSMFISFFTSVLLTQPIKVVLLAIFFALVCKKSSSFXXXXXXXXXXXXXXXLGRRNALMQNEEFLHNELYSAPIKPHRFHVQPPPKEELEKAREIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTSNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFVVTKFIMWTGISETK 10913
            LPWW  ++ W  +     ++  FT  YG+ +G  +  +W+ SM +SF  S+ +TQP+KV+  A FFALV K+     +T                  L+  + +    L+ A     R   QPP    +EK +   LKE + + + REI  Y+ F   LL V Y  RDP+AY L   L + F +       F+G+    +F+ WA   LV NL     Y + P     GFI++ N++L+G A +RQVR +++SC +    ++    C + Y++  +D   YG+GW     N T   E+ ++S+ +  G    G++ +Y GGGYV    ++  +    +  L DN W+D  TRA+F+E T YN N+NLF I T  +E+   G  +T   ++   L   ++ G   F +  +++Y +F+L  +V + + + K+ W YF   WNL+E+ I++ S+ A+A FV   +   +  ++   +  +  ++F+  A  +  LGY+++F+V L+T+K   +LR N ++ M+ + L     D+  F I+   M LA+ +    +F   L  Y T   A E  + + LG F + E+    P+ G  +    ++F+ FV+LN+FI+++   F+  +   +L E + E+V  ++ K + + GI   +
Sbjct: 1817 LPWWCILVGWLLVAATSGVAAFFTMLYGLHYGRASSLRWLISMAVSFVESMFVTQPLKVLGFAAFFALVLKRVDDEEDTVAPLP-----------GHLLGPDPY---ALFRARRNSSRDVYQPPLTAAIEKMKTTHLKEQKAFALIREILAYLGFLWMLLLVAYGQRDPSAYHLNRHLQHSFTRG------FSGVLGFREFFKWANTTLVSNL-----YGHPP-----GFITDGNSKLVGSAQIRQVRVQESSCPLAQQPQAYLNGCRAPYSLDAEDMADYGEGW-----NATTLSEWQYQSQDQRQGYPIWGKLTVYRGGGYVVPLGTDRQSTSRILRYLFDNTWLDALTRAVFVESTVYNANVNLFCIVTLTLETSALGTFFTHAALQSLRLYP-FTDGWHPFVVAAELIYFLFLLYYMVVQGKRMSKETWGYFCSKWNLLELAIILASWSALAVFVKRAVLAERDLQRCRNHR-EEGISFSETAAADAALGYIIAFLVLLSTVKLWHLLRLNPKMNMITAALRRAWGDISGFMIVILTMLLAYSIASNLIFGWKLRSYKTLFDAAETMVSLQLGIFNYEEVLDYSPVLGSFLIGSCIVFMTFVVLNLFISVILVAFSEEQKYYQLSE-EGEIVDLLLMKILSFLGIKSKR 2431          

HSP 2 Score: 190.66 bits (483), Expect = 1.560e-46
Identity = 122/353 (34.56%), Postives = 176/353 (49.86%), Query Frame = 3
Query: 7698 TFRVRIFSTGCYFNSNNFQGGWGTAGCVVGPLTTTKVTQCICNHLTSFASGWIVAPNTIDFDYVFSNF-DFTKNLTLFVTEXXXXXXXXXXXXWARRMDIKDIEKVGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVA*G-----------------PTKTTESVLTVGPFALTSREIWIGFVTNIISFVPLFVIIEMFRRSQLK 8702
            T  +  F + C F  +  Q  W  +GC VGP T+   T C+CNHLT F S ++V  N I+       F  F  N  +  T   + +V++ + IWARR D +D  KV VT L  ND    Y Y VT+ T  R  A TSS V   L G   E +P HL D   P+ +RG VD FLL+    LG L+ +RLWHDNS  G   SWY +   V DL    K++FL NSW ++   D  +D++  VA+  +   F  +F  K      + H+W SI +R   S FTRV+RV+                   P    E  + +G    T +E+ IG  ++I+ F    +I+++F+ ++ +
Sbjct: 1272 TVGITTFLSHCVF-WDEVQETWDDSGCQVGPRTSPYQTHCLCNHLTFFGSTFLVMSNAINIHQTAELFATFEDNPVVVTTVGCLCVVYVLVVIWARRKDAQDQAKVKVTVLEDNDPFAQYHYLVTVYTGHRRGAATSSKVTVTLYGLDGEREPHHLADPDTPVFERGAVDAFLLSTLFPLGELRSLRLWHDNS--GDRPSWYVSRVLVYDLVMDRKWYFLCNSWLSINVGDCVLDKVFPVATEQDRKQFSHLFFMKTSAGFQDGHIWYSIFSRCARSSFTRVQRVSCCFSLLLCTMLTSIMFWGVPKDPAEQKMDLGKIEFTWQEVMIGLESSILMFPINLLIVQIFQNTRPR 1621          
BLAST of PKD1L-1 vs. UniProt/SwissProt
Match: sp|Q6IVV8|PKD2_DANRE (Polycystin-2 OS=Danio rerio OX=7955 GN=pkd2 PE=1 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 3.971e-65
Identity = 161/540 (29.81%), Postives = 263/540 (48.70%), Query Frame = 3
Query: 9321 PPPKEE-------LEKAR---EIRL-------KELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKT---SNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYG-KGWTALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEK--FAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFV 10871
            PP +E        LEK R   + RL       +E+ +  V RE+  YI+F  TL  +TY     N Y     ++ +F+ T   S     F  ++  E FW +     +  +   +WYNN      +  I    N L+G   +RQ+R +  SC+V +  +    +CY+ Y+  N+D+  +G K  TA          + FK E  L   SY G++  Y GGGY             ++  LK+N W+D  TRA+F++F+ YN N+NLF I   +VE P +GG    ++ +   LL  Y      F   C+V + +F+L  +V+E   I   + +YF   WN ++V IV    ++V   +     TS ++ +  F       Y NF  +A    +   + + IVFL+ +K  K + FN+ +  L + ++  +KD+  F I+F I+FLA+  + Y +F   +  + TF        +I LG F F E+ + + + GPI F  +V FI  +LLNMF+AI+ D ++ VKAD+  Q ++ E+   +
Sbjct:  117 PPAQEHRSCGKRILEKMRVLWDTRLLGESNSNREMYLKTVLREMITYILFLLTLCIITYGMVSTNMYYYTKVMSQLFLDTPLSSGEPTNFKSLSTMEDFWKFTEGPFLNGMYWELWYNNKSLPENQSLIY-YENLLLGVPRLRQLRVRNESCSVHEDLRDEVYDCYNVYSPANEDKAPFGPKNGTA----------WRFKDESSLGESSYWGQVSTYGGGGYYQDLSRTREKSANQLQELKNNLWLDRGTRAVFLDFSIYNGNVNLFCIVRLLVEFPATGGAVPSWQFQTVRLL-RYVSSWDYFVGMCEVSFCLFVLYYLVEEALEIRLHRLRYFKSLWNCLDVLIVA---LSVPAIIMNICRTSAVSHRLHFLLENHSTYPNFEPLARLQVHFNNLAAIIVFLSWVKLFKFINFNKTMNQLSTTMSRCAKDLMGFAIMFFIVFLAYAQLAYLVFGTQVNDFSTFQACIFTQFRIILGDFDFSEIEEADSVLGPIYFTTFVFFIFMILLNMFLAIINDTYSEVKADMAQQRSEMEITDLI 641          
BLAST of PKD1L-1 vs. UniProt/SwissProt
Match: sp|H2LRU7|PKD2_ORYLA (Polycystin-2 OS=Oryzias latipes OX=8090 GN=pkd2 PE=1 SV=2)

HSP 1 Score: 242.662 bits (618), Expect = 2.846e-64
Identity = 147/506 (29.05%), Postives = 249/506 (49.21%), Query Frame = 3
Query: 9366 KELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIK----TSNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFV 10871
            +E  +++V RE+  YI F  T+  +TY     N Y     ++ +F+     + NP   F  ++  E FW +     +  +   VWYNN      + FI    N L+G   +RQVR    +C++ +  +   + CY  Y   N+D   +G        N T    +   +E ++N  ++ G++  Y GGGY             ++  LKD+ W+D  TRAIF++F+ YN N+NL  I   +VE P +GG+ T ++ +   L+  Y      F   C+V + +F+L  +V+E+  I   +  YF   WN ++V IV  S +A+   +        L +    Y    + +F  +A        M + IVF   +K  K + FN+ +  L + ++  +KD+  F I+F I+FLA+  + Y +F   +  + TF  +     +I LG F F E+ +  P+ GPI F  +VLFI F+L+NMF+AI+ D ++ VKAD+    ++ E+  F+
Sbjct:  155 RERYLWNVLRELLTYIAFLITICILTYGMISTNMYYYTKAMSQLFLDAPLSSENPK-TFRSLSTMEDFWKYTQGPFLGGMYWEVWYNNQSLPGNQSFIY-YENILLGVPRLRQVRVHNETCSIHEDLRDEVQGCYGVYTPSNEDNSPFG------PQNGTA---WVHTTESKMNASTHWGQVSKYGGGGYYQDLSRTREESGLQLQFLKDHLWLDRGTRAIFLDFSVYNGNVNLVCIARLLVEFPATGGVLTSWQFQTLRLIK-YVSSWDYFVGVCEVAFCLFVLYYVVEEVLEIHIHRLHYFKNLWNCLDVLIVTLSVVAIIMSITRAAMGGDLLKGLENYTS--HTSFDSLANLQVQFNNMAAVIVFFCWVKLFKFINFNKTMSQLSTTMSRCAKDLVGFAIMFFIIFLAYAQLAYLVFGTQVNDFSTFQGSVFTQFRIILGDFDFFEIKEANPVLGPIYFITFVLFIFFILMNMFLAIINDTYSEVKADMAQHRSEMEMTDFI 646          
BLAST of PKD1L-1 vs. UniProt/SwissProt
Match: sp|A2A259|PK2L1_MOUSE (Polycystic kidney disease 2-like 1 protein OS=Mus musculus OX=10090 GN=Pkd2l1 PE=1 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 6.074e-61
Identity = 156/505 (30.89%), Postives = 257/505 (50.89%), Query Frame = 3
Query: 9366 KELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKT-SNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFIS--NRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFV 10871
            +EL +    RE+  YIVF   +  +TY     +AY     ++ +F+ T S+    F  I+    FW +A   L+ +L    WYNN  Q   RG  S     N L+G   +RQ+R + +SC V +  +    NCY  Y+   +D+  +G        N T    +++ S+ EL G S+ GR+  YSGGGY      +       +  L++  W+D  TR +FI+F+ YN NINLF I   VVE P +GG    +++    L+  Y      F + C+V++ +FI   +V+EI  I   + +Y +  WN++++ +++ S +AV   ++  +  ++L  K  Q   D Y +F ++AF       M +  +F A +K  K + FN+ +  L S L   +KD+  F I+F I+F A+  + Y LF   +  + TF+       +I LG F +  +     I GP+ F  YV F+ FVLLNMF+AI+ D ++ VK ++  Q++  +L  F+
Sbjct:   93 RELYVKTTLRELVVYIVFLVDICLLTYGMTSSSAYYYTKVMSELFLHTPSDSGVSFQTISSMSDFWDFAQGPLLDSLYWTKWYNN--QSLGRGSHSFIYYENLLLGAPRLRQLRVRNDSCVVHEDFREDILNCYDVYSPDKEDQLPFGP------QNGTA---WTYHSQNELGGSSHWGRLTSYSGGGYYLDLPGSRQASAEALQGLQEGLWLDRGTRVVFIDFSVYNANINLFCILRLVVEFPATGGTIPSWQIRTVKLI-RYVNNWDFFIVGCEVVFCVFIFYYVVEEILEIHLHRLRYLSSVWNILDLVVILLSIVAVGFHIFRTLEVNRLMGKLLQQP-DTYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGFAIMFFIVFFAYAQLGYLLFGTQVENFSTFVKCIFTQFRIILGDFDYNAIDNANRILGPVYFVTYVFFVFFVLLNMFLAIINDTYSEVKEELAGQKDQLQLSDFL 584          
BLAST of PKD1L-1 vs. TrEMBL
Match: A0A0H3YJQ5 (PKD1L-1 OS=Schmidtea mediterranea OX=79327 GN=PKD1L-1 PE=2 SV=1)

HSP 1 Score: 5323.83 bits (13809), Expect = 0.000e+0
Identity = 2662/2662 (100.00%), Postives = 2662/2662 (100.00%), Query Frame = 3
Query:  567 MGTIFKLILSILLIHFSRAEWCIKITLDKVVGIGTYNKDQVSLDRTLCTDECYYSGFPFTVVWKNTYCFCANDISAGINVTDFSTCATVDGFYVSASLASSLTVIFQMAMATTKFIASGNLVSMSPNIYYYAPPGPPPSFKYSYHDKAGIWEYSLDSNAIQRVFSISGIYQIRSQVLKPNNQAKISEVSTEIMAYQSVTNLNITCQPIAIVYIAVNCTVSISNGSFITGQIMADGLIIETLTLPDIPWERVGAVPNFFNNDFITGQSVSGIYLINGQYQYNGIITSIEFNAFKTGNIDLLLLKPSCGTYYCIATGSCAATPSCSRTLACGNEYCPLSQSCSAICNNRLLNKENSSSLPSVSYIINQVQLYPISNTGYQIVTLSVPWPVQAGYRLGFHFGNGITDLIAVTSLRSGETPNFFYNSQTVTSGTLIPSTSFTPKYISHQFSAVSVQQRNTKFKLMFNTTGIKNVTVNLQXXXXXXXXXXXXXXXGLNINDTSFANLGYATTNVSYMFIMNPHTGDQLLYYWDFGDNTTLNSTTRFVNHTFTVAGVYNSSVYVYNTLVSKVQNYLIYVKDAVKINFFNSSGVYNPNVFASFILSMKSGTGFNCTLSGDGIANQTQPSNNLLFGWQWATEGSFNVRIDCYNELTRDYKTLVQVIQANITGLTFVNFGGAAFEQMQLRFSWLTGSNITFLLLVNNISYSLTQNETALTGISQNITISAPGVLIGVIRATNLISDIILVANLTFSQKISNMNLIADKYYTTNGSAFNFYVNMSTGSGVRSVIQYGDGQNNTNINYESPSVYWPGISVPYTYSNVGTYNVTVNCTNIVNSQTSSVVVYVLTGLGTYEIVYNNLFFKKNDLIQLSLNRTSGYPASMTNITINWQNGDITSIPFAAFNESAIYNYVYSANGVYNVTLTLQNPLSTVVKSILLSIIDPIINFRCVNVPANTWNGNQIQLQTLVDQGQNVIYTLNPGDGGALITKNINISXXXXXXXXXXXXXXVGNYTSNIWACNQLGCQNCSNYVQIQYKIQSFDFQVQTNGNIEYLKTNLITTISFTGTNFPTALMATFTLSDGSPPSTVYLSLSMMPYNFVKNLSVVGFGNILVKLENLANSVNISATYGSFEKFSNFNVSLTWGPTRALGFGANFNTFPLNNPVYFRPSAQAKGTVVGYTFLYAPIKNLSAIFQCNATLVNGEFSYTFSTMGDFNVSFKVYNPIDQAFIENTLTIGSSIQNTQISTRPLTLMPNYFGYISIQWSVISTESCICVDFANNTKLIYGAMSGCSNCSGYLFANRKPSNNLLEILVRFSTEGDYNIKVFIYNDYESAFANRTIPVTYAQCAPPVVSMTYTQFQNPMTPQKDIRSSQIIVSAVVLDLPCILTKNNMKLWSATLMDPIYLTPIKAVDMSIIPTSNNTQLIIPPRFLNYGLYKLTFSVTMDKNVTIYTFQSSNFTYLFIDKSPIIVGLSSGGISLIVNGIDQNICFTPLQYSQDPDLNVQDFSKWIWTWTCQKTTESENLTNYVYPKPIGYSFTTPKTGCFGDGPGVVNFTSSPCFWGGNLEINGTYQLGLVGMSSDNRTGSAKIIITVVKGIPPDITVQCLRPLMCKINNVGAFAFNEVVFNPSDALLLSATCYGNGTICGQGLWNLILLNETTQIWTPLDSSIANLYIKGVYSMQISLLPSFFSFYNTIKRFQICYNSINLTPNGKSCIQFYIFPLPSGIICTLDKTTVQQTDTVCVNCTFQPNYQYRMYVNVTNECSTLGFNSTGQFCSIIPYQTVNQTYIVRVTNENGGFIDVIAGIIMVTQLQLVDLTKILTNVINGTDQTLTVAIAKGDFKEMSQVYLKYVSVLTASNQITIRNLFQPLTNNSKENLGGTGYMTTSVNSSTMTIESLPKDIRAKYEIDRDQKSTVINSMTAGLYTMVPGDIQSLHLISSVVNAIGESSDCVNRQSQWQLSTKLASLADNFKELQKTAPRDDVLTIATNLLSANYRSDAAANIQIDNGILRDIKFSKDTYLDYDTNLESGGKNYLNVDDPSAAAYSLTLETNSNFQSKIAFGVGSNSLYTIQTISKVLRDITVLNDVPTDLLTSQMQYYSIKTQINDLSNKAFTKGRSTIILPDICAALNSPPGSCSDPNNPIGLEIIATPNNVRAYAQNPNKNGLPIPMNSDFVSLSLFLGRQISEKPVQPNGNNNFTIFISRDPVFAVPDFNFTEPDPQIQPPKSIPGTGTIFTGPQCFEQKLVVYQFKLIGSDQSVHFQIKSNFSTKCTQYLIVGRLGQPPVLGANPDGSVDSVNFTFWGMIPTHTKYCNLIPSSDMPDPFTFFVDNSMFKQSKISTKSSMPDYSKTLDTLYFGVRELTPAEYDLYTRSNRPPVPYTISAQINNTFRVRIFSTGCYFNSNNFQGGWGTAGCVVGPLTTTKVTQCICNHLTSFASGWIVAPNTIDFDYVFSNFDFTKNLTLFVTEXXXXXXXXXXXXWARRMDIKDIEKVGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVA 8552
            MGTIFKLILSILLIHFSRAEWCIKITLDKVVGIGTYNKDQVSLDRTLCTDECYYSGFPFTVVWKNTYCFCANDISAGINVTDFSTCATVDGFYVSASLASSLTVIFQMAMATTKFIASGNLVSMSPNIYYYAPPGPPPSFKYSYHDKAGIWEYSLDSNAIQRVFSISGIYQIRSQVLKPNNQAKISEVSTEIMAYQSVTNLNITCQPIAIVYIAVNCTVSISNGSFITGQIMADGLIIETLTLPDIPWERVGAVPNFFNNDFITGQSVSGIYLINGQYQYNGIITSIEFNAFKTGNIDLLLLKPSCGTYYCIATGSCAATPSCSRTLACGNEYCPLSQSCSAICNNRLLNKENSSSLPSVSYIINQVQLYPISNTGYQIVTLSVPWPVQAGYRLGFHFGNGITDLIAVTSLRSGETPNFFYNSQTVTSGTLIPSTSFTPKYISHQFSAVSVQQRNTKFKLMFNTTGIKNVTVNLQSVDNVVASASSSVIVGLNINDTSFANLGYATTNVSYMFIMNPHTGDQLLYYWDFGDNTTLNSTTRFVNHTFTVAGVYNSSVYVYNTLVSKVQNYLIYVKDAVKINFFNSSGVYNPNVFASFILSMKSGTGFNCTLSGDGIANQTQPSNNLLFGWQWATEGSFNVRIDCYNELTRDYKTLVQVIQANITGLTFVNFGGAAFEQMQLRFSWLTGSNITFLLLVNNISYSLTQNETALTGISQNITISAPGVLIGVIRATNLISDIILVANLTFSQKISNMNLIADKYYTTNGSAFNFYVNMSTGSGVRSVIQYGDGQNNTNINYESPSVYWPGISVPYTYSNVGTYNVTVNCTNIVNSQTSSVVVYVLTGLGTYEIVYNNLFFKKNDLIQLSLNRTSGYPASMTNITINWQNGDITSIPFAAFNESAIYNYVYSANGVYNVTLTLQNPLSTVVKSILLSIIDPIINFRCVNVPANTWNGNQIQLQTLVDQGQNVIYTLNPGDGGALITKNINISTLNTQYNFNYTYNTVGNYTSNIWACNQLGCQNCSNYVQIQYKIQSFDFQVQTNGNIEYLKTNLITTISFTGTNFPTALMATFTLSDGSPPSTVYLSLSMMPYNFVKNLSVVGFGNILVKLENLANSVNISATYGSFEKFSNFNVSLTWGPTRALGFGANFNTFPLNNPVYFRPSAQAKGTVVGYTFLYAPIKNLSAIFQCNATLVNGEFSYTFSTMGDFNVSFKVYNPIDQAFIENTLTIGSSIQNTQISTRPLTLMPNYFGYISIQWSVISTESCICVDFANNTKLIYGAMSGCSNCSGYLFANRKPSNNLLEILVRFSTEGDYNIKVFIYNDYESAFANRTIPVTYAQCAPPVVSMTYTQFQNPMTPQKDIRSSQIIVSAVVLDLPCILTKNNMKLWSATLMDPIYLTPIKAVDMSIIPTSNNTQLIIPPRFLNYGLYKLTFSVTMDKNVTIYTFQSSNFTYLFIDKSPIIVGLSSGGISLIVNGIDQNICFTPLQYSQDPDLNVQDFSKWIWTWTCQKTTESENLTNYVYPKPIGYSFTTPKTGCFGDGPGVVNFTSSPCFWGGNLEINGTYQLGLVGMSSDNRTGSAKIIITVVKGIPPDITVQCLRPLMCKINNVGAFAFNEVVFNPSDALLLSATCYGNGTICGQGLWNLILLNETTQIWTPLDSSIANLYIKGVYSMQISLLPSFFSFYNTIKRFQICYNSINLTPNGKSCIQFYIFPLPSGIICTLDKTTVQQTDTVCVNCTFQPNYQYRMYVNVTNECSTLGFNSTGQFCSIIPYQTVNQTYIVRVTNENGGFIDVIAGIIMVTQLQLVDLTKILTNVINGTDQTLTVAIAKGDFKEMSQVYLKYVSVLTASNQITIRNLFQPLTNNSKENLGGTGYMTTSVNSSTMTIESLPKDIRAKYEIDRDQKSTVINSMTAGLYTMVPGDIQSLHLISSVVNAIGESSDCVNRQSQWQLSTKLASLADNFKELQKTAPRDDVLTIATNLLSANYRSDAAANIQIDNGILRDIKFSKDTYLDYDTNLESGGKNYLNVDDPSAAAYSLTLETNSNFQSKIAFGVGSNSLYTIQTISKVLRDITVLNDVPTDLLTSQMQYYSIKTQINDLSNKAFTKGRSTIILPDICAALNSPPGSCSDPNNPIGLEIIATPNNVRAYAQNPNKNGLPIPMNSDFVSLSLFLGRQISEKPVQPNGNNNFTIFISRDPVFAVPDFNFTEPDPQIQPPKSIPGTGTIFTGPQCFEQKLVVYQFKLIGSDQSVHFQIKSNFSTKCTQYLIVGRLGQPPVLGANPDGSVDSVNFTFWGMIPTHTKYCNLIPSSDMPDPFTFFVDNSMFKQSKISTKSSMPDYSKTLDTLYFGVRELTPAEYDLYTRSNRPPVPYTISAQINNTFRVRIFSTGCYFNSNNFQGGWGTAGCVVGPLTTTKVTQCICNHLTSFASGWIVAPNTIDFDYVFSNFDFTKNLTLFVTEIVVALVFIAIFIWARRMDIKDIEKVGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVA
Sbjct:    1 MGTIFKLILSILLIHFSRAEWCIKITLDKVVGIGTYNKDQVSLDRTLCTDECYYSGFPFTVVWKNTYCFCANDISAGINVTDFSTCATVDGFYVSASLASSLTVIFQMAMATTKFIASGNLVSMSPNIYYYAPPGPPPSFKYSYHDKAGIWEYSLDSNAIQRVFSISGIYQIRSQVLKPNNQAKISEVSTEIMAYQSVTNLNITCQPIAIVYIAVNCTVSISNGSFITGQIMADGLIIETLTLPDIPWERVGAVPNFFNNDFITGQSVSGIYLINGQYQYNGIITSIEFNAFKTGNIDLLLLKPSCGTYYCIATGSCAATPSCSRTLACGNEYCPLSQSCSAICNNRLLNKENSSSLPSVSYIINQVQLYPISNTGYQIVTLSVPWPVQAGYRLGFHFGNGITDLIAVTSLRSGETPNFFYNSQTVTSGTLIPSTSFTPKYISHQFSAVSVQQRNTKFKLMFNTTGIKNVTVNLQSVDNVVASASSSVIVGLNINDTSFANLGYATTNVSYMFIMNPHTGDQLLYYWDFGDNTTLNSTTRFVNHTFTVAGVYNSSVYVYNTLVSKVQNYLIYVKDAVKINFFNSSGVYNPNVFASFILSMKSGTGFNCTLSGDGIANQTQPSNNLLFGWQWATEGSFNVRIDCYNELTRDYKTLVQVIQANITGLTFVNFGGAAFEQMQLRFSWLTGSNITFLLLVNNISYSLTQNETALTGISQNITISAPGVLIGVIRATNLISDIILVANLTFSQKISNMNLIADKYYTTNGSAFNFYVNMSTGSGVRSVIQYGDGQNNTNINYESPSVYWPGISVPYTYSNVGTYNVTVNCTNIVNSQTSSVVVYVLTGLGTYEIVYNNLFFKKNDLIQLSLNRTSGYPASMTNITINWQNGDITSIPFAAFNESAIYNYVYSANGVYNVTLTLQNPLSTVVKSILLSIIDPIINFRCVNVPANTWNGNQIQLQTLVDQGQNVIYTLNPGDGGALITKNINISTLNTQYNFNYTYNTVGNYTSNIWACNQLGCQNCSNYVQIQYKIQSFDFQVQTNGNIEYLKTNLITTISFTGTNFPTALMATFTLSDGSPPSTVYLSLSMMPYNFVKNLSVVGFGNILVKLENLANSVNISATYGSFEKFSNFNVSLTWGPTRALGFGANFNTFPLNNPVYFRPSAQAKGTVVGYTFLYAPIKNLSAIFQCNATLVNGEFSYTFSTMGDFNVSFKVYNPIDQAFIENTLTIGSSIQNTQISTRPLTLMPNYFGYISIQWSVISTESCICVDFANNTKLIYGAMSGCSNCSGYLFANRKPSNNLLEILVRFSTEGDYNIKVFIYNDYESAFANRTIPVTYAQCAPPVVSMTYTQFQNPMTPQKDIRSSQIIVSAVVLDLPCILTKNNMKLWSATLMDPIYLTPIKAVDMSIIPTSNNTQLIIPPRFLNYGLYKLTFSVTMDKNVTIYTFQSSNFTYLFIDKSPIIVGLSSGGISLIVNGIDQNICFTPLQYSQDPDLNVQDFSKWIWTWTCQKTTESENLTNYVYPKPIGYSFTTPKTGCFGDGPGVVNFTSSPCFWGGNLEINGTYQLGLVGMSSDNRTGSAKIIITVVKGIPPDITVQCLRPLMCKINNVGAFAFNEVVFNPSDALLLSATCYGNGTICGQGLWNLILLNETTQIWTPLDSSIANLYIKGVYSMQISLLPSFFSFYNTIKRFQICYNSINLTPNGKSCIQFYIFPLPSGIICTLDKTTVQQTDTVCVNCTFQPNYQYRMYVNVTNECSTLGFNSTGQFCSIIPYQTVNQTYIVRVTNENGGFIDVIAGIIMVTQLQLVDLTKILTNVINGTDQTLTVAIAKGDFKEMSQVYLKYVSVLTASNQITIRNLFQPLTNNSKENLGGTGYMTTSVNSSTMTIESLPKDIRAKYEIDRDQKSTVINSMTAGLYTMVPGDIQSLHLISSVVNAIGESSDCVNRQSQWQLSTKLASLADNFKELQKTAPRDDVLTIATNLLSANYRSDAAANIQIDNGILRDIKFSKDTYLDYDTNLESGGKNYLNVDDPSAAAYSLTLETNSNFQSKIAFGVGSNSLYTIQTISKVLRDITVLNDVPTDLLTSQMQYYSIKTQINDLSNKAFTKGRSTIILPDICAALNSPPGSCSDPNNPIGLEIIATPNNVRAYAQNPNKNGLPIPMNSDFVSLSLFLGRQISEKPVQPNGNNNFTIFISRDPVFAVPDFNFTEPDPQIQPPKSIPGTGTIFTGPQCFEQKLVVYQFKLIGSDQSVHFQIKSNFSTKCTQYLIVGRLGQPPVLGANPDGSVDSVNFTFWGMIPTHTKYCNLIPSSDMPDPFTFFVDNSMFKQSKISTKSSMPDYSKTLDTLYFGVRELTPAEYDLYTRSNRPPVPYTISAQINNTFRVRIFSTGCYFNSNNFQGGWGTAGCVVGPLTTTKVTQCICNHLTSFASGWIVAPNTIDFDYVFSNFDFTKNLTLFVTEIVVALVFIAIFIWARRMDIKDIEKVGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVA 2662          
BLAST of PKD1L-1 vs. TrEMBL
Match: A0A0H3YJK5 (PKD1L-3 OS=Schmidtea mediterranea OX=79327 GN=PKD1L-3 PE=2 SV=1)

HSP 1 Score: 3358.16 bits (8706), Expect = 0.000e+0
Identity = 1629/2603 (62.58%), Postives = 2033/2603 (78.10%), Query Frame = 3
Query: 3192 MTNITINWQNGDITSIPFAAFNESAIYNYVYSANGVYNVTLTLQNPLSTVVKSILLSIIDPIINFRCVNVPANTWNGNQIQLQTLVDQGQNVIYTLNPGDGGALITKNINISXXXXXXXXXXXXXXVGNYTSNIWACNQLGCQNCSNYVQIQYKIQSFDFQVQTNGNIEYLKTNLITTISFTGTNFPTALMATFTLSDGSPPSTVYLSLSMMPYNFVKNLSVVGFGNILVKLENLANSVNISATYGSFEKFSNFNVSLTWGPTRALGFGANFNTFPLNNPVYFRPSAQAKGTVVGYTFLYAPIKNLSAIFQCNATLVNGEFSYTFSTMGDFNVSFKVYNPIDQAFIENTLTIGSSIQNTQISTRPLTLMPNYFGYISIQWSVISTESCICVDFANNTKLIYGAMSGCSNCSGYLFANRKPSNNLLEILVRFSTEGDYNIKVFIYNDYESAFANRTIPVTYAQCAPPVVSMTYTQFQNPMTPQKDIRSSQIIVSAVVLDLPCILTKNNMKLWSATLMDPIYLTPIKAVDMSIIPTSNNTQLIIPPRFLNYGLYKLTFSVTMDKNVTIYTFQSSNFTYLFIDKSPIIVGLSSGGISLIVNGIDQNICFTPLQYSQDPDLNVQDFSKWIWTWTCQKTTESENLTNYVYPKPIGYSFTTPKTGCFGDGPGVVNFTSSPCFWGGNLEINGTYQLGLVGMSSDNRTGSAKIIITVVKGIPPDITVQCLRPLMCKINNVGAFAFNEVVFNPSDALLLSATCYGNGTICGQGLWNLILLNETTQIWTPLDSSIANLYIKGVYSMQISLLPSFFSFYNTIKRFQICYNSINLTPNGKSCIQFYIFPLPSGIICTLDKTTVQQTDTVCVNCTFQPNYQYRMYVNVTNECSTLGFNSTGQFCSIIPYQTVNQTYIVRVTNENGGFIDVIAGIIMVTQLQLVDLTKILTNVINGTDQTLTVAIAKGDFKEMSQVYLKYVSVLTASNQITIRNLFQPLT-NNSKENLGGTGYMTTSVNSSTMTIESLPKDIRAKYEIDRDQKSTVINSMTAGLYTMVPGDIQSLHLISSVVNAIGESSDCVNRQSQWQLSTKLASLADNFKELQKTAPRDDVLTIATNLLSANYRSDAAANIQIDNGILRDIKFSKDTYLDYDTNLESGGKNYLNVDDPSAAAYSLTLETNSNFQSKIAFGVGSNSLYTIQTISKVLRDITVLNDVPTDLLTSQMQYYSIKTQINDLSNKAFTKGRSTIILPDICAALNSPPGSCSDPNNPIGLEIIATPNNVRAYAQNPNKNGLPIPMNSDFVSLSLFLGRQISEKPVQPNGNNNFTIFISRDPVFAVPDFNFTEPDPQIQPPKSIPGTGTIFTGPQCFEQKLVVYQFKLIGSDQSVHFQIKSNFSTKCTQYLIVGRLGQPPVLGANPDGSVDSVNFTFWGMIPTHTKYCNLIPSSDMPDPFTFFVDNSMFKQSKISTKSSMPDYSKTLDTLYFGVRELTPAEYDLYTRSNRPPVPYTISAQINNTFRVRIFSTGCYFNSNNFQGGWGTAGCVVGPLTTTKVTQCICNHLTSFASGWIVAPNTIDFDYVFSNFDFTKNLTLFVTEXXXXXXXXXXXXWARRMDIKDIEKVGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVA-------------------*GPTKTTESVLTVGPFALTSREIWIGFVTNIISFVPLFVIIEMFRRSQLKHGHANKLRQAVENHLQISLESKENKGYQGSTATLVRNEDVN-SRPTTPSYRSTDQINIQIPEYEVENQDSDANEKYKKRVIKRKLLPWWMRIIVWGFLTFLVIISVVFTTFYGIQFGDIACKKWISSMFISFFTSVLLTQPIKVVLLAIFFALVCKKSSSFXXXXXXXXXXXXXXXLGRRNALMQNEEFLHNELYSAPIKPHRFHVQPPPKEELEKAREIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTSNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFVVTKFIMWTGISETKFGKKFIKT 10937
            MTN+TINWQN +I +IP+ +FNESA+Y   YS NG YNVT  LQNPLST V S+L++I++PI+NFRC  VPANTWNGN + L+T  D G NV+ TLNPGDG A     INI+++N +Y+FNYTYNTVGNY+SNIWACNQLGCQNCSNYVQIQYKI   DFQ  T+GNIEY+ TNL TT++F+GTNFPTAL A F  SDGSPP ++ L+  MMPY  +KNLS  GFG   V L+NLANS N +A+Y +F K+ N +V++ WGP + +GFG+  N FPLNN +Y RP++Q  GT+V  T  Y   K+ S +  CN+T +NGE ++T S+MG+ N+S  +YNPID       + IGSSIQNT+I+T P TL+P Y+G+I + WS+IS  +CICVD A+  K IYGA SGC  C  Y + N  P NN + I VR+  +GDY I V IYN +ES  A+R I VT   CAPP + MTY  +QN  +PQ +IRS+QII+S +V D+PC +T  N KLW+A L+DP YLT +K +D+S IPT+NN+QLIIPPRFL+YGLYK T +VTMDK++T++TFQSSNFT+L I KSP++VGLSSGG+++I   I ++ICFTPL YSQDPDLNVQDF  W W WTCQ+  E  N +N VYPKP  Y ++ PKTGCFGDGPG+VNFT+SPCF G NL+I+  Y   L   + DNRTGS+ I + VV G  P+IT+QC RPLMC IN  G +AFNEV+FNPSD+L+LSATC     IC +G W++  LN+    W   + +I N Y+KG  S+Q+SL+P FF+ Y+ + R QICYNS  L  NG  CIQF I+PLP G+ C L+   + Q   +CVNCTF  +YQYRM++N T    TLG+  TG  CSI+PYQ   Q Y+VRVTN NGGF DV+AG + VTQ+   DL   + N+++G D++L +AIAK +F++M+Q+Y+KY+SVL+ SNQ T++NLF     +N +  LGG+GY++ +V    + I++LP D R  YE DRDQKS+VIN MT+GL + VPG+I+SL+L SSV+++ G+SSDC+NR SQ Q+S  L ++A  F+ LQ TA ++D+L I  NLL AN+ SD AAN+QI++GILRDI+ SKD Y+DYDTN+ S GK+YL V DP+ A  SL LETN+NFQSK+A G+GSN+  +I  I +++R + V+ D P    T+ + Y + K   + L NK F  GRS + LPDIC +LN  PG+CS+PNNPI +E+I TPNN+R+Y  NPN +GLPIP  SD+++++L+ G   S+    PN + NFTIF++RDP F +PDFN +E DPQI PPK+IPGTGT+F+GP  FEQKLVVY F L G+DQS+HFQ+KSNFS  CTQYL+VGRL QPP+LG NPDG+ DS+NFTFWGMIP+ TKYCN+ P ++ PDPFTFFV N++FKQSK S   SMPDYSKTL+T+YFGVRELTP E++ YT +NRPPVPYTISAQIN+TFRVRIFS+GCYF S++ +  WGT GCVVGPLTT + TQCICNHLTSF+SGW+VAPN IDF+Y+FSNFDFTKN+TLF TEI +A+VFI + +WARR DIKDIEKVG+TPL SND  DMYLYEV +DTSIR NAGT+SNVYFILSGE +ETDP HLVD+KR ILKRGNVDRFLLAVPRSLG +Q+IRLWHDNSGKG NASWYCN  G+ DLQTKEKF+FLVN WFAVEE+DGQIDR+I VA ++ELL+F+E+FSRKMK NLSEDHLWLSI+ARPPESRFTRVERVA                    GP+K   ++LT+GPFAL+++E+W GF++NII+FVPLFV+IE+FRRS LKHG+AN LR+AVENHLQISL S + KGY  STA L+ NED+N SRP +   RS   INIQ+ E + E  D D  EK +  V+++KL PWWMRI  W FL  L+I++ V TTFYGIQFGD+ACKKWISSMFISFFTSVLL QPIKV+ LAIFFAL+CK SS+F + EYI EE+E+M+ELGRRNA+MQNEE+LH ELY+APIKPH+   +PP +EE+EKARE+RLKELQMYDV RE+ FY+ FFCTLLF++YS R P+AY L+NEL N+FIK + P+  FT IT E  FW W L V VP +RAPVWYNNDP ++QRGFISNRNNRLIGYA++RQVR+KK+SC V DY K + K+CYS Y+IFNQDE SYG GWT L+ +DT    F + +E  L+G+ YIGR+  YSGGGYVY+ + +V+ L+ +++AL+DN WIDFQTRAIFIEFTT+NPNINLFAI+T+V E PG+GG+WTIYR+EPANLLGLYSGGVKAFEIFCQVLYGIFILVI VKEIRN +KQKWKYF+QFWN IE+FI+ GS ++ AGF YV IAT++LT KF+QYGG VYLNFA VAF NE   Y+VS I+F AT+KFI++LRFN+RIGMLG+VL+YT+ DMKQFFIIF IMFLAFVM+FYSLFMDSLYRYH+FLFA E+SM I LGKF FLELYQK PIFGPIVFAG+VLFI+FVLLNMF+AILY+GF VVK DI+LQ +DHEL++F+ TKF+MWTGI++TK GKKFIKT
Sbjct:    1 MTNLTINWQNANIVNIPYTSFNESAVYYNQYSTNGAYNVTFLLQNPLSTFVASVLITIMNPIVNFRCSYVPANTWNGNMMSLKTFADSGDNVVLTLNPGDGSASTVNTINITSINQEYDFNYTYNTVGNYSSNIWACNQLGCQNCSNYVQIQYKIIKTDFQYITSGNIEYINTNLTTTLTFSGTNFPTALTAIFNFSDGSPPLSLLLTSGMMPYTLMKNLSKPGFGVSTVILQNLANSENFTASYEAFVKYINVSVTVLWGPKKLIGFGSFLNIFPLNNYLYLRPNSQMIGTIVNGTVTYYDSKSSSTVLLCNSTFINGELNFTISSMGNVNLSLTLYNPIDTITSSLPIIIGSSIQNTEITTSPSTLLPGYYGFIIVTWSIISATNCICVDVADGRKFIYGATSGCEKCINYNYTNIAPVNNQISISVRYLIQGDYKINVSIYNSFESGNASRIISVTTNPCAPPTLLMTYPTYQNSFSPQTEIRSNQIIISGIVSDIPCTMTTTNYKLWTAVLIDPNYLTTMKEIDLSSIPTANNSQLIIPPRFLSYGLYKFTLTVTMDKSITVFTFQSSNFTFLQIVKSPLVVGLSSGGLTIISRSIQEDICFTPLIYSQDPDLNVQDFLNWNWVWTCQEKNEIMNTSNIVYPKPRNYQYSFPKTGCFGDGPGIVNFTTSPCFAGNNLDIDKMYMFNLTARAPDNRTGSSLINVRVVNGTSPNITIQCSRPLMCNINKNGQYAFNEVLFNPSDSLILSATCVCLNVICEKGFWSI--LNQVASSWETFNQTIVNSYVKGFNSLQMSLIPDFFTAYSNLTRIQICYNSDGLPTNGFGCIQFAIYPLPKGVTCQLNTNIIPQAANLCVNCTFNSDYQYRMFINNTGSILTLGYTGTGYLCSIVPYQPFAQAYMVRVTNSNGGFTDVLAGNVTVTQMTSQDLNSTINNLLSGADKSLQLAIAKSNFQDMAQIYMKYISVLSVSNQNTLQNLFGTSNLSNIQPYLGGSGYLSQNVGPGVLVIDNLPADKRLLYEKDRDQKSSVINLMTSGLSSFVPGNIKSLYLASSVLSSFGDSSDCINRISQMQISNNLRNMAGYFQNLQGTATKEDILEIGKNLLQANFLSDTAANVQINDGILRDIQQSKDNYMDYDTNMYSKGKSYLAVSDPNQAGNSLVLETNANFQSKVASGIGSNAGQSINIIKRIMRSVMVVGDEPISFQTNNLHYVASKQVGSALKNKTFLAGRSVVQLPDICQSLNISPGNCSNPNNPISVEMIGTPNNIRSYLSNPNVDGLPIPSKSDYLTVNLYTGTNSSDISASPNDSQNFTIFVTRDPSFQIPDFNMSESDPQISPPKTIPGTGTLFSGPASFEQKLVVYTFTLSGTDQSIHFQMKSNFSINCTQYLVVGRLAQPPILGPNPDGTSDSINFTFWGMIPSDTKYCNMSPQNNEPDPFTFFVSNNLFKQSKFSALQSMPDYSKTLNTIYFGVRELTPPEWNSYTSNNRPPVPYTISAQINHTFRVRIFSSGCYFLSDDNKNSWGTNGCVVGPLTTPQKTQCICNHLTSFSSGWLVAPNAIDFNYIFSNFDFTKNVTLFATEIAIAVVFILLLVWARRQDIKDIEKVGLTPLASNDPKDMYLYEVIVDTSIRNNAGTTSNVYFILSGELNETDPTHLVDSKRKILKRGNVDRFLLAVPRSLGAMQFIRLWHDNSGKGTNASWYCNCLGIIDLQTKEKFNFLVNKWFAVEEDDGQIDRIIPVAGINELLYFQEMFSRKMKANLSEDHLWLSIIARPPESRFTRVERVACCLLLLFLTMLTTCMFYQTEGPSKPVSNILTIGPFALSAKELWTGFISNIIAFVPLFVLIELFRRSSLKHGYANLLREAVENHLQISLNSDKVKGYHSSTANLIWNEDLNISRPVS---RSMGHINIQLNENDTEIDDMDVQEK-ETPVVRQKLFPWWMRIFAWTFLITLLIVASVLTTFYGIQFGDLACKKWISSMFISFFTSVLLVQPIKVICLAIFFALLCKDSSAF-DVEYIGEEDEIMDELGRRNAIMQNEEYLHQELYTAPIKPHKICFRPPSQEEIEKARELRLKELQMYDVIREVGFYLAFFCTLLFISYSLRHPDAYDLQNELKNVFIKQA-PDSSFTDITSETLFWNWILRVFVPRIRAPVWYNNDPPIFQRGFISNRNNRLIGYAIIRQVRSKKDSCKVNDYVKHLIKHCYSQYDIFNQDEKSYGFGWTELNTSDTSESPFLYSNESSLDGLPYIGRLSTYSGGGYVYKLKDDVNTLYNDLSALRDNKWIDFQTRAIFIEFTTFNPNINLFAIHTYVAEMPGNGGLWTIYRIEPANLLGLYSGGVKAFEIFCQVLYGIFILVIFVKEIRNFLKQKWKYFSQFWNFIELFIIFGSLLSAAGFAYVTIATNKLTGKFSQYGGSVYLNFAQVAFWNEYFSYLVSLIIFCATIKFIRVLRFNKRIGMLGAVLSYTATDMKQFFIIFFIMFLAFVMMFYSLFMDSLYRYHSFLFAIESSMNIPLGKFGFLELYQKAPIFGPIVFAGFVLFIVFVLLNMFVAILYNGFTVVKEDIDLQSSDHELMRFIFTKFVMWTGINDTKLGKKFIKT 2595          
BLAST of PKD1L-1 vs. TrEMBL
Match: A0A267FSJ8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023848g1 PE=4 SV=1)

HSP 1 Score: 1860.5 bits (4818), Expect = 0.000e+0
Identity = 1226/3563 (34.41%), Postives = 1887/3563 (52.96%), Query Frame = 3
Query:  654 VVGIGTYNKDQVSLDRTLCTDECYYSGFPFTVVWKNTYCFCANDISAGINVT------DFSTCATVDGFYVSASLASSLTVIFQMAMATTKFIASGNLVSMSPNIYYYAPPGPPPSFKYSYHDKAGIWEY-SLDSNAIQRVFSISGIYQIRSQVLKPNNQAKISEVSTEIMAYQSVTNLNITCQPIAIVYIAVNCTVSISNGSFITGQIMADGLIIETLTLPDIPWERVGAVPNFFNNDFITGQSVSGIYLINGQYQYNGIITSIEFNAFKTGN-IDLLLLKPSC--GTYYCIATGSCAATPSCSRTLACGNE---YCPLSQSCSA---ICNNRLLNKENSSSLPSVSYIINQVQLYPISNTGYQIVTLSVPWPVQAGYRLGFHFGNGITDLIAVTSLRSGETPNFFYNSQTVTSGTLI---PSTSFTPKYISHQFSAVSVQQRNTKFKLMFNTTGIKNVTVNLQXXXXXXXXXXXXXXXGLN--INDTSFANLGYATTNVSYMFIMNPHTGDQLLYYWDFGDNTTLNSTTRFVNHTFTVAGVYNSSVYVYNTLVSKVQNYLIY-VKDAVKINFFNSSGVYNPNVFASFILSMKSGTGFNCTLSGDGIANQTQ-PSNNLLFGWQWATEGS-FNVRIDCYNELTRDYKTLVQVIQANITGLTFVNFGGAAFEQMQLRFSWLTGSNITFLLLVNNISYSLTQNETALTGISQNITISAPGVLIGVIRATNLISDIILVANLTFSQKISNMNLIADKYYTTNGSAFNFYVNMSTGSGVRSVIQYGDGQ--NNTNINYESPSVYWPG--ISVPYTYSNVGTYNVTVNCTNIVNSQTSSVVVYVLTGLGTYEIV---YNNLFFKKNDLIQLSLNRTSGYPASMTNITINWQNGDITSIPFAAFNE--SAIYNYVYSANGVYNVTLTLQNPLSTVVK-SILLSIIDPIINFRCVNVPANTWNGNQIQLQTLVDQGQNVIYTLNPGDGGALITKNINISXXXXXXXXXXXXXXVGNYTSNIWACNQLGCQNCSNYVQIQYKIQSFDFQVQTNGNIEYLKTNLITTISFTGTNFPTALMATFTLSDG-------------------SPPSTVYLSLSMMPYNFVKNLSVVGFGNILVKLENLANSVNISATYGSFEKFSNFNVSLTW-GPTRAL---GFGANFNTFPLNNPVYFRPSAQAKGTVVGYTFLYAPIKNLS----AIFQCNATLVNGEFSYTFSTMGDFNVSFKVYNPIDQAFIENTLTIGSSIQNTQISTRPLTLMPNYFGYISIQWSVISTESCICVDFANNTKL-IYGAMSGCSNC-----SGYLFANRKPSNNLLEILVRFSTEGDYNIKVFIYNDYESAFANRTIPVTYAQCAPPVVSMTYTQFQNPMTPQKDIRSSQIIVSAVVLDLPCILTKNNMKLWSATLMDPIYLTPIKAVDMSIIPTSNNTQLIIPPRFLNYGLYKLTFSVTMDKNVTIYTFQSSNFTYLFIDKSPIIVGLSSGGISLIVNGIDQNICFTPLQYSQDPDL-----NVQDFSKWIWTWTCQKTTESE----NLTNYVYPKPIGYSFTTPKTGCFGDGPGVVNFTSSP---CFWGGNLEINGTYQLGLVGMSSDNRTGSAKIIITVVKGIPPDITVQCLRPLMCKINNVGAFAFNEVVFNPSDALLLSATCYG--NGTICGQGLWNLILLNETTQIWTPLDSSIANLYIKGVYSMQISLLPSFFSFYNTIKRFQICYN-SINLTPNGKSCIQFYIFPLPSGIICTLDKTT-VQQTDTVCVNCTFQP--------NYQYRMYV--NVTNECSTL-GFNSTGQFCSIIPYQTVNQTYIVRVTNENGGFIDVIAGIIMVTQLQLVDLTKILTNVINGTDQTLTVAIAKGDFKEMSQVYLKYVSVLTASNQITIRNLFQPLTNNSKENLGGTGYMTTSVNSSTM--TIESLPKDIRAKYEIDRDQKSTVINSMTAGLYTMVPGDIQSLHLISSVVNAIGESSDCVNRQSQWQLSTKLASLADNFKELQKTAPRDDVLTIATNLLSANYRSDAAANIQIDNGILRDIKFSKDT-YLDYDTNLESGGKNYLNVDDPSAAAYSLTLETNSNFQSKIAFGVGSNSLYTIQTISKVLRDITVLNDVPTDLLTSQMQYYSIKTQINDLSNKAFTKGRSTIILP-DICAALNSPPGSCSDPNNPIGLEIIATPNNVRAYAQNPNKNG-LPIPMNSDFVSLSLFLGRQISEKPVQPNGNNNFTIFISRDPVFAVPDF---NFTEPDPQIQPPKSIPGTGT-IFTGPQCFEQKLVVYQFKLIGSDQSVHFQIK-SNFS---TKCTQYLIVGRLGQPPVLGANPDGSVDSVNFTFWGMIPTHTKYCNLIPSSDMPDPFTFFVDNSMFKQSKISTKSSMPDYSKTLDTLYFGVRELTPAEYDLYTRSNRPPVPYTISAQINNTFRVRIFSTGCYFNSNNFQGGWGTAGCVVGPLTTTKVTQCICNHLTSFASGWIVAPNTIDFDYVFSNFDFTKNLTLFVTEXXXXXXXXXXXXWARRMDIKDIEKVGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVA*-------------------GPTKTTES-VLTVGPFALTSREIWIGFVTNIISFVPLFVIIEMFRRSQLKHGHANKLRQAVENHLQISLESKENKGYQGSTATLVRNEDVNSRPTTPSYRSTDQINIQIPEYEVENQDSDANEKYKKRVIKRKLLPWWMRIIVWGFLTFLVIISVVFTTFYGIQFGDIACKKWISSMFISFFTSVLLTQPIKVVLLAIFFALVCKKSSSFXXXXXXXXXXXXXXXLGRRNALMQNEEFLHNELYSAPIKPHRFHVQPPPKEELEKAREIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTSNPNWQFT------GITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDTPA-PE---FSFKSEKELNGMS-YIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFVVTKFIMWTGISETKFGKKF 10928
            +V  G Y+ D ++ +   C   C  S + +T +W+  +CFCA +IS+  + T      D  +C   +   V    ++ L    Q+       +     V+++ +   +A        + SY D A  WE        + + + + G++  R+      N + I   S +++  +     NITC  + +V   + CT+S+ +G+ +   I       E   L D  WER G  P   NN  +   +   + L++  ++Y GI+ + EF     G+ ++L++ +P C  G  +C    +C+    C+ T+ C +     CP ++SC A    C      +  +  + S   +I      P+S  GY +  +   + V  G R+GF+   G T  IA  S  S E P++     +  +   I    + ++    + HQ SA+S   +    +  + +TG   ++V L S      S + S  V L   INDTSF  +    +N      + PHTG  + Y W F D  T  +T  F ++  +  G  + +V  Y+TL ++ Q YL + +   V I      G +  N  A  I S+ SG+ + CT++    + +TQ P   L F     +  + + ++  CYN L+   +T+   ++  +TG              QL  S   G++  F   +   + ++  N  AL  +++  ++   G+   V R  N +SDI++  N+T   +ISN +           S   F + MS G+GV+  +Q+GDG   N T  + E     W G  +S  +TY+  G++ VT   +N++ + T ++ V VL  LG Y ++    +NL    N+ +Q S    SG P S   +T +W +G     P   F+   +  YN+ Y+A G Y ++    NP+ T+   S  ++I+D I+N R    P     G    ++  +D G +V  TL PGDGG+     I  S  NTQ     TYNT G +  N+  CN   C   ++ +++  K+QS    + TNGN +     +I T +++GT       +   L D                    SP    Y+S S   YN   N ++                   S   GSF   SN +++L +  P R +   GFGA+  TFP    +   PS    GT   +TF  + I  L     A FQ N T+    + Y  ST G++ VS   +NPI  A     +T+G S+ N ++        P     +S+ W V+S ++C+ VD    T+L +YG  +  + C       Y  ++   SNN ++  V +   G Y +KVF  N + +     T+ V+ ++C PP V+M          P+K +RS+ + V  ++ +LPC  T  N + W    +D    +    VD+S +PT  NT L +PPRFL  GLY++T  V M+  VT+  F + +  YL +  SP+IV L+ GG+  +   + + IC  P   S DPD+     N Q    W++   C +  E+E    + +    P+   ++     TGCFG  PG V    S    CF G NL  N TY   + G  +   + S   IIT     P  I ++C  P  C   +     +N V  NP+D + L+++C    N ++C    W++  L+ +   W  +D+     +++G    ++SL P  FS   T +RF++C    +     G++C   +   +P+   CT + T+ V       ++C+  P        +YQ+ + V  NVT   STL GF+    +    PY   +    V  T+  G         + +++         L  +I G+   L   + KG+ KE SQ+     +++ + +    RN    LT +      G+GY   S+N  T+   ++SL +  +  YE  RD+++ V+  ++    TM   + + + L+S+ +  +   +D ++R +Q     KL  +AD    L  +  ++ +  ++  +L+   +   A+N+ + +G L D + S  T + DYDT+ ES    + N    S A+ +   ETN   Q++++  V S+ + +I  ++K +    V+ND P ++ +SQ+     K++   LS      GRS + LP ++C+    P G C+   + + L  +ATP N   Y      NG   +   S+ V+L+L      +E  V   G++ F IF+ +DP F  P++   N  +P P+I     IPGT    F   +  EQKL++++F+L GSDQSVHFQ++  NF+   T C Q+L+VGRL +PP L    +G      F +WGMIP+HT++CN  P  + PDPFTFFV N+ +K++K   K S  D+ +++D L FGVRE++ AE++ Y    RP +PY  + Q +  + VRIFS  CY      Q  W T GC VGPLTT +VT C C HLTSFA GW+ +PNTID++YVFSNFDFTKN TLFVTEIV+A++FIA+F+WARR D KD+EK+GV PLP N+ +  YLYE+ + T +R  AGT SNV+FILSGE+DETD RHL+D  R +L+RG VDRFLLAV R LG L ++RLWHDNSG+G  ASWYCNY  + DLQT+ ++HF+VN W AVEE+DG +DR++ VA   EL  F  +FS   K  L++ HLWLS+MARPPESRFTRVERVA                    GP+K   S  LT+GPF LT R I++G VTN+ISF+PLFV++E+FRRS+L+ G+ N+L++A+ +H   +   KE++  QG  A    +      P      S  Q++++                 +K++ K+   PWW+RII W  L     +S +FTTFYGIQFGD  CKKWISS+FISFF+SV+L+QP+KV+++  F AL+CKK+S  +  E++++EEE++NELG+RN L  +EE+LH +         R  +QPP  E LE+ARE RLKE +M+D+ REI+FY++F+  LLFVT++FRDPNAY LK ++  + +    P+   T      GI+ EE+FW W     +P +RA  WYNNDP L QRGF  +R  RL+GYA+MRQ R + ++C+V    + +  +C  +Y+   +++  +   W A   N T + P+   F F S   L  M  Y+ R   Y+ GGYV+QFR ++S +   +N LK   W+D QTRA+FI+   YNPN+NLF I T V E  G+GGM  IYR + ANLL     G+K+FEI CQVL+ + +L +I+KE+RNI KQ+  YF   WNL E+FI+ GS +++A + YV   TS+LTE+F++YGG+VYLNF YVAF NE L Y  +FIVF++TLKFI++LRFN+R+GM+G V+   +KD++QFFI+F IMF AFV  F+ +F+  LY Y TFL+  E  MQIALGKF FLELY+ EPI GP++FA Y +F+IF+LLNMF++IL + FA VK D+E QEN+HE+V F+V K +M+ G+ +++  + +
Sbjct:   42 LVSPGDYDPDLLATEVITCAASCKASSYRYTGIWQARFCFCAQNISSVASATFNRTEADAGSCTDAEHIAVYDIDSTDLADDLQILPPAQGTVVDAGSVNLTVDTSVFA--ATEYLVRMSYGDDASRWERIDYPQQQVNKSYIVPGVWNARANAYY-QNSSLIGSSSLQLLVVEQTVIANITCPVVLLVTSPIQCTLSLISGTRVRASIDWGDGTQENFLLADSTWERAG-TPVGQNNVDLASPTSDNVVLVDADFKYVGILQAFEFLGISGGSTVNLMIFRPMCPLGEQFCFGQYACSTDNLCASTVDCSSPVETLCPTTESCWASEGTCLKTRTKQNTTRGIASSYQVIAVYASVPVS-AGYNLYRVPDEFTVFPGDRIGFY---GTT--IAARSASSAEGPDYHLQRPSAPAINDIFNAANANWNSTGVHHQVSALSKSLQTYTLERKYISTGNTTISVRLSSNPFGGPSVNLSRAVLLQEGINDTSFEPVLDVLSNEPCNLRLKPHTGLNVKYNWTFSDGGTDFTTVPFSSYAISGLGPASVNVTAYSTLDTR-QGYLSFRLISRVNILHLIVDGQHFGNDSAVSI-SLNSGSDYLCTINAS--SGETQGPIAALSFRVSAQSSPALYFLKATCYNSLSSSSRTVPLYVEIPVTGFVVETNAAEVGVPFQLEMSIFNGTHPKFQASIAGENKTVVYNSAALRALAEASSLPTAGMFAVVCRTYNNVSDIVIALNVTAQHRISNASFRVQSSAIGVNSYGLFELTMSAGTGVQISVQFGDGNSYNYTTTDLEE----WGGRNLSFNHTYTIGGSFTVTATLSNLIGNTTLTLSVSVLAPLGQYALIGPATSNL----NNPVQFSFQVLSGSPPSSAKVTFSWGDGS----PLETFDMLLTWTYNHTYAALGNYIISFNASNPIPTLAANSTSITIVDLIVNPRATFTPPVLAKGESASVKITIDGGSDVTCTLVPGDGGSPDVSVIPTSGQNTQRILTSTYNTNGTFIMNLTVCNAAMCFVFTHNLKVVNKLQSSTLGLTTNGN-QTFGDPIIFTFTYSGTAADAPYGSVIELRDANGTAVSSTELDLPTTQVSVSPAQHGYVSYSFFVYNNGSNFTIQ------------------SPVIGSFLPISNLSLTLMYRSPGRDILNSGFGADRLTFPNKQELVALPSF--FGTSEKHTFSISQIPALGEQSVATFQPNETI----YLYLNST-GNYLVSLFTWNPISNATFSTNITVGGSMINGRVVDVQGVSRPGQTRSLSVVWDVLSEDTCVYVDLGIATELHLYGPAACLAICRPPDNKDYNHSSSLVSNNRIDFSVVYKKRGTYIVKVFTCNQFANDSFTATVAVSPSKCLPPHVTMADEPHMRVENPRKVLRSASVTVECIITELPCEATPQNRREWLIESLDETTRSVTGIVDVSSLPTFGNTILALPPRFLELGLYRVTARVVMNTTVTVEEFANYSSIYLLVGSSPLIVSLTPGGMIEVKRSVGRTICLEPKLNSFDPDVGSIDPNAQGIGSWVYH--CWQKGEAEPDDSSRSPVQIPRNSSFNAINHTTGCFGSPPGFVQTGGSGGAFCFDGANLWANRTYIFKVQGFKAKRSSRSVLRIITT-DLFPAIIDLRCRFPAECHRMSGSDLGYNMV--NPTDTVQLTSSCQSSENASVCDSTAWSVEFLDSSNN-WVVVDAQTMQAFVQGSSFREVSLSPDLFSNI-TSRRFRVCLKVGLGTVNEGEACSLLFTNLVPTTGACTCNSTSGVAAVTPFEISCS--PFTDSDGIDSYQFILKVGANVTTNASTLIGFSDRPLYQGPFPYVASSVEVCVIATDSYGATTTACIATVSLSEPSGSYSASELQKIIRGSSSILKT-VHKGNLKETSQLVQGLAAMIVSLS----RNSISSLTGSESVTTAGSGYDEISLNGITLEKKLKSLSQKEKDAYERSRDERAQVLAMLSETFATMTCANYEQIRLVSNTIQVVSTDADDLSRTTQINCKNKLVEVADAVVGLSGSLSKERLTELSMPVLATLSQIITASNVHVSHGTLTDKRSSMATPFGDYDTDWESSRDGFAN-KPLSQASSAFVDETNGVVQTQVSTEVTSSCMSSITKLTKSMTSKLVMNDKPMNIKSSQLSLVLQKSEPASLSGSLVRTGRSRVTLPTNMCSVTGGPEGRCTGARSSVSLTAMATPTN--PYVSAATNNGDCSVSTTSEVVTLNLS-DENGTEISVTDTGSSFFDIFLRKDPTFEEPNYIDPNPMQPIPRIPEGIEIPGTADGPFGKNRIAEQKLILHEFQLTGSDQSVHFQLRFENFTLGVTPCRQFLVVGRLWKPPSLTDASEG------FDWWGMIPSHTRFCNETPGPNDPDPFTFFVTNAEYKEAKARVKKSASDWDRSIDKLKFGVREMSQAEWNRYGPLTRPSIPYEYTNQFSIKYTVRIFSASCYAIKPG-QPSWNTGGCTVGPLTTVRVTHCQCTHLTSFAGGWVESPNTIDWNYVFSNFDFTKNPTLFVTEIVIAVIFIAVFVWARRSDKKDLEKLGVAPLPDNNPDHKYLYEIVVSTGMRRGAGTDSNVFFILSGERDETDTRHLMDRSRKVLQRGCVDRFLLAVERPLGSLNFLRLWHDNSGEGSAASWYCNYVSIIDLQTRRRYHFVVNRWMAVEEDDGAVDRVVPVAGNQELGDFSYLFSMDTKKRLTDGHLWLSVMARPPESRFTRVERVACCLMLLFLSMVTTCMFYQREGPSKPAASDGLTIGPFLLTPRMIYVGVVTNLISFLPLFVVMELFRRSKLRVGYINQLKKAINDHFDGADWGKESQ--QGDRAEYAESPAAAVNPPA----SVRQVDVE-----------------EKKLPKQVRFPWWVRIISWSILVIGTAVSALFTTFYGIQFGDETCKKWISSLFISFFSSVMLSQPLKVLMMTAFMALLCKKNS-VDEEEFLDDEEEVLNELGQRNGLQMDEEWLHEDDLEGQRGQCRSGIQPPSGELLERARERRLKEKKMFDILREISFYMLFYFLLLFVTFAFRDPNAYVLKEQMERLLL----PDLGMTSGEGIPGISTEEEFWNWMQTKFMPGIRAGPWYNNDPPLLQRGFTGDRVARLVGYAIMRQKRVRMDTCSVLPSVRYLVGHCVESYSFSAEEKSDFSPKWQAYDPNKTSSKPQYEAFKFTSGSALKNMGPYMARQYTYASGGYVFQFRGSLSAMQANINELKTLQWLDRQTRAVFIDLAFYNPNVNLFGIGTIVFELSGTGGMVGIYRFQAANLLSFLGSGLKSFEIACQVLFCLMLLGMIIKELRNIYKQRKAYFWSIWNLAELFILFGSVLSIAAYAYVIYETSKLTEEFSKYGGNVYLNFQYVAFWNEYLTYFTAFIVFVSTLKFIRLLRFNKRMGMMGDVVRIAAKDIRQFFIMFFIMFCAFVQTFHLIFLQRLYGYSTFLYTMEQLMQIALGKFKFLELYESEPILGPLIFAMYAIFVIFILLNMFVSILNEAFAKVKDDVEKQENEHEMVDFMVQKAMMFVGLGQSRAARAY 3499          
BLAST of PKD1L-1 vs. TrEMBL
Match: A0A1I8J0W5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 1510.74 bits (3910), Expect = 0.000e+0
Identity = 1042/3243 (32.13%), Postives = 1667/3243 (51.40%), Query Frame = 3
Query:  666 GTYNKDQVSLDRTLCTDECYYSGFPFTVVWKNTYCFCANDI--SAGINVTDFSTCATVDGFYVS---ASLASSLTVIFQMAMATTKFIASGNLVSMSPNIYYYAPPGPPPSFKYSYHDKAGIWEYSLDSN-AIQRVFSISGIYQIRSQVLKPNNQAKISEVSTEIMAYQSVTNLNITCQPIAIVYIAVNCTVSISNGSFITGQIMADGLIIETLTLPDIPWERVGAVPNFFNNDFITGQSVSGIYLINGQYQYNGIITSIEFNAFKTGNIDLLLLKPSC--GT-YYCIATGSCAATPSCSRTLACGNE---YCPLSQSC----SAICNNRLLNKENSSSLPSVSYIINQVQLYPIS-NTGYQIVTLSVPWPVQAGYRLGFHFGNGITDLIAVTSLRSGETPNFFYNSQTVTSGTLIPSTSFTPKYISHQFSAVSVQQRNTKFKLMFNTTGIKNVTVNLQXXXXXXXXXXXXXXXGL--NINDTSFANLGYATTNVSYMFIMNPHTGDQLLYYWDFGDNTTLNSTTRFVN-HTFTVAGVYNSSVYVYNTLVSKVQNYLIYVKDAVKINFFNSSG-VYNPNVFASFILSMKSGTGFNCTLSGDGIANQTQPSNNLLFGWQWATEGSFNVRIDCYNELTRDYKTLVQVIQANITGLTFVNFGGAAFEQMQLRFSWLTGSNITFLLLVNNISYSLTQNETALTGISQNITISAPGVLIGVIRATNLISDIILVANLTFSQKISNMNLIADKYYTTNGSAFNFYVNMSTGSGVRSVIQYGDGQNNTNINYESPSVY-WPG-ISVP-YTYSNVGTYNVTVNCTNIVNSQTSSVVVYVLTGLGTYEIVYNNLFFKKNDLIQLSLNRTSGYPASMTNITINWQNGDITSIPFAAFNESAI---YNYVYSANGVYNVTLTLQNPL-STVVKSILLSIIDPIINFRCVNVPANTWNGNQIQLQTLVDQGQNVIYTLNPGDGGALITKNINISXXXXXXXXXXXXXXVGNYTSNIWACNQLGCQNCSNYVQIQYKIQSFDFQVQTNGNIEYLKTNLITTISFTGTNFPTALMATFTLSDGS-------------------PPSTVYLSLSMMPYNFVKNLSVVGFGNILVKLENLANSVNISATYGSFEKFSNFNVSLTW---GPTR-ALGFGANFNTFPLNNPVYFRPSAQAKGTVVGYTFLYAPIK-NLSAIFQCNATLVNGEFSYTFSTMGDFNVSFKVYNPIDQAFIENTLTIGSSIQNTQISTRPLTLMPNYFGYISIQWSVISTESCICVDFA-NNTKLIYGAMSGCSNCSG-----YLFANRKPSNNLLEILVRFSTEGDYNIKVFIYNDYESAFANRTIPVTYAQCAPPVVSMTYTQFQNPMTPQKDIRSSQIIVSAVVLDLPCILTKNNMKLWSATLMDPIYLTPIKAVDMSIIPTSNNTQLIIPPRFLNYGLYKLTFSVTMDKNVTIYTFQSSNFTYLFIDKSPIIVGLSSGGISLIVNGIDQNICFTPLQYSQDPDLNVQDFSKWI---WTWTCQKTTESE----NLTNYVYPKPIGYSFT---TPKTGCFGDGPGVVNFTSSP--CFWGGNLEINGTYQLGLVGMSSDNRTGSAKIIITVVKGIPPDITVQCLRPLMCKINNVGAFAFNEVVFNPSDALLLSATCYGNGTICGQGLWNLILLNETTQIWTPLDSSIANLYIKGVYSMQISLLPSFFSFYNTIKRFQICYNSINLTP-NGKSCIQFYIFPLPSGIICTLDKTT-VQQTDTVCVNCTFQPN------YQYRMYVNVTNECSTL--GFNSTGQFCSIIPYQTVNQTYIVRVTNENGGFIDVIAGIIMVTQLQLVDLTKILTNVINGTDQTLTVAIAKGDFKEMSQVYLKYVSVLTASNQITIRNLFQPLTNNSKENLGGTGYMTTSVNSSTMTIESLPKDIRAKYEIDRDQKSTVINSMTAGLYTMVPGDIQSLHLISSVVNAIGESSDCVNRQSQWQLSTKLASLADNFKELQKTAPRDDVLTIATNLLSANYRSDAAANIQIDNGILRDIKFSKDT-YLDYDTNLESGGKNYLNVDDPSAAAYSLTLETNSNFQSKIAFGVGSNSLYTIQTISKVLRDITVLNDVPTDLLTSQMQYYSIKTQINDLSNKAFTKGRSTIILPDICAAL---NSPPGSCSDPNNPIGLEIIATPNNVRAYAQNPNKNG-LPIPMNSDFVSLSLFLGRQISEKPVQPNGNNN-FTIFISRDPVFAVPDF---NFTEPDPQIQPPKSIPGTGT-IFTGPQCFEQKLVVYQFKLIGSDQSVHFQIK-SNFS---TKCTQYLIVGRLGQPPVLGANPDGSVDSVNFTFWGMIPTHTKYCNLIPSSDMPDPFTFFVDNSMFKQSKISTKSSMPDYSKTLDTLYFGVRELTPAEYDLYTRSNRPPVPYTISAQINNTFRVRIFSTGCYFNSNNFQGGWGTAGCVVGPLTTTKVTQCICNHLTSFASGWIVAPNTIDFDYVFSNFDFTKNLTLFVTEXXXXXXXXXXXXWARRMDIKDIEKVGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVA-------------------*GPTKTTE-SVLTVGPFALTSREIWIGFVTNIISFVPLFVIIEMFRRSQLKHGHANKLRQAVENHLQISLESKENKGYQGSTATLVRNEDVNSRPTTP----SYRSTDQINIQIPEYEVENQDSDANEKYKKRVIKRKLLPWWMRIIVWGFLTFLVIISVVFTTFYGIQFGDIACKKWISSMFISFFTSVLLTQPIKVVLLAIFFALVCKKSSSFXXXXXXXXXXXXXXXLGRRNALMQNEEFLHNELYSAPIKPHRFHVQPPPKEELEKAREIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFI-KTSNPNWQ-FTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDTPAPE---FSFKSEKELNGMS-YIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFI 10022
            G Y+ D ++ +  +CT  C    F +  +W++ +CFC+++I  +A  N+TD +  A     YV+   + +A+S+  +     ATT+   +  L   + N+   AP     S +  Y D     E  + +  A  + +   G++ I++Q  +  N   I   + +I   + ++ +N+TC  + I    + C +SI++G+ +   I       E   + D PW+R G+ P    N  +   S++G  L+   +++ G + + EF A   G+++LL+L+P+C  GT YYC +   C A+ +C+  + C       CP +++C     + C  +   +  + SL S     N  + Y +S   GY ++ ++  + V  G ++GF    G   ++A   +   E  ++ ++S +  +     S+  T + + HQ SA+S    + +    ++TTG   V V + +       +++S  V +  NINDT F  + Y          + PHTG  + Y W + D++T  ST+  V+ ++++ AG    +V  +    +K  +    + + V I+     G ++  +  A+ +L+  +GT +NCT S    +     SN +      A  G +NV   C N LT D ++ V  ++  +T    V         +QL+F     ++  F  L+ N++ ++T NE  L    + +TI+A G  + + RA N +SD++ V N T  ++I+ +N+  D      GS  +F ++M+ GSGV+  + +GDG +    NY +  +  W G I +P  TY+  G Y VT+N +N++  +  ++ V+V+  LG Y++V  ++    N  +   L    G P S+T     W +G     P + FN   +   YN+ Y+A G Y V+ + +NP+ ST   S  + ++ PI N   +  P     G   +    VD G N+  TLNPGDG   IT  I+ S   +    N TY   G +T N+  CN   C   +N + +  K+ S    +   GN+ + +  L  T +++G +      A   + D S                   PP   Y+  +   YN   N +V G                     G+F   +N N +L +   G T+ + G+G N   FP    +   P++   G + GY     PI  N+SAI  C        F Y   T G F V+   +NP+  A +   +T+G SI   ++        P     +S+ W VIS ++C+ VD      + +YG  +  + C       Y +     +NN L+  V +   G Y + VF  N++ ++  + T+ V+ A+C PPVV  T  ++  P +P++ +RS Q I+   +++LPC LT +N + W    +DPI    I +V+++ +P+S NT L +P  FL+ GLYK+T  V M+ ++TI  F +S   YL +  SP+ + L++GG+S +     + IC  P  +S+DPD+N    S      W + C +  E+E    +LT    PKP  + FT      +GCF   PG+V+   S   CF G NL    TY   + G  S  R G A I I +V  +P  + ++C                                C  + + C    W++  LN    +W  +D +  + +I+G  + +IS  P  F+  N+ +++++C N  N T  +G+ CIQ +   +P+   C+ + T+ V       + C+   +      Y++ +   V  + S+L  G+N    F    P+ +   T  V V++  G  +      I +++        ++ +++ G+   L   + KGD ++         +++  S+   I  L    T +      G+GY   + N     IE+LP D++A Y+ DR+ ++ V   +T  L T+   D + + L++  +  I E+ D + R +Q     K   +      +  +  ++ +  I T LL+   ++ +A + Q+D GI  DI+ SK + Y +YDT+ ES  + ++       A      ETN   Q K++  V S+S+  I+ ++ +L    V  D P  ++T Q+      T  + LS    + GRS+  +P     L   ++  G CS PN+ I +   A P N   + + P  NG   IP +++ V+L+L  G+   E  +   GNN  F I I++DP F  P F   N  +P P+I     +PG+    F   +   QKL+++ F+L G+DQSVHFQ++  NF+   TKC Q+L+VGRL  PP L     G      F +WGMIPT+T+YC + P +D PDPFTFFV N  F + K   +S  PD+ K ++ + FGVREL   E++ YT +N PP+PY  S Q    ++VRIFS  CY    N +  W T+GC VG  TT + TQC+C+HLTSFA GW+ +PNTID++YVFSNFDFTKN TLFVT+IV+A++F  IFIWAR  D KD+EK+GVTPL  N+    YLYE+ + T +R  AGT S V+FILSGE+DETD R L D KR +L+RG  DRFL+AV R LG L ++R+WHDNSG+G +ASWYCN   V DLQT+ ++HF++N W AVEE+DG +DR++ VA ++EL  F  +FS + K +L++ HLWLSIMARPPESRFTRVERVA                    GPTK +  S L +GPF+LT R +W+G VTNII+FVPLF+++E+FRRS+L+ G+ N+L++A+++H   S ES + + Y   +A     +  +S PT P    ++ S+ Q+N+ +        DSD  EK  KR ++    PWW+RII W  L    + S VFTTFYGIQFGD  CKKWISS+F+SFF SV+L+QP+KV+L+A    LV                        +RN L  +EE++++E      +  +  ++PP  E LE+ARE RLKE +M+++ REI FY +F+  LL VT++FRDPN Y +K+++  + + +  N   +   GI+ E QFW W  +  +P +RA  WYN  P L+QRG+  +R  RL+GYA+MRQ R K N+C V    + + KNC  TYN  ++++  +   WT  + N T  P+   F + S  +L     YI R+  YS GGYV+QFR ++ N+ + +  LK  HW+D QTRAIF+
Sbjct:   46 GDYDPDLLATEPVVCTSRCQQMSFAYAAIWQSRFCFCSDNINQTADFNITDLAAAACTAPEYVAVYNSEIATSIEDLEVTVGATTEVAVNTPLEVKALNVS--APLSNTFSTRLGYADDRFRKELIMSNGYATNKSYIQPGVFNIKAQAYQYENTV-IGSGALQIKVTEPLSGINLTCPSVWITEKQMQCVLSIASGTGLRALINWGDGTTENFIVADPPWDRAGS-PVATQNSEMENSSITGA-LVAADFKFEGTLQAFEFFAHTAGSLELLILRPACSGGTPYYCYSKDICDASNACNSDIDCAATSEILCPATENCWQASGSTCATKATKRNVTRSLHST---FNVAKKYSVSAQVGYNLLPVTDQFLVLPGDKIGFW---GSVAIVAARPVSVVEGNDYSFSSGSSPTTLTT-SSDLTAQPMQHQISAISRPVTSHRLDRTYSTTGNFTVKVTISNAYLTGVESNASQSVWIQPNINDTRFVPVKYVLAREPCNIALEPHTGVDVKYNWSYSDSSTTESTSVPVSTYSYSSAGPGFINVTAFTVFENKTNSTSFQIIERVNISALVLDGQIFGNDSAATVVLA--TGTDYNCTFSISPGSTYYVSSNAMRIP-PLANIGYYNVNATCTNFLTSDSRSNVLYVEVPVTTFQLVTKAAEVNVAIQLKFRLNNCTHPKFEALLLNLTRAMTYNEPLLEVDMEPVTIAAVGKYVLISRAYNNVSDVLTVMNFTVQERIAGLNITIDNAVQEIGSVASFKISMTKGSGVQIDLAFGDGNS---FNYTTEDIEPWGGRIILPNTTYATGGDYTVTLNASNLLGFEVLTLTVHVIAPLGIYQLVGPSVA-TLNTPVGFQLQLVVGSPPSLTTANFTWGDG----TPISTFNNVQLNVDYNHTYTAVGGYAVSFSAKNPIPSTASNSTSIIVVKPIENPTVLFTPPVLAKGEVARAIVNVDSGTNITITLNPGDGNPAITYWID-SASTSTVVMNATYIINGTFTMNLTICNPYHCFVYTNNLPVVNKLDSGTLGLTNAGNVTFGRP-LEFTFTYSGASADAPYGAMIEVRDSSDAVVQNSPVVIPITTLNLFPPVAGYIDYTFFVYNNGSNFTVAG------------------PRIGTFTNITNLNFTLKYRTPGDTKLSSGYGPNQLMFPNKKDLVAVPTSD--GYIQGYILSIEPIPVNVSAIKLCVFASNESAFKY-IETTGAFEVTLTAWNPMSNATVTMNITVGGSILGGRVVDNDGVTKPKETRSVSLVWDVISDDTCVFVDLGLPQYRYVYGPANCNTTCGSSFDDTYQYTGALVTNNRLDFNVVYDKRGTYQVNVFACNEFTNSSFSGTLAVSNAKCRPPVVVFTDARYSTPDSPREILRSDQAIIECRIIELPCELTLSNKREWYFYKLDPISFGVIGSVNVTALPSSGNTILAVPKLFLDVGLYKVTVRVVMNTSITIEEFANSTSMYLQVGSSPLFIALNNGGMSEVKLTTRRQICLQPKMFSRDPDVNSTSVSNQGIGGWIYHCYQEGEAEPSDNSLTPLQTPKPSSFDFTGSPPAASGCFSSPPGIVSNDGSGVLCFDGRNLLSGRTYIFKVQGTKS-GRKGKASIRIQMVDNLPATVVLRC-------------------------------NCSESPSACQSTSWHVKYLNHL-NVWVDVDDTTRSQFIEGTSNSEISFSPGLFNSVNS-RKYRVCLNVANGTDYDGEGCIQLFTNTMPTAGTCSCNATSGVAGISGFNITCSGYRDDDGIDSYKFFLVKEVNGKTSSLLLGYNHKPHFIGPFPFFSEVVTIQVVVSDVYGATVSNNYTQISLSKPSKAHTDSVIKSILGGSAPLLKT-LNKGDMQDTCNELQNIAALVVESSHSEISKL----TGDDSVTTAGSGYGDGTTNGE-RKIEALPPDVQAVYQKDRNDRAEVFKKLTTFLTTLTTADAKQVELVAGSMKGITEAMDDLPRSAQIGCKNKAIEMVGTLSHISDSVGKEQMEAIVTPLLTTLSQTMSACSAQVDWGITGDIEESKKSEYYEYDTDWESDRQGFMKSSSTLEAGSKFIKETNGVVQGKVSKEVSSDSIGAIEDLTVMLASKQVQGDKPLVIVTPQLSLVINNTSPDSLSGVQISAGRSSFSMPKGLCELTKASTSSGQCSGPNSAIAMAAFAMPTN--PFPKMPTNNGDCSIPKSAEVVTLNL-RGKDGKEIRIDNTGNNGVFEININKDPTFVEPKFTDPNPHQPIPRIPEGMEVPGSAEGPFEKNKKIYQKLILHDFQLTGNDQSVHFQVEFENFTRNVTKCRQFLVVGRLWHPPSLMDPEKG------FDWWGMIPTNTEYCRVYPGADEPDPFTFFVSNDKFNKVKAKVRSRAPDWDKDVNKVKFGVRELEEEEFNKYTENNPPPIPYPYSKQFTIKYKVRIFSASCYATRRN-EDSWSTSGCTVGNKTTVRTTQCLCSHLTSFAGGWVESPNTIDWNYVFSNFDFTKNPTLFVTQIVIAVLFTLIFIWARHGDKKDLEKLGVTPLYDNNPEHKYLYEIVVSTGMRRGAGTESKVHFILSGERDETDIRPLEDKKRKVLQRGCADRFLMAVERPLGALNFLRIWHDNSGRGASASWYCNSVVVIDLQTRRRYHFVLNRWLAVEEDDGVVDRVVPVAGLEELKDFNYMFSTQTKKDLTDGHLWLSIMARPPESRFTRVERVACCLFLLFLTMVTTCMFYQKEGPTKASATSGLNIGPFSLTPRMVWVGVVTNIITFVPLFLVMELFRRSRLRVGYVNQLKKAIDDHFDGS-ESDDFR-YSDQSAKYQVQQPKSSGPTKPMQASTFGSSKQVNVDV--------DSD-EEKPPKRPVR---FPWWVRIISWIILILGTLTSAVFTTFYGIQFGDETCKKWISSLFVSFFASVMLSQPLKVLLVAFLTRLV------------------------KRNGLRFDEEWMYDE--GDIDRQRKTGIEPPNAELLERARERRLKEKKMFEILREIVFYFMFYLLLLLVTFAFRDPNLYDMKSQMERLLLPRMDNATGEGIPGISTEAQFWQWLEDQFIPGIRADRWYNGAPPLFQRGYTGDRVGRLVGYAIMRQKRNKLNTCVVQPSVRYLVKNCIDTYNFIDEEKRDFDPKWTDYNPNTTALPQYEAFRYTSGSKLKSFGPYIARMHTYSPGGYVFQFRGSLKNIRSNIAELKTLHWLDKQTRAIFL 3152          
BLAST of PKD1L-1 vs. TrEMBL
Match: A0A3Q0KRY7 (Polycystin 1-related OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 1482.62 bits (3837), Expect = 0.000e+0
Identity = 1064/3536 (30.09%), Postives = 1718/3536 (48.59%), Query Frame = 3
Query:  666 GTYNKDQVSLDRTLCTDECYYSGFPFTVVWKNTYCFCANDISAGINVTDFSTCATVDGFYVSASLASSLTVIFQMAMATTKFIASGNLVSMS---PNIYYYAPPGPPPSFKY-------------------SYHDKAGIWEYSLDSNAIQRVFSISGIYQIRSQVLKPNNQAKISE---VSTEIMAYQSVTNLNIT--CQPIAIVYIAVNCTVSISNGSFITGQIMADGLIIETLTLPDIPWERVGAVPNFFNNDFITGQSVSGIYLINGQYQYNGIITSIEFNAFKTGNIDLLLLKPSCGT-YYCIATGSCAATPSCSRTLACGNEYCPLSQSC----SAICNN-RLLNKENSSSLPSVSYIINQVQLYPISNTGYQIVTLSVPWPVQAGYRLGFHFGNGITDLIAVTSLRSGETPNFFYNSQTVTSGTLIPSTSFTP---------KYISHQFSAVSVQQRNTKFKLMFNTTGIKNVTVNLQXXXXXXXXXXXXXXXGLNI----NDTSFANLGYATTNVSYMFIMNPHTGDQLLYYWDFGDNTTLNSTT-RFVNHTFTVAGVYNSSVYVYNTLVSKVQNYLIYVKDAVKINFFNSSGVYNPNVFASFILSMKSGTGFNCTLSGDGIANQTQPSNNLLFGWQWATEGSFNVRIDCYNELTRDYKTLVQVIQANITGLTFVNFGGAAFEQMQLRFSWLTGSNITFLLLVNNISYSLTQNETALTGISQNITISAPGVLIGVIRATNLISDIILVANLTFSQKISNMNLIADKYYTTNGSAFNFYVNMSTGSGVRSVIQYGDGQ--NNTNINYESPSVYWPG-ISVPYTYSNVGTYNVTVNCTNIVNSQTSSVVVYVLTGLGTYEIVYNNLFFKKNDLIQLSLNRTSGYPASMTNITINWQNGDITSIPFAAFNESAIYNYVYSANGVYNVTLTLQNPLSTVVKSILLSIIDPIINFRCVNVPANTWNGNQIQLQTLVDQGQNVIYTLNPGDGGALIT-----KNINISXXXXXXXXXXXXXXVGNYTSNIWACNQLGCQNCSNYVQIQYKIQSFDFQVQTNGNIEYLKTNLITTISFTG--TNFPTALMATFTLSDGSPPSTVYLSLSMMPYNFVKNLSVVGFGNILVKLENLANSVNISATYGSFEKFSNFNVSLTWGPTRALGFGANFNTFPLNNPVYFRPSAQAKGTVVGYTFLYAPIKNLSAIFQCNATLVNGEFSYTFSTMGDFNVSFKVYNPIDQAFIENTLTIGSSIQNTQIS-TRPLTLMPNYFGYISIQWSVISTESCICVDFANNTKLIY-----GAMSGCSNCSGYLFANRKPSNNLLEILVRFSTEGDYNIKVFIYNDYESAFANRTIPVTYAQCAPPVVSMTYTQFQNPMTPQKDIRSSQIIVSAVVLDLPCILTKNNMKLWSATLMDPIYLTPIKAVDMSIIPTSNNTQLIIPPRFLNYGLYKLTFSVTMDKNVTIYTFQSSNFTYLFIDKSPIIVGLSSGG-ISLIVNGIDQNICFTPLQYSQDPDLNVQDFSKWI--WTWTCQKTTESENLTNYVYPKPIGYSFTTPKTGCFGDGPGVVNFTSSP-CFWGGNLEINGTYQLGLVGMSSDNRTGSAKIIITVVKGIPPDITVQCLRPLMCKINNVGAFAFNEVVFNPSDALLLSATC-YGNGTICGQGLWNLILLNETTQIWTPLDSSIANLYIKGVYSMQISLLPSFF-SFYNTIKRFQICYNSINLTPNGKSCIQFYIFPLPSGIICTLDKTTVQQTDT-VCVNC----TFQPNYQYRMYVNVTNECSTLGFNSTGQFCSIIPYQTVNQTYIVRVTNENGGFIDVIAGIIMVTQLQLVDLTKI-LTNVINGTDQTLTVAIAKGDFKEMSQVYLKYVSVLTASNQITIRNLFQPLTNNSKENLGGTGYMTTSVNSSTMTIESLPKDIRAKYEIDRDQKSTVINSMTAGLYTMVPGDIQSLHLISSVVNAIGESSDCVNRQSQWQLSTKLASLADNFKELQKTAPRDDVLTIATNLLSANYRSDAAANIQIDNGILRDIKFSKDTYLDYDTNLESGGKNYLNVDDPSAAAYSLTLETNSNFQSKIAFGVGSNSLYTIQTIS-KVLRDITVLNDVPTDLLTSQMQYYSIKTQINDLSNK--AFTKGRSTIILPDICAALNSPPGSCSDPNNPIGLEIIATPNNVRAYAQNPNKNGLPIPMNSDFVSLSLFLGR--------QISEKPVQPNGNNNFTIFISRDPVFAVPDFNFTEPDPQIQPPKSIPGTGTIFTGPQCFEQKLVVYQFKLIGSDQSVHFQIKSNFSTKCTQYLIVGRLGQPPVLGANPDGSVDSVNFTFWGMIPTHTKYC-NLIPSSDMPD-PFTFFVDNSMFKQSKISTK--SSMPDYSKTL-DTLYFGVRELTPAEYDLYTRSNRPPVPYTISAQINNTFRVRIFSTGCYFNSNNFQGGWGTAGCVVGPLTTTKVTQCICNHLTSFASGWIVAPNTIDFDYVFSNFDFTKNLTLFVTEXXXXXXXXXXXXWARRMDIKDIEKVGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVA*-------------------GPTKTTESVLTVGPFALTSREIWIGFVTNIISFVPLFVIIEMFRRSQLKHGHANKLRQAVENHLQISLESKENKGYQGSTATLVRNEDVNSRPTTPSYRSTDQINIQIPEYEVENQDSDANEKYKKRVIKRKLLPWWMRIIVWGFLTFLVIISVVFTTFYGIQFGDIACKKWISSMFISFFTSVLLTQPIKVVLLAIFFALVCKKSSSFXXXXXXXXXXXXXXXLGRRNALMQNEEFLHNELYSAPIKPHRFHVQPPPKEELEKAREIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTSNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDTP---APEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFVVTKFIMWTGISETKFGKKFIK 10934
            G Y+   +  D + C   C  + + ++ +  ++YCFC N++     + + ++C   D   V  + +++    FQ+          G+ +S++   P  +   P      F Y                   SY+    +W      N    + S+    +  SQ+   +   K ++    S  +M Y+ +T  +IT  C  I +      C ++ + GS I G +       + ++LP+  ++ +G  P    + FI+  + + + +   Q +Y+G I++I+ +A    ++   LL+  C +  Y   T  C+ T + S T      +  L + C    S+ C + R L  +   ++ +  Y +  +    ++  G+Q + L   W +Q+G R+GF      T ++A +    G  P+  Y +  + + T    T+ +            I HQ  A              NTTG K+V++ L S      ++ + +   + I    N+T    L    T+      +  HTG  + Y WDFGD T   +T+ + V H +T  G+YN +V + N++  K+    I V    + N    +     N   +  L++ +G  F C+   DGI   T+  N   F ++    G     + C        + L Q +    TGL+ V       +  Q+ F+++TG+N+T  L+  N   + + +    T  S+ ++      +   +  TN +   +    + F   +  MN+  +  Y        F V+   G+ +   I YGDG+    + +  ++    WP    +   Y N G Y VT + ++  N +  +V VYV+  +G Y    N  +   N+ + L + R SG PA +T I+++W  GD +      F E  +Y+++Y + G + VT +L NP+   V    L +   I NF C  VP     G    +  +    +NV       +  AL+      K  N+                G Y   I A N +  Q+CS  V ++ KI + D  +   G+  Y   ++  T+++TG   NFPT         DGS PS   L L+  P      L+ + +    V L+N+ +++  +    +F  F   ++ +T   T   G+G + N+FPL   + F+  A  K   V     Y+ I   + +   + T+ +  F YTF+  G++NV     NP+        L+I +SI+  +        L PN  G I I +     ++C+CV  ++    +Y        S CS C  Y      P N    + V++ + G + + +   +  +       IPVT++ C PP +SM+    Q    P K + S  II+ A++    C+L+  N KLW+   +D      +  + +S   +S   +L +P  FL  G YK T SV       +  +  S   Y+ +   P++V    G  IS  ++     IC  P  YS+DP +N  +  + I  W W C++  E  +    + PKP G+ + +  TGCFGDGPGV++  +   CF   N  +N  Y+  ++G     R G A + +     + P  T++C  P +C                 SD L ++    +G  +   +  WN+  +     +  P D    + Y +G ++    +   +F +  N ++   +C      T  G SC++F   P P+  ICT        TDT +CV+C    +      Y  ++  ++    L   +  Q C ++PY        V V+++ GG I++    + V Q + +DL +  + ++++  +  L   I  G   E + +   Y SV+     + I+N               TG    +++ +T+               +R+ +S VI  +   +   +P D  S  L  S   +I +++  V+R SQ +L+     + ++ + +      + +L + + +  +      A N QI+N I  DI     T LDY+ +LE  G     +D        L L+ NS  Q  +  G   + +  + T S KV + + +    P    TS       K   N+LSN+     K  + + + ++C  + +   SCS+P     L+   +  N+ ++      + +PIP +++ +SL L+  +        +I E  V    N N  IF S DP    P      P P+I   K+           + ++  L+  Q  ++ +D +V FQ+     ++C QYL+  RL  PPV+  +  G      +  W  +P  T  C N+  + + P+  +TF +DN    + + + K         K++  T+Y G R+L   E ++Y  ++ P +PY    QINNT   R F T C     +    W T+ C VGP TT + TQCIC+ L++F SGW   PN+IDF+YVF+N DF +N TL+ TEI + ++F+ I IWARR DIKDIEK+ VT L  N+ +  YLYE+ + T  R  AGT S V FILSG+  ET    L D  R +L RG  DRFLLA P+ LG L YIRLWHDNSG G NASWYCNY GV DLQT+EK HF+V SWFAVEE DGQ+DR+I V S +E+L F  +FS     N+++DHLW+S++ARP  SRFTRVERVA                    G  K   +++++GPF  T  E +I  V N+++F+PLF+II +FR ++L+  HA KLR+A+E HL       + K Y G  A+ + +     + T+   +  D      PE   EN D D   K K R +      W MRI+ W  L   + I++ FTTFYG+ FG+  CKKW+SS+F+SFF SVLL QPIKV+LLA+FF+ VCK +   +  E   EE+ L+  LG+R  L  +EE+L+N   S   +P R  + PP   +L +AR  RLK+ +  D+ RE+  Y+ F   LL V+  FRD N + LK+ L N+F   S     F  +   + F+ WA  VL+P LRA  WYN +P L+QRGF+ +R +R+IGY +MRQ+RTKK+SC V + AK + K+CY +Y++FN+D+ +YG  W     +D     APEF +++  +L G  Y+G+I  YSGGGYV+  R +   +   M+ L   HWI+F TRAI I+FT YNPNINLFAI T +VE PG G M   YR+E ANL G+     K  +I  Q L+   +   ++KEIRN+ +++ KYFT+FWN +E+FI+ GS  A+A ++Y+ + T    E+F++  G++Y+NF  +A+ NENL Y+ + I F A LK + + RFN+R+G+LGSVL Y + D+K F  IF ++F AFV+VFY L+ D+L  + T L A E SMQI LGKF F  +Y+++ + GP++FA + L ++FV+++MFIAIL + F  V  D+ LQ +DHE+ +F++ +FI   G+ +T +GK FI+
Sbjct:   52 GFYDSKTIGTDPSECLTGCSKNNYTWSAISNDSYCFCGNNLPPSTELYN-ASCLYSDIVTVYRTDSNTFIGPFQITTTELTVRQVGDKISINFVIPTEFKNLPGVKVYEFDYGDTIQTTENISDITIPLVISYNSPGPVWPTLRARNEDGTIVSVFNYNRKCSQMYSDSAGTKYNDTGSASLALMIYELITPADITFNCPIIVMSRSVFTCQLNCNKGSHIQGTVSFANDWQDAISLPEPNYDWIGLPPKRMTDKFIS-YNTNKLIITGSQARYDGTISTIQIHALLLTDVTFYLLRVQCTSGMYNFETNGCSLTNNRSVTCTANQVFSGLLRDCVNISSSDCGSLRQLKLDKPITVENYDYQVIGIYTVKLTVLGWQSIKLPSVWTIQSGDRIGF------TSILAGSI---GCAPSTSYEADDLETLTTFSGTNGSSVLGSGLKRLTLIRHQIGAWIRPTHGALLTGYINTTGYKDVSLQLYSYWGKNYTSPALIKTPILIDEIINETQLI-LNICDTDTQCSLELKNHTGINVTYVWDFGDGTVQETTSVKTVQHIYTAVGIYNLTVNISNSIQYKIITQNITVMKKTEFNGIQGNYFAVLNELTTLKLNI-TGKRFICSWYIDGIL--TKNDNMTQFDYKHIQSGVVVWNVTCQTPTIAFSRKLEQFVLERFTGLSLVTKSLQVAKPAQIVFTFITGNNLTAQLIFFNQVLNTSIDYVQKTITSELVSEPQTASVNYSLWITNPLGSNLTTGQIQFDVPVLGMNVQVEPNYVGLSENLIFRVSFQEGTSIILTIDYGDGEVIQQSAMQLQT----WPSDYQLTKKYLNTGEYIVTFSASSGGNRENRTVSVYVVGTIGVYTAQANTEYVAVNNPVTLKITRQSGNPAVLTKISLDW--GDNSQFTLDDFREGNVYSHIYKSEGDFGVTTSLTNPVDQKVFVTTLKVRAGIENFGCQVVPNPVETGKLSVISVVYKSAKNV-------NISALLNNRTDPKQFNVPAPKLTEINYNYPV-AGLYYEEIQAMNSVSNQSCSLIVDVRNKIVNVD--IAYGGHAVYPSGSVTFTLTYTGLAANFPTLAKYKVVWGDGSAPSEGMLQLANQPEKINHVLAGLNYFQASVTLDNVISNMTKNTQIAAFGLFQQIDLMVTVASTGYPGYGIDGNSFPLGVQLRFQVLADGKPNNVA-NITYSIINKTNNVILDSGTVWSNYFFYTFTKFGEYNVVVLASNPVSMKSTSKELSIRTSIRGLKAYLVGNGILEPNQQGIIQISFEAYPNDACLCVTKSDGIGSVYYPKLADPTSFCSLCPSYSRLQDVPVNLTFSLSVQYGSSGLHYVFIQAISASQMVDTKLYIPVTFSTCPPPKISMSNVSSQLTNYPIKAVTSENIIIEAILTVPDCLLSVPNEKLWTLYSIDLDTTQTLGPISLSQQLSSKTLRLGLPANFLTPGTYKATCSVQFTPPQGV-PYIVSESAYIIVVPPPLLVQFDVGNPISKTIDLSVNEICLKPEVYSRDPAMNNVNVPQGIGSWIWYCRQVDEQLS-GKLILPKPPGFQYNSDYTGCFGDGPGVIDTNNGTLCFTTENFRVNKAYEFTVIGSKPPKRNGKATMRLLTTSEVTPIFTIRCSIPYLCYNLEFDPSNLTSWFIPESDDLYVTVFIEFGTLSPDMRFEWNIREMYSDGTLL-PFDQVQQDTYTEGTFTSSYRVKKGYFINKSNNVRGCIVCATLTKNTDIGTSCLRFKYLPRPTPGICTY-----TLTDTYMCVSCVNFTSIVSPLTYTFFLKNSSINIVLTSGNLPQTCFVVPYMYSPLDACVYVSDKFGGSIELCYANVFV-QAKSLDLVRAAIQSLLSEKETELNRLITTGQLTESADLVTSYASVVQMFATLDIQN--------------STG--ANNISDATL---------------NRNSRSLVIQMLVNAVNNFIPTDSNSFILAMSSTESILDNTLDVDRSSQSKLNAYFTKVTESLEAI-VCGNTNQLLKMTSTIFQSTLLLAEAGNRQINNPISLDIPTDPAT-LDYNVDLEKAGLQTSGLD----PMVDLMLQ-NSADQQSLLVGETLDMIRKLMTTSQKVTQRLLIEGAPPITFETSNGVISLSKITPNNLSNRIPVLNKLENGVFVNNLCDNIQALNKSCSEP---YSLQTFLSKTNLFSFRTG---SSIPIPFHTETISLILYDSKPVTIRNVKEIVEGIVHRLSNFNPPIFTSMDPGTNRPQL----PAPRISVDKT-----------EVYQALLMSQQ--VVSNDVAVFFQLYPENISECPQYLLFLRLVDPPVISLSNGG------YDMWTTLPEDTSQCVNMTTNPNDPNYRYTFMLDNRQLMELRSTQKYRERFELLQKSVAQTVYIGFRQLNQYEINMYKTTSPPLIPYPYRDQINNTALSRWFLTSCVSGQVDSSKRWSTSKCRVGPETTVQQTQCICDELSTFTSGWFAPPNSIDFNYVFANIDFNRNPTLYATEISLCIIFLLILIWARREDIKDIEKLSVTQLSENNPDCEYLYEIIVSTGHRRCAGTDSKVCFILSGQYGETGCYVLQDPNRKVLCRGATDRFLLACPKPLGSLIYIRLWHDNSGVGDNASWYCNYVGVVDLQTREKSHFIVESWFAVEEGDGQVDRIIPVTSEEEMLTFMHMFSTTASRNMTDDHLWISVVARPIYSRFTRVERVACCLLLLYLSMLGSCMFYKGEGSAKQ-PNIISLGPFGFTPSEFYIAIVNNLLTFIPLFLIIYIFRNARLRVSHATKLRRAIEEHL-------DEKLYLGK-ASFIYSAQSAIKDTS---KDDD------PEALAENAD-DTEAKQKGRTL---FCGWQMRILAWLLLILCLGIAIAFTTFYGVMFGEATCKKWLSSLFLSFFISVLLAQPIKVLLLAVFFSFVCKSTDRVDQIEIFEEEDRLIRTLGKRYQLRMDEEYLNNNYLSDDFRPQRLAILPPDPSDLARARAYRLKQRRANDIIREVILYVFFLTLLLIVSLDFRDSNGFLLKSSLQNLFFPDS-----FQSMNDVDDFYKWAQKVLIPGLRADRWYNRNPPLFQRGFLQDRTDRIIGYGMMRQLRTKKDSCNVHELAKHLFKHCYGSYDMFNEDKEAYGISWAKFEGDDKSNNSAPEFVYQNSSQLKGYPYLGQIAWYSGGGYVHLLRGSKDEMLDRMSYLNQTHWIEFSTRAIIIQFTVYNPNINLFAIITALVEMPGIGAMIPSYRIETANLFGVLGSETKLAQITSQALFAFILFCYLIKEIRNMFRERLKYFTRFWNFVELFIICGSIAAIAAYIYMILCTKSSIEEFSRTHGNIYMNFQLLAYWNENLTYLTAIICFFAMLKLVYLFRFNQRVGLLGSVLKYAATDLKYFCFIFLVVFSAFVLVFYLLYNDTLSGFKTILNAIETSMQIILGKFDFTSMYERQMVLGPLLFAAFSLCVVFVMVSMFIAILDESFQHVLKDLSLQSDDHEMTQFILIQFIQCIGLDKTAWGKNFIR 3452          
BLAST of PKD1L-1 vs. Ensembl Cavefish
Match: pkd1l2a (polycystin 1 like 2 [Source:NCBI gene;Acc:103044173])

HSP 1 Score: 315.849 bits (808), Expect = 2.198e-85
Identity = 206/654 (31.50%), Postives = 334/654 (51.07%), Query Frame = 3
Query: 8955 LPWWMRIIVWGFLTFLVIISVVFTTFYGIQFGDIACKKWISSMFISFFTSVLLTQPIKVVLLAIFFALVCKKSSSFXXXXXXXXXXXXXXXLGRRNALMQNEEFLHNELYSAPIKPHRFHVQPPPKEELEKAREIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTSNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWT-ALSANDT---PAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANL-LGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFVVTKFIMWTGI 10901
            LPWW   + W  +     +S  FT  YG+ +G      W+ SM +SFF S+ +TQP+KV+  A+FFALV KK       +               +  + N +      ++       F+ QPPP   +EK R   +KE +++ + REI  Y+ F   LL V Y  RDPNA+ L   +   F      N     +T  E F  WA + L+ NL             Q GFI++ N++L+G A +RQVR +  SC V    ++   +C++ Y+   +D GSYG GW  ++ AN +   P P + ++++  L      G + +Y GGG+V     N  N  + +  L +N W+D  TRAIF+EFT YN N+NLF I T + E+   G     YR E  ++ L   +GG+  F +  +V+Y +FI   + ++ + + +QKW+YF   WNL+++ I+I S+ A+  F+   +  +Q  E + Q   D Y  F   A  +  LGY+++F+V LAT+K   +LR N ++ M+ S L     D+  F ++ TIMFLA+ +    L+   LY Y T L A +  + + LG F + E+    P+ G  +    ++F+ FV+LN+FI+++   F+  +   +  E + E+V  ++ K     G+
Sbjct: 1958 LPWWFVFVGWFLVAATSGVSAYFTMMYGLTYGKQKSISWLISMLVSFFESLFITQPVKVLGFAVFFALVLKKVDQEEYGDVPI------------DGNLPNSDDPDAVRFARRDSTCSFY-QPPPPSNIEKMRNNMIKEQKVFGLIREILIYMGFLWMLLLVAYGQRDPNAFYLTQHIQQSF-----SNGISDSMTHGEVF-QWANSTLLNNLFG----------QQPGFITDGNSKLVGNARLRQVRVQDGSCRVDRSMRNSVPDCHAPYSWDMEDLGSYGPGWNPSIDANLSKTLPTP-WQYQTQSRLRAHPIWGGVAVYRGGGFVVDLGPNRENASSSLQYLFENTWLDMFTRAIFVEFTVYNANVNLFCIVTLMFETTAVGAFQ--YRSELQSVRLYQSTGGLHIFVMASEVVYFLFIFYYMFQQGKLMKQQKWEYFRSKWNLLDMAIIILSWSALPVFIKRTLLGNQSIEYY-QNHKDEYAGFNETATADAVLGYIIAFLVLLATVKLWHLLRLNPKLHMITSTLQRAWNDISGFIVVMTIMFLAYSVACNLLYGWKLYSYRTLLNAAQTIVSLQLGIFNYEEVLDYNPVLGAFIVGSCIIFMTFVVLNLFISVILVAFSEEQIHHKPSE-EEEIVDLMLMKICSLFGV 2577          

HSP 2 Score: 228.409 bits (581), Expect = 7.005e-59
Identity = 135/383 (35.25%), Postives = 204/383 (53.26%), Query Frame = 3
Query: 7611 RELTPAEYDLYTRSNRPPVPYTISAQINNTFRVRIFSTGCYFNSNNFQGGWGTAGCVVGPLTTTKVTQCICNHLTSFASGWIVAPNTIDFDYVFSNF-DFTKNLTLFVTEXXXXXXXXXXXXWARRMDIKDIEKVGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVA*G-----------------PTKTTESVLTVGPFALTSREIWIGFVTNIISFVPLFVIIEMFRRSQLKH 8705
            R+LT  E  +Y    RP V   +++   + F   I +   Y++    +  W   GC VGP TT ++TQC+C HLT F S + V PN +D       F  F  N  +      + L ++ + IWARR DI+D  K+ +T L  ND    Y Y VT+ T  R  A TSS V   + G + E++P HL D  +P+ +RG VD FLL  P SLG LQ IRLWHDNS  G + +W+ N   V DL+T +K+HFL +SW A++  +  +D++  VA+  +L  F  +F  K   +  + H+W S+++RPP S FTRV+RV+                   PT  +E  + +G    T +++ IG  ++II F    +I+ +FR ++ + 
Sbjct: 1373 RDLT-VEVGVYFLLVRPVVEAGVNSSNTSVFITSIAAQCKYWDET--KTNWSDYGCRVGPRTTPQLTQCLCTHLTFFGSSFFVMPNLVDVSRTAELFATFVNNPVVVCFVGAIFLAYLLVVIWARRKDIQDTAKLKLTVLQDNDPLAEYRYLVTVTTGHRLGASTSSQVTVTILGSEGESEPHHLTDPHKPVFERGAVDMFLLTTPFSLGDLQSIRLWHDNS--GTHPAWFVNKVMVQDLETGQKWHFLCSSWLAIDVGECTLDKVFPVATEMDLKQFSNLFFMKTAKDFRDGHIWFSVISRPPSSNFTRVQRVSCCFSLLLCTMLTNIMFWGIPTDPSEQTMDLGKIEFTWQQVMIGIQSSIIMFPINLLIVSIFRNTRPRE 1750          
BLAST of PKD1L-1 vs. Ensembl Cavefish
Match: ENSAMXT00000006495.2 (pep primary_assembly:Astyanax_mexicanus-2.0:5:35007331:35041448:1 gene:ENSAMXG00000006274.2 transcript:ENSAMXT00000006495.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 311.612 bits (797), Expect = 1.342e-84
Identity = 201/675 (29.78%), Postives = 340/675 (50.37%), Query Frame = 3
Query: 8931 KRVIKRKLLPWWMRIIVWGFLTFLVIISVVFTTFYGIQFGDIACKKWISSMFISFFTSVLLTQPIKVVLLAIFFALVCKKSSSFXXXXXXXXXXXXXXXLGRRNALMQNEEFLHNELYSAPIKPHRFHV----------QPPPKEELEKAREIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTSNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDTPAPEFS---FKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANL-LGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFVVTKFIMWTGISETK 10913
            K+   +K LPWW   + W  +     +S  FT  YG+ +G      W+ S+ +SFF S+LL QP+KV+  A+FFALV K     +  +                      + L N++ +    P    +          QPPP  ++ K +EI +K+ + + +  EI  Y+ FFC LL   YS RDPNA+ L   +   F   SN     +    ++  + WA + L+ NL               GFI++ N++L+G A +RQVR +K+SC      +S   +C++ Y+   +D GSYG GWT+L  ++     F+   ++++  L   +  G + LY GGG+V     +  N  + +  L +N W+D  TRA+FIEFT YN N+NLF I T ++E+   G     YR E  N+ L   + G+    +  + +Y +FIL  +  + + + +QKW+YF   WN++E+ I++ S+ A + F+   +   Q   K+ Q   + + +F   A  +  LGY+ + +V LAT+K   ++R N ++ M+ + L     D+  F ++  IMFLA+ +V   LF   LY Y T + A  A + + LG F + E+    P+ G  +    ++F+ FV+LN+FI+++ + F+  +   +  E + E+V  ++ K   + GI   K
Sbjct: 1064 KKKCCQKGLPWWFVFVGWFLIAATSGVSAYFTMMYGLTYGKEKSISWLISLSVSFFQSLLLIQPVKVLGFAVFFALVVKSVDDDDEDDEEYI------------------KMLKNKVPAFSGDPDDVRISRRNSSCSFYQPPPPSDVGKMKEIWIKDQKAFALIWEILIYLGFFCMLLMAAYSQRDPNAFFLTRHIQQSF---SN---GISDSMSQQDVFIWANSSLLTNLFG----------QYSGFITDGNSKLVGTARLRQVRVQKSSCRKASSVRSSVPDCHAPYSWEVEDMGSYGPGWTSLIDSNMSKALFTPWQYQTQSRLRAHTVWGGMALYRGGGFVVDLEPDQQNSSSVLQYLFENAWLDIYTRALFIEFTVYNANVNLFCIVTLMLETTAVGAFQ--YRTELQNIRLFQTTDGIPT--LVSEAIYFLFILYYMFLQAKLMKQQKWEYFRNKWNILELAIILLSWSAFSVFIKKMVQGDQ-DLKYYQDHRNQFPSFYETAAADSVLGYLTAVLVLLATIKMWHLMRLNSKLNMITNTLQQAWSDISSFIVVIVIMFLAYSIVSNLLFGWKLYTYKTLIDAATAMVSLQLGIFNYEEILDLNPVLGAFIIGSCIIFMTFVVLNLFISVILEAFSQEQRHHKPSE-EEEIVDLMLLKICNFLGIKTKK 1698          

HSP 2 Score: 229.565 bits (584), Expect = 1.965e-59
Identity = 131/366 (35.79%), Postives = 200/366 (54.64%), Query Frame = 3
Query: 7743 NNFQGGWGTAGCVVGPLTTTKVTQCICNHLTSFASGWIVAPNTIDFDYVFSNF-DFTKNLTLFVTEXXXXXXXXXXXXWARRMDIKDIEKVGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVA*G-----------------PTKTTESVLTVGPFALTSREIWIGFVTNIISFVPLFVIIEMFRRSQLKHGHANKLRQAVENH---LQISLESKENK 8777
            +N +  W   GC VGP TT  VTQC+C HLT F S + V PN +D       F  F++N  +      V L++    +WARR D++D  KV VT L  ND    Y Y + I T  R  A TSS V   ++G   E++P HL D  +P+ +RG VD FLL+ P +LG LQ IRLWHDNS  G + +WY N   V DL+  +K+HFL +SW A++  +  +D++ ++A+  +L  F  +F  K   +L + HLW S+++RP  SRFTRV+RV+                   P+  +E  +T+G    + R++ +G  ++II F    +I+ +FR ++ +     K +Q   +    L+ +LE K++ 
Sbjct:  550 DNIKTNWSDYGCRVGPGTTRLVTQCLCTHLTFFGSSFFVMPNAVDVTRTAELFATFSQNPVVVCFVGAVFLLYFITVVWARRKDLQDQVKVKVTVLEDNDPLAEYRYLLVISTGHRRGASTSSQVTVTVTGSVWESEPHHLTDPDKPVFERGGVDMFLLSTPFNLGDLQSIRLWHDNS--GTHPAWYVNKVMVQDLENGQKWHFLCSSWLAIDMGECTLDKVFSLATETDLKRFSNLFFMKTAKDLFDGHLWFSVISRPANSRFTRVQRVSCCFSLLLGTMLTGIMFWGIPSDPSEQSVTIGSIKFSWRQLMVGIQSSIIMFPVNLLIVSIFRLARPR----KKTQQTASDQIPKLESALEDKKHS 909          
BLAST of PKD1L-1 vs. Ensembl Cavefish
Match: pkd2 (polycystin 2, transient receptor potential cation channel [Source:NCBI gene;Acc:103043751])

HSP 1 Score: 235.343 bits (599), Expect = 8.221e-63
Identity = 160/518 (30.89%), Postives = 256/518 (49.42%), Query Frame = 3
Query: 9333 EELEKAREIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKT----SNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYG-KGWTALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFV 10871
            E+ E +RE+ LK     +V RE   YI F  TL  +TY     N Y     ++ +F+ T     +P   F  ++  E FW +     +  +   VWYNN      +  I    N L+G   +RQV+    SC V +  K    +CYS Y+  ++D+  +G K  TA          + +  E  L   SY G +  Y GGGY      +      ++  LKDN W+D  TRA+F++F+ YN N+NLF I   +VE P +GG  T ++ +   L+  Y      F   C+V++ +F+L  +V+E+  I   + +YF   WN ++V IV  S  A+   +Y   A S    ++       Y NF  +A       ++ + IVFLA +K  K + FN+ +  L + ++  +KD+  F I+F I+FLA+  + Y +F + L  + TF        +I LG F F E+ +   + GPI F  +V F+  +LLNMF+AI+ D ++ VKAD+  Q ++ E+   +
Sbjct:  146 EDSESSREVYLK-----NVLRETVTYIFFLITLCIITYGMVSTNMYFYTKVMSQLFLDTPLSKGDPT-TFKTLSTMEDFWKYTEGPFLNGMYWDVWYNNKSLPENQSLIYY-ENLLLGVPRLRQVKVLNKSCPVHEDLKDEVYDCYSIYSPASEDKAPFGLKNNTA----------WVYSEENILGESSYWGEVATYRGGGYYQDLARSREESARQLKELKDNLWLDRGTRAVFLDFSVYNGNVNLFCIVRMLVEFPATGGAVTSWQFQTVRLV-RYVSSWDYFVGTCEVVFCLFVLYYMVEEVLEIRLHRLRYFKSLWNCLDVIIVTLSAPAIIMNIYRTSAVSNRL-RYLLENHSTYPNFQPLAQVQVQFNHLAAVIVFLAWVKLFKFINFNKTMSQLSTTMSRCAKDLLGFAIMFFIVFLAYAQLAYLVFGNQLNDFSTFQACIFTQFRIILGDFDFSEIEETNRVLGPIYFTTFVFFMFMILLNMFLAIINDTYSEVKADMAQQRSEMEITDLI 644          
BLAST of PKD1L-1 vs. Ensembl Cavefish
Match: pkd2l1 (polycystic kidney disease 2-like 1 protein [Source:NCBI gene;Acc:103031316])

HSP 1 Score: 216.083 bits (549), Expect = 6.613e-57
Identity = 160/506 (31.62%), Postives = 255/506 (50.40%), Query Frame = 3
Query: 9366 KELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKT-SNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFIS--NRNNRLIGYAVMRQVRTKKNSCAVF-DYAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFV 10871
            +EL +    RE+  YIVF   +  +TY       Y     +T++F+   S+    F  I   + FW++A   L+  L    WYNN  Q  Q G  S     N L+G   +RQ++ K  SC V  D+ + IS +C+  YN   +D+ S+G        N T    + + +EKEL G ++ G +  YSGGGY              +  L +N W+D  TRA+FI+F+TYN NINLF +   VVE P +GG    Y++    L+  Y      F I C++++ +FIL  IV+EI  +   K  YF   WN+++V I++ + +A+   V+  I   +L     +    +Y +F ++AF       M +  +F A +K  K + FN+ +  L S L   + D+  F I+F I+F A+  + Y LF   +  + TF        +I LG F +  + +   + GPI F  YV F+ FVLLNMF+AI+ D ++ VK ++  Q++D ++   +
Sbjct:  112 RELFVRTTLRELVVYIVFLVDMCLLTYGMTSSTTYYYTKVMTDLFVNAPSDSGVTFQSIGTMDDFWSYAQGPLLDGLYWTSWYNN--QSLQTGTHSFIYYENMLLGVPRVRQLKVKNKSCKVHKDFEEEIS-DCFDVYNEKKEDDSSFGL------INGTA---WQYHTEKELKGSNHWGMLATYSGGGYYQDLALTKEESAGVLANLNNNLWLDHGTRAVFIDFSTYNANINLFCVIRLVVEFPATGGAIPSYQIRTVKLI-RYITTWDYFIIGCEIVFCVFILYYIVEEILELRIHKLSYFKSIWNILDVVIIMLAIVAIVFNVFRTIKVDKLLGNLLKEPS-IYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCATDILGFAIMFFIVFFAYAQLGYLLFGTEVESFSTFHKCIFTQFRIILGDFDYDGIERANRVLGPIYFFTYVFFVFFVLLNMFLAIINDTYSEVKEELASQKDDLQITDLI 603          
BLAST of PKD1L-1 vs. Ensembl Cavefish
Match: pkd1a (polycystic kidney disease 1a [Source:ZFIN;Acc:ZDB-GENE-100707-1])

HSP 1 Score: 144.05 bits (362), Expect = 2.912e-33
Identity = 102/317 (32.18%), Postives = 159/317 (50.16%), Query Frame = 3
Query: 7617 LTPAEYDLYTRSNRPPVPYTISAQ--INNTFRVRIFSTGCYFNSNNFQGGWGTAGCVVGPLTTTKVTQCICN--HLTSFASGWIVAPNTIDFDYVFSNFDFTKNLTLFVTEXXXXXXXXXXXXWARRMDIKDIEKVGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAV--EENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERV 8549
            L+P EYD  T+ +   V    SA   +     V +F+  C + S   +  W T G V  PL  T   Q +C+  HLT+FA+   V PN + FD        +++L + +  +V  L +       R++D  D+ +  V PL   D   +Y YE+ + T     AGT+++V   L G +  +  RHL  ++     R ++D F +A   SLG +  IR WHDN  KG + +W   Y  V DLQT   + FLV  W +V  E+ DG+++     +   EL H+  + S +++  + E H+WLS+  RPP S FTR++R 
Sbjct: 2955 LSPLEYDT-TQDHYINVSGGCSADWPVRVQLEVGVFTALCQYFSEQARL-WQTDGIV--PLAQTSAGQAVCSTRHLTAFAASLFVPPNAVSFD-----MSPSRSLVVVLVCVVCVLCYAVAGAVMRKLDQMDLRRASVVPLCGKDG--LYKYEIQVKTGWSRGAGTTAHVGVSLHGSEGRSGHRHL--DRVGAFTRNSLDIFHIATDTSLGSVLKIRAWHDN--KGLSPAWLLQYVLVKDLQTGSSYFFLVEEWLSVDNEKTDGRVEIEAEASEEAELRHWPRLLSWELQRAVCESHMWLSLWERPPRSPFTRLQRA 3256          

HSP 2 Score: 70.4774 bits (171), Expect = 4.332e-11
Identity = 82/343 (23.91%), Postives = 157/343 (45.77%), Query Frame = 3
Query: 9915 GGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQI----ALGKFAF-LELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKAD-----IELQENDHELVKFVVTKFIMWTGISETK 10913
            GG+V +    + +  + +  L  + W    TRA+F+EF+ YN N +L A+ T ++E P S    +   ++  +L  L+ G   +  +   ++  IFI+   V+E     +Q   YF + WNL  +  ++ + +  A  +      ++L   F Q   + + +F  +A  N+ L  + + ++FL  LK    LRF R   + G  L  +  ++    +   ++ LA+  + + LF   L  Y T    + A + +    + G F++ L+           VF      +  VLL +  + L   +  V+A+     ++LQ  D+E+V+  + +  MW G+S TK
Sbjct: 3727 GGFVQELSRRMEDSRSLIQQLLSHQW----TRALFVEFSLYNTNTDLLAVFTLLLEFPVSERAQSSLDLKTCSLHTLHHGLDLSLFLTLLLM--IFIIYFSVREGVAAHRQGRSYFLRVWNLAGMCTLLLAAVVSALHLSRSALATRLWASFLQQ-RESFTDFFPLAQQNQVLTQLNATLLFLLVLKASHQLRFLREWAVFGRTLRRSVWELLAAALALLVLLLAYSHMGHLLFHSVLEGYAT---VSSACLYLLGSGSRGLFSWRLDGGSSSCSGSCFVFHVSFAVLRLVLLWLATSALLRNYHRVRAELYRPAVDLQ--DYEMVELFLRRLKMWMGLSRTK 4057          

HSP 3 Score: 65.855 bits (159), Expect = 1.366e-9
Identity = 120/563 (21.31%), Postives = 228/563 (40.50%), Query Frame = 3
Query: 2133 LLYYWDFGDNTTLNSTTRFVNHTFTVAGVYNSSVYVYNTLVSKVQNYLIYVKDAVKINFFNSSGVYNP-NVFASFILSMKSGTGFNCTLSGDGIANQTQPSNNLLFGWQWATEGSFNVRIDCYNELTRDYKTLVQVIQANITGLTFVN--FGG----AAFEQMQLRFSWLTGSNITFLLLVNNISYSLT---QNETAL--TGISQNITISAPGVLIGVIRATNLISDIILVANLTFSQKISNMNLIADKYYTTNGSAFNFYVNMSTGSGVRSVIQYG---DGQNNTNINYESPSVYWPGISVPYTYSNVGTYNVTVNCTNIVNSQTSSVVVYV---LTGLG-TYEIVYNNLFFKKNDLIQLSLNRTSGYPASMTNITINWQNGDITSIPFAAFNESAIYNYVYSANGVYNVTLTLQNPLSTVVKSILLSIIDPIINFRCVNVPANTWNGNQIQLQTLVDQGQNVIYTLNPGDGGALITKNINISXXXXXXXXXXXXXXVGNYTSNIWACNQLGCQNCSNYVQIQYKI------------------QSFDFQVQTNGNIEYLKT 3710
            +++ WDFGD   +   +  V H +  +G +N SV   N +        + V   ++    N+S V  P N    F   +  G     +          Q +  + + ++  + G FNV +   N ++    ++   +Q  + GL  V+   G     A    + L+ +   G+N++F       S++L    +N  AL  TG +  +    PG    +++ATNL+  + +   + F   +    L+ + +Y  N +A +   N +  + + S +QY    DG       +  P  +    S+ +T+ + G   VTV  +N V+ +TSSV + V   ++G+  T   V    F      + L  N  +G     ++++  W      ++P    +     +YV+   G + +TL   N +S+ V S    + D I          N   G  ++    V  G +V YTL+   G A +  N+          + + ++ V NY +N+ A NQ+  +  + ++ +   I                  ++F+ QV T   + YL T
Sbjct: 1443 VIHSWDFGDGAVVPGHS--VIHAYNTSGTFNISVVGKNEVSENKSEITVMVLAPIQGLSVNASHVNVPLNASVHFEAHLDQGDDVRYSWILCDRCTPIQGTQTMFYTFR--SVGMFNVIVTGENFISAAQASIFIFVQRELEGLQIVSDELGEECCFATNRVLHLQAALKEGTNMSF-------SWNLLREHENTAALNLTGKTIELNYLTPGPCEVILKATNLLGQLAVNRTIEFLDPVGR--LVLEAFY--NPTAIDTPTNFTVFTDIGSDLQYRWSVDG-------HPLPISF---ASILHTFDSPGLKRVTVEVSNRVSLETSSVSISVQEPISGVTFTATSVTEQNFVATGVSVSLHGNIQTG-----SDVSWMW------TLPNGKKSSQQSTSYVFPTPGTFTITLNASNDISSKVLSRDFFVQDRIQGLEFKASKQNVAVGENVEFTFAVSSGTSVSYTLSI-SGDATVHPNMT---------YVHQFSRVDNYYANLTASNQISSERKNLHICVMEPITKLTILDCCEEAIPVGIPKTFEAQVATGNPVTYLWT 1959          

HSP 4 Score: 56.6102 bits (135), Expect = 6.716e-7
Identity = 94/466 (20.17%), Postives = 184/466 (39.48%), Query Frame = 3
Query: 2133 LLYYWDFGDNTTLNS-TTRFVNHTFTVAGVYNSSVYVYNTLVSKVQNYLIYVKDAVKINFFNSSGVYNPNVFASFILSMKSGTGFNCTLS-GDGIANQ-TQPSNNLLFGWQWATEGSFNVRIDCYNELTRDYKTLVQVIQANITGLTFVNFGGAAFEQMQLRF-SWLTGSNITFLLLVNNISYSLTQNETALTGISQNITISAPGVLI------GVIRATNLISDIILVAN----LTFSQKISNMNLIADKYYTTNGSAFNFYVNMSTGSGVRSVIQYGDGQNNTNINYESPSVYWPGISVPYTYSNVGTYNVTVNCTNIVNSQTSSVVVYVLTGLGTYEIVYNNLFFKKNDLIQLSLNRTSGYPASMTNITINWQNGDITSIPFAAFNESAIYNYVYSANGVYNVTLTLQNPLSTVVKSILLSIIDPI----INFRCVNVPANTWNGNQIQLQTLVDQGQNVIYT 3476
            ++Y WDFGDN+++ +   R V H +   G Y   V V NT+ S      + V + ++     +S     N       ++++G     T + GDG      +P        ++  +G++ V +   N ++  ++  V  +   +  + ++   G   E+  + F ++++G+             S  Q   +    + N+T      ++      G    T L+S     AN    +     ++N+ L   + +   G    F V          +  +G        +Y+ P      +S  +TY + G Y VTV   N ++    +V + V   +G   I +N         + L  + T    +   N+  +W  GD   +P      S I  + Y+ +G +N+++  +N +S     I + ++ PI    +N   VNVP N      +  +  +DQG +V Y+
Sbjct: 1102 IIYTWDFGDNSSIQAGRERRVYHEYKYGGTYTVWVNVNNTVSSMDSCKEMMVYEDIEGLKVEASPCTELNTLTVVTATLEAGNNVTWTFAMGDGTEKSGVEPR----MEHRYIKDGNYTVNVTATNAVSSKWE--VVHVHVFVLQVLWLEPAGCVQEKTDINFHAYVSGNK------------SAHQYVWSFGDGTPNVTHRGTPSIVHSYDSSGTYHLTLLMSSTANKANFFNWICVQPAVTNVTLEPSRRHIKLGEESQFTVTALPDFDYTYLWDFGLK------DYKGPIQGKDKMS--FTYKSPGLYMVTVTVLNNISYSNCTVQIEVQQLVGLLLIQHNG---SMGHNLTLGQDYTFSSSSDSANVIHSWDFGDGAVVP----GHSVI--HAYNTSGTFNISVVGKNEVSENKSEITVMVLAPIQGLSVNASHVNVPLNA----SVHFEAHLDQGDDVRYS 1528          
BLAST of PKD1L-1 vs. Ensembl Sea Lamprey
Match: pkd2l1 (polycystic kidney disease 2-like 1 [Source:ZFIN;Acc:ZDB-GENE-030616-558])

HSP 1 Score: 241.891 bits (616), Expect = 1.684e-67
Identity = 149/497 (29.98%), Postives = 245/497 (49.30%), Query Frame = 3
Query: 9387 VFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTS-NP--NWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKF 10868
              RE+  Y+VF   L  +T+   + N Y     + ++F+++  +P     F  I+  + FW      ++  L    WYN D       FI    N ++G   +RQ++ +  SC ++   ++I   CY  Y+   +D+ ++G+G             + + SE+EL+G S+ G +  YSG GY        +     +  LKD  W+D  TRA+FI+FTTYN NINLF +   VVE P +GG    Y+     L+  Y      F + C+V++  FIL  +V+E   +     KYF   WN +++ +++ S +A+   +   IA S L         ++Y +F Y+AF       M++  VF A +K  K + FN+ +  L S L   +KD+  F ++F I+F A+    Y +F   +  + +F+       +I LG F F  +     I GPI F  Y+ F+ FVLLNMF+AI+ D +  VKA++   ++D E+  F
Sbjct:   30 TLRELIIYVVFLIDLCLLTFGMMNTNTYYYTKVMMDLFVESPVSPIDGTNFNSISSMDDFWKVVQGPVLDGLYWEKWYNGDQLPVNLSFIQ-YENVMLGVPRVRQLKVRNGSCTIYPLFRNIIPGCYDGYSCGEEDKETFGRG---------TGTAWKYWSEEELSGSSHWGLLAQYSGAGYYRDLSRRKNESAPMLQELKDYLWLDHGTRAVFIDFTTYNGNINLFCVVRLVVEFPLTGGALPSYQFRTVKLIR-YVSAFDYFIMACEVIFCCFILYYVVEECLELRLHGMKYFKSVWNCLDIIVIVLSMVAIIFNICRTIAVSNLLGALLN-DPNIYADFEYLAFWQTQFNNMLAINVFFAWIKIFKYVSFNKTLTQLSSTLARCAKDVLGFAVMFFIIFFAYAQTGYLVFGSQVEDFSSFVNCIFTQFRIILGDFDFHAIENANRILGPIYFTTYIFFVFFVLLNMFLAIINDTYTDVKAELADTKDDFEIGDF 514          
BLAST of PKD1L-1 vs. Ensembl Sea Lamprey
Match: pkd2l1 (polycystic kidney disease 2-like 1 [Source:ZFIN;Acc:ZDB-GENE-030616-558])

HSP 1 Score: 222.246 bits (565), Expect = 5.787e-60
Identity = 150/497 (30.18%), Postives = 251/497 (50.50%), Query Frame = 3
Query: 9387 VFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTS---NPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVF-DYAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLL--NMFIAILYDGFAVVKADIELQENDHEL 10859
              RE+  YI F   L+ +T+       Y+    + N+F++ +   N +  F  I   + FW      ++  L    WYN+ P +  + FI    N L+G   +RQ++ + +SC V  D+ K + + CY+ Y+   +D+ S+G       A  TP   + + +  ++NG S+ G +  YSGGGY      + S     +  L D  W+D  TRAI I+F++YN NINLF++   +VE P +GG     ++    L+  Y  G   F + C+ ++  FIL  IV+EI  +   K+ YF   WN +++ +++ S +A+   VY  +  ++L +       + Y NF ++AF       MV+  VF   +KF K + FN+ +  L S L   +KD+  F ++F I+F A+  + Y LF   +  + TF        +I LG F F  +     + GP+ F  YV  + FVLL  NMF+AI+ D +A VK ++  +EN+ ++
Sbjct:  116 TLRELFVYIAFLINLIILTFGMTSDLMYKYTLAMDNLFLQNTVSPNDSVNFNSIFTFDDFWKVVQGPVLNGLYWEKWYNDIPLVENQSFIY-YENFLLGVPRIRQLKVRNDSCTVHADFQKDV-QGCYAAYSEDAEDKASFG------PATGTP---WKYSTSSDMNGSSHWGLLATYSGGGYYLDLTRSKSESAILLQDLFDKQWLDRGTRAILIDFSSYNGNINLFSVIRLLVEFPPTGGAVPSSQIYTVKLI-RYVTGSDYFILACEGIFCCFILYYIVEEILELSIHKFAYFKSVWNCLDLLVIMLSVVAIIFNVYRTVTVNKLLKALLDEP-NRYGNFQFLAFWQTQYNNMVAVNVFFCWIKFFKYVSFNKTMTQLSSTLARCAKDVLGFAVMFFIIFFAYAQLGYLLFGTQVEDFSTFSNCIFTQFRIILGDFDFNAIENANRVLGPLYFTTYVFVVFFVLLPKNMFLAIINDTYAEVKNELAEKENEFDV 599          
BLAST of PKD1L-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007306.1 (pep scaffold:Pmarinus_7.0:GL480012:400827:419749:1 gene:ENSPMAG00000006595.1 transcript:ENSPMAT00000007306.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 181.03 bits (458), Expect = 9.256e-46
Identity = 127/451 (28.16%), Postives = 205/451 (45.45%), Query Frame = 3
Query: 7839 FASGWIVAPNTIDFDYVFSNFDFTKNLTLFVTEXXXXXXXXXXXXWARRMDIKDIEKVGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVA------------------*GPTKTTESVLTVGPFALTSREIWIGFVTNIISFVPLFVIIEMFRRSQLKHGHANKLRQAVENHLQISLESKENKGYQGSTATLVRNEDVNSRPTTPSYRSTDQINIQIPEYEVENQDSDANEKYKKRVIKRKLLPW---WMRIIVWGFLTFLVIISVVFTTFYGIQFGDIACKKWISSMFISFFTSVLLTQPIK 9128
            FA+ + V PNTIDF  VF+ FD   N  +F T I + L++  + ++ARR D +D +   + PL  ND +  Y+Y ++I T +RA AGT S VYF +     +T  R L +       RG+   F + VP   G  + I +WHDNSG G   SW+  +  + D+  K+ F F  + W A E  DGQ+ R + VA    +     VFS  ++  +++DH+W+S+  RP  S F+RV+R++                   GP+  +++V  +GPF L+  E+ IG ++N+I F   FVI+ +FRR               + +   +L   E  G         R   +  R T  ++                                 K + W   ++ ++  GF T L          Y +++G      W+    +SFF S+++ QP+K
Sbjct:    1 FAAEFFVPPNTIDFATVFAKFDLRSNAAVFTTVIAILLLYFLLLLYARRADRRDKDNWKIRPLVDNDDSHAYVYLLSIVTGMRAGAGTQSRVYFTVHFSLGDTGTRILHNGHLKGFSRGSTVTFEMTVPYYWGEPKNITIWHDNSGPGGQGSWFLRHILLHDIHAKQTFAFPCDRWLAAEFEDGQLCRELPVAGFQFVPSTGMVFSSTVQSKITDDHMWVSVFMRPTRSAFSRVQRISCCVSLLFLTMVTNAMWFETGPSTGSDNV-QIGPFTLSLSEMLIGLMSNLIVFPISFVIVAVFRR---------------QTYSPATLRFFETHGKGEGDPGPWRKPPLCRRITATAF--------------------------------YKFVAWSLVFLSVVTSGFFTIL----------YSMEWGPDKANLWLRVFIMSFFQSIIIVQPVK 393          

HSP 2 Score: 144.821 bits (364), Expect = 1.490e-34
Identity = 114/482 (23.65%), Postives = 225/482 (46.68%), Query Frame = 3
Query: 9393 REIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTSNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLY-QRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKS-ISKNCYSTYNIFNQDEGSYGKGWTALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVE-SPGSGGMWT-----IYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVF-IVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGF 10811
            R++  +++    L+F+TY  RDP A+ ++N + N F+  S  +                 N  +PN     WYN +   + +R ++ + +   +G   +RQ+R+   +  +   A + ++    + Y +  +     G+G T           FS +  + +    +   + LYSGGG++ +   N+++    +  L    W+D  TRA+  EFT YN N +LF   T ++E S G+G         ++R+E       + G ++       +++ I +++I   E   + +    YF  FWN+ E+  I +G+   V  F+ + +AT  L EKF +     ++NF  +   ++ L  +++ +VF++T+K +  ++  R+  +L    +     ++ F +I  ++F +F  +   LF  SL  Y TF    E    + LG+  + ELY    + GP+++  +     FV++N  + IL +GF
Sbjct:  613 RQLILFLMHAALLVFITYRGRDPYAFLVQNSVRNAFVLNSFDH-----------------NGFLPNFYPRAWYNGERMSWRERYYLRDFSTIRVGPGRLRQIRSVPRAWNLLLSAPTAVATLSRAPYVVAARANQRCGEGTTQRKRAVRQYQIFSHRVTQLVP--VWHPSLALYSGGGFIAELGLNLADGTEIVANLSSASWLDHSTRAVLTEFTGYNMNTDLFCSVTLLLEFSQGAGDAHGHAYIHVFRIES------FVGKLETLTGVVYIVFAILLVIIAATEALRLSELGVAYFKSFWNIAELLSITLGAASVVTYFIKMSVATRTL-EKF-RTDPHKFVNFQELVTWDQQLSELLATLVFVSTIKVLGHMKSLRQFEVLVGAFSEARDHIQGFAVIVVVVFCSFGQLTSLLFAGSLRNYRTFTTCLEQLFSLLLGQPGYGELYAANRVLGPLIYFAFTSVNTFVIVNFSLGILSEGF 1067          
BLAST of PKD1L-1 vs. Ensembl Sea Lamprey
Match: pkd2 (polycystic kidney disease 2 [Source:NCBI gene;Acc:432387])

HSP 1 Score: 158.303 bits (399), Expect = 2.171e-39
Identity = 127/509 (24.95%), Postives = 228/509 (44.79%), Query Frame = 3
Query: 9387 VFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIF----IKTSNPNWQFTGITREEQFWTWALNVLVPNLRAPV-W--YNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSC-AVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNV-SNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFVVTKFI 10886
              RE   + VF   L  V YS R P AY+  + ++ +F    +  ++P   F  +   EQ W     V    L  P+ W  +N+  +      +S   N ++   ++ Q R   NSC ++     + +  CY  Y+  N+++  +G       AN T    + F SE    G+ + G +G Y  GGY  +  ++  +  + E+ AL+D  W+D  TR + ++    NPN+ L+ +    +E P +GG+ T   + P   LG      +A       L  I+ LV  V E+RN+      + +  W  +++ I+    +  A  V+  I +S L  + +      +   + VA   +N   +   IVF+A +K ++     R + M G  L   + D+  + ++F  +FLAF  + + +F  +L  + +F       ++I LG F F  L     I GPI F  YV  +  +++ MF+AI+ + ++  K+     E  H   +F ++  I
Sbjct:   22 AIREAVTFSVFLALLCVVAYSSRIPLAYEYTHAVSEMFTSSPLSNADPT-TFHNLATIEQVW----QVFHGYLTGPLLWALHNSGSRNLTNSMVSG-ENLVVEPVIIWQARVHNNSCWSLSTNLGTGTTECYGPYSSANENKDPFGP------ANST---VWRFDSEA---GVPWQGALGWYGPGGYAVRLPADSRTAAWQELAALRDASWLDRATRLLSVDAALLNPNLRLYMVVRLSMEFPPTGGILTALSLTPGRPLGTPLWDARAVCGLLAALLTIYYLVEEVLELRNLGPAG--FLSSPWTFLDISIIALCVVGTAFGVHHGILSSSLLGEASSSRAMSFSTVSTVAEWEQNFIIVTGVIVFVAWIKVVRFGSMCRTLTMCGCALTRCAWDLLGYTLVFATVFLAFAQLAFLIFGGALPDFSSFSSCILTQVRILLGDFDFSSLEAASRIMGPIYFVSYVFCVGLIMMVMFLAIVSEAYSEEKS-----EQAHSQPQFQLSSVI 505          
BLAST of PKD1L-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010654.1 (pep scaffold:Pmarinus_7.0:GL477016:137097:160647:-1 gene:ENSPMAG00000009641.1 transcript:ENSPMAT00000010654.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 142.124 bits (357), Expect = 1.739e-33
Identity = 84/268 (31.34%), Postives = 133/268 (49.63%), Query Frame = 3
Query: 7752 QGGWGTAGCVVGPLTTTKVTQCICNHLTSFASGWIVAPNTIDFDYVFSNFDFTKNLTLFVTEXXXXXXXXXXXXWARRMDIKDIEKVGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDR-LIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVA 8552
            +G W   GC       +    C C+HLT+F +      ++     V S     +NL      ++   + +  F   RR D  D  K G  PL  N  +D  LYEVT++T  RA AGT++    IL GE   ++ R L    +P+ +R +   F+++VP SLG +  + LWH+N  +G + SW+ +   V DL +   + F    W A E  DG+++R L+A++     L F  +   K+   L + HLW S+ +RP  SRFT  +R++
Sbjct: 1602 EGSWRPDGCETATALQSNRVNCSCDHLTTFTAVASRVASSPSQTPVLSFIRPLENLFPCAVVLLALALAVPGFALCRRWDRHDEHKAGAIPLQDNLPSDRQLYEVTLETGFRAGAGTTAKANVILHGEHGTSETRELHCEDKPLFERNSTHTFIMSVPDSLGPIWKLHLWHNN--RGASPSWFVSRVTVRDLWSGSAWLFPAECWLAAERGDGRVERELLALSGA---LRFTALLYSKVTAYLEDFHLWASVYSRPSCSRFTHTQRLS 1864          

HSP 2 Score: 50.8322 bits (120), Expect = 7.226e-6
Identity = 49/177 (27.68%), Postives = 77/177 (43.50%), Query Frame = 3
Query: 2982 GISVPYTYSNVGTYNVTVNCTNIVNSQTSSVVVYVLTGLGTYEIVYNNLFFKKNDLIQLSLNRTSGYPASMTNITINWQNGDITSIPFAAFNESAIYNYVYSANGVYNVTLTLQNPLSTVVKSIL-LSIIDPI-INFRCVN----VPANTWNGNQIQLQTLVDQGQNVIYTLNPGDG 3494
            G  V + Y++ G YNVTV   N+V S  ++  + V   +    I   + +F     +  S+      PA   ++T  W  GD T  P       A Y+Y Y+    YNV++   N +S  V ++L L +  P+ IN   VN    VP     G  +  Q  ++    + Y  + GDG
Sbjct:  139 GPQVQHMYASTGLYNVTVVAYNLVGSLNATAQLSVQNAMHAVMIETTSKYFAVKSTVSFSV-----IPADTVSVTFEWHFGDGTD-PVTVRLPYATYSYEYARR--YNVSVRACNGISCTVSNVLSLEVQQPVAINSLMVNGTKRVPG-LLLGRPVTFQIFMNSNSALRYNWSFGDG 306          
BLAST of PKD1L-1 vs. Ensembl Nematostella
Match: EDO44884 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUD7])

HSP 1 Score: 563.148 bits (1450), Expect = 1.486e-172
Identity = 363/1110 (32.70%), Postives = 569/1110 (51.26%), Query Frame = 3
Query: 7665 VPYTISAQINNTFRVRIFSTGCYFNSNNFQGGWGTAGCVVGPLTTTKVTQCICNHLTSFASGWIVAPNTIDFDYVFSNF-DFTKNLTLFVTEXXXXXXXXXXXXWARRMDIKDIEKVGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKR--PILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVA*G-----------------PTKTTESVLTVGPFALTSREIWIGFVTNIISFVPLFVIIEMFRRSQLKHGHANKLRQAVENHLQISLESKENKGYQGSTATLVRNEDVNSRPTTPSYRSTDQINIQIPEYEVENQDSDANEKYKKRVIKRKLLPWWMRIIVWGFLTFLVIISVVFTTFYGIQFGDIACKKWISSMFISFFTSVLLTQPIKVVLLAIFFALVCKKSSSFXXXXXXXXXXXXXXXLGRRNALMQNEEFLHNEL--YSAPIKPHRFHVQPPPKEELEKAREIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTSNPNWQFTGITR-------EEQFWTWALNVLVPNLRAPVWY---NNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTALSAND---TPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANL-LGLYS--GGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFVVTK 10880
            V Y IS Q+           GC +  +  Q  W T GC VGP T++  T C+CNHLT F S   V PNT+D   + +N  D  +   +     ++  ++    +WARR D  D  KVGV   PSN     YLYE+ +    R  AGT++NV   L G+Q ++ P  L D+ R    L RG+ + F++    +LG L YIR+WHDN+G   N + +     V D  T + +HFL N WFAV+E DG IDR++ + S +EL HF+ +F  K K +L++ HLW SI+ RPP+S FTRVERV+                   PT +   V  +GP   +  ++ IG +++++ F    VI+++FR  + K     +L  + +   ++ + S          + ++ +ED+++  + PS  S               + S  + K  K   K K LPWWM  I W  +T  V+ S V T  YGIQFG    +KW+ SMFIS    + ++QP+KV+LLA+FFA V KK  S        ++    NEL  +  L Q  +   N++    AP  P    +     + LEKAR+   KE +M  +  +I  Y+ F   LL + +S  D  AY     ++++ +KT+  +   +G+T+       + + W W  +VL+P L    WY      P+L + G        ++G+A  RQ+R KK++C +    + +  +C   Y++  QDE +Y   W   + +D   +P+  +SF S  +LNG  Y G I  YSGGGY+  F S       E+   ++N WID  T  +F EFT YNP  NLF  +T +VE   +GG    + V P      LYS  G    F + C V++ +F      +E++ + K K  YF  +WN  E+ I++ ++IAVA + ++ +   + T K  Q   + Y NF Y++    +   ++  +VF++T+KFIK+LRFN+++ +L   L+ ++KD+  + I+F I+FL+F   +Y L       + TF+ + E  + + LG+F+F E      I G   F  Y+    F+LLNMFIAI+ + F  VK   EL  N+ E+++F V +
Sbjct:    5 VVYNISLQV----------VGCMY-WDEVQENWSTRGCRVGPNTSSSRTHCLCNHLTWFGSKIFVPPNTLDLSLIRANIQDPAQYAAVVSVMCIIWGLYAIGVVWARRQDKNDALKVGVHFSPSNRPGSRYLYEIVVCVGTRRRAGTTANVAIKLYGDQQDSQPFLLDDSNRNSTPLSRGSNNSFIVTTSEALGQLSYIRVWHDNTGS--NPALFVKKVIVRDHVTGDTWHFLCNRWFAVDEGDGMIDRVVPMTSQEELKHFKTIFMDKTKKDLTDSHLWFSIVWRPPDSNFTRVERVSCCLSFLLCTMMANAMWYEVPTGSNTQV-DIGPVQFSWEQVSIGIMSSMVVFPINLVIVQIFRNCKAKKNRGKRLLGSPKGGNRVCVTSN---------SKILHHEDIDTHISLPSDTS---------------RTSFWSNKRSKNPKKIKSLPWWMTYIGWLLVTLTVLASTVVTLMYGIQFGKHTSEKWLLSMFISVTHDIFISQPLKVILLALFFAYVLKKPPS--------DQNNNANELDSKELLQQCNKRDTNDVIDVEAPSVP----LGALSNDALEKARDRNDKERKMSVILTDIGTYLTFLWVLLVIAHSRVDSAAYWQSRSISDVLMKTTYESPPESGLTKTFQKISNDSEIWLWTNHVLLPALYNLDWYYYTKTAPKLVRGG-----AGLVVGFARWRQLRKKKDTCLITGVMRGVIHHCTDPYSMSTQDETNYNSRWRPFNTSDVPPSPSTIWSFNSASKLNGYPYFGEISTYSGGGYIVPFSSIYYKAVKEIKHARNNSWIDRYTAGLFTEFTLYNPYSNLFTASTVLVEVLPTGG----FHVRPEFFTFRLYSLVGDFHIFTLVCDVVFLLFTSYFTFRELKKLYKDKCSYFRDYWNWAEIVIMVLAWIAVADY-FICLGIRKWTLKLHQENPNDYTNFQYISAWQMSFESILGILVFISTIKFIKLLRFNKKMFLLAYTLSRSAKDLAHYGIMFLIVFLSFAQFYYLLLGSDYDSFSTFVKSIEKLINVLLGRFSFEEFLIPFRIMGAFGFFLYMTLTNFLLLNMFIAIIVESFTEVKLSPELARNEFEIMEFTVER 1054          
BLAST of PKD1L-1 vs. Ensembl Nematostella
Match: EDO44744 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUR6])

HSP 1 Score: 559.296 bits (1440), Expect = 1.821e-170
Identity = 346/1143 (30.27%), Postives = 566/1143 (49.52%), Query Frame = 3
Query: 7680 SAQINNTFRVRIFSTGCYFNSNNFQGGWGTAGCVVGPLTTTKVTQCICNHLTSFASGWIVAPNTIDFDYVFSNF-DFTKNLTLFVTEXXXXXXXXXXXXWARRMDIKDIEKVGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVA*G-----------------PTKTTESVL-TVGPFALTSREIWIGFVTNIISFVPLFVIIEMFRRSQLKHGHANKLRQ--------------AVENHLQISLESKE------------NKGYQGSTATLVRNEDVNSRPT---TP-SYRSTDQINIQIPEYEVENQDSDANEKYKKRVIKRKLLPWWMRIIVWGFLTFLVIISVVFTTFYGIQFGDIACKKWISSMFISFFTSVLLTQPIKVVLLAIFFALVCKKSSSFXXXXXXXXXXXXXXXL--------GRRNALMQNEEFLHNELYSAPIKPHRFHVQPPPKEELEKAREIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTSNPN----------WQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGS-YGKGWTALSAN-DTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKY-FTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFVVTKFIMWTG 10898
            S  +N TF    +S+ CYF  +   G W + GC VG  T+ +VT C C+HLT F +   + PN ID      NF +F ++  L  T   +  +++   IWARR D+KD  KVG+  +P +D +D+Y YEVT+ T     A T+SNV  I+ GE  E+    L D+   + + G +D F +  P  LG L YIR+WHDN+G   N SWY N   V ++ + E+F+FL   WFA +E DG++DR++ VA  +EL  F  +F  K   + S+ HLW SI  RP  S FTR +RV                    P    E V+   G   +T  E+ IG  ++++ F    +II++FR ++ +  H +   +              A+++   ++ E+ +            +  Y+       +N D   RPT   +P S  S D ++   P ++   + +    K  K  + + LLPWW   + W         +  FT  YG+ F       W+ SMF S    + ++QP+KV+  A+ FALV KK    N+ +  +E  +    L         RRNA+  +             KP      PP    L++AR  R KE +M++V +EI FY +F   +L V Y  RDPNA+ +   L ++F   +  +          +Q + IT    FW W   VL+P L +  WYN      + GF+++  + ++G A MRQ+R K   C V D        C   Y+   +D    +  GW    +N  T    + ++   EL  + Y+G++ LYSGGGY +            +  LK + W+D  TRAIF+EFT Y+P  NL  +   ++E   SGG  + +       +  Y+G    F + C++L+ +F +    K+ + I ++   Y F ++W+ +E+ +   S+ ++  + +V+   ++ T         V++NF  +A  ++  GY+ +F+ F  +LKF+++ RFN+R+ +L + L  ++K++  F I+F ++F+AFV   Y +F   LY +HT L   E  + + LGKF++  L Q   +  P +F  Y + ++F+L+NMFI+I+ + F  VK+  +LQ N++E+V F+  +F  W G
Sbjct:    5 SGAMNYTFGA--YSSCCYF-WDEAGGMWSSQGCEVGRNTSRQVTHCKCSHLTWFGAKLFIPPNAIDLSSAIKNFANFDESPALLATFCAILGMYLVALIWARRRDLKDTSKVGLVAVPDSDISDLYRYEVTVYTGRGKAAATTSNVTLIMCGELGESQAVTLTDDNSEVFQAGGIDSFFVTTPNPLGALCYIRIWHDNTGS--NPSWYLNQVAVRNIDSNERFYFLCYRWFACDEGDGEVDRVLPVAGKEELAQFMYLFRSKATRDFSDAHLWFSIALRPCRSLFTRTQRVTCCLSLLLCTMLANVLWYQVPQSQKEDVIFESGFIRITWHELLIGIQSSLLVFPINLLIIQIFRNTKPRPLHKDDSCEVKSICSRSVTTPAIALQDITTVTRETPDVVKSWTHSERRLDSPYKQRRGEEKKNLDTIERPTEQPSPVSIESFDYVDGAKPLFKSPAEANARKSKKAKEHVGKVLLPWWFVYVGWALCLLTACTAAFFTMLYGLTFDKPKQHAWLISMFFSLVQDIFISQPLKVLGFALVFALVLKKPQGENDEKLNSELAKDRQWLEEHVGQRDKRRNAISND-------------KPKYL---PPDPSALQRARLQRFKERKMFEVIQEILFYALFVWVVLVVAYGHRDPNAHVMNQGLEDVFSGRAKHDHSVPDGHSLLFQVSDIT---SFWNWTEAVLIPGLYSESWYNGRSD--KPGFLADHTSWMLGTARMRQLRVKAGDCKVHDVYSGYLAQCNGPYSWDTEDTTPVFRPGWRPAPSNYSTAQNAWKYRDSSELRSLPYLGKLALYSGGGYAFDL-GKKEKAMAMLAQLKRDKWVDRSTRAIFVEFTVYSPYTNLHCVGYLLLEVLPSGGT-SPFSELLVTRIDRYAGNFMIFVLLCEILFVLFTVYFTYKQGKEIAREGVAYHFHEYWSWVELVLSGCSWTSIVLY-FVRFGINKSTVLTYHKDTSVFVNFHALAASDQVFGYVYAFVAFFVSLKFLRLFRFNKRMSLLATTLKCSAKELAHFSIVFGLVFMAFVHFCYLIFSTELYIFHTVLSTVETLISVMLGKFSYERLLQTNRLLAPFMFFFYSIVVVFILINMFISIIIENFQRVKSQNDLQSNEYEIVDFMTEQFRDWLG 1118          
BLAST of PKD1L-1 vs. Ensembl Nematostella
Match: EDO49200 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHB8])

HSP 1 Score: 542.732 bits (1397), Expect = 8.923e-165
Identity = 349/1156 (30.19%), Postives = 559/1156 (48.36%), Query Frame = 3
Query: 7701 FRVRIFSTGC-YFNSNNFQGGWGTAGCVVGPLTTTKVTQCICNHLTSFASGWIVAPNTIDFDYVFSNFDFTKNLTLFVTEXXXXXXXXXXXXWARRMDIKDIEKVGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVA*------------------GPTKTTESVLTVGPFALTSREIWIGFVTNIISFVPLFVIIEMFRRSQLKHGHA-NKLRQAVENH-----LQISLESKENKGYQG-----STATLVRNEDVNSRPTTPSYRSTDQIN-----------IQIPEYEVENQ-DSDANEKYKKRVIKRK------------------------LLPWWMRIIVWGFLTFLVIISVVFTTFYGIQFGDIACKKWISSMFISFFTSVLLTQPIKVVLLAIFFALVCKKSSSFXXXXXXXXXXXXXXXLGRRNALMQNEEFLHNELYSAPIKPHRFHVQPPPKEELEKAREIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTSNPNWQFTGITREE--------------QFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDTP--------APEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFVVTKFIMWTGIS 10904
            + +R++S+ C +F+  N    W   GC VG  T      C CNHLT F S + VAPN IDFD VFS  D ++N  +  T   +  +++   I+ARR D++D +K G TPLP+N       Y ++I T +R NAGT+++V  +L+GE+ E+ P  L D  RP+  RG  +  +L +P SLG L ++R+WHDN G   + SWY +   V ++ TKE+++F+   W AVEE+DG++DR++ +AS  EL HF  +F  K    L + HLW SI+ RPP+S FTRV+R++                   G       V+ +G  +   R++ IG  +++I F   F ++ +FR  + +     NK +    +       ++ +   E   Y+        A+++  E          + S D+             ++  E E E++ D+   E+ + R  K K                        L P W R + W       +    FT FY + +G     KW+ +  +SFF SVLL QPIKV+  +I FAL+ KK    +  E   +E            L++  E   +E+   P  P   H        L  AR+ RLKE+QM  + +EI  Y +F   LL V Y  RDPNAY L+  L   F+         +G++ +E                W WA   L+ NL     YN  P  Y  G++ +R N L+G + +R  R K  SC +          CY  ++  N D   Y   W  L+ +  P        A +FSF       G  Y G++  YSGGGY      +     T +  L  ++W++  TR +FIEF  YN N NLF +    VE   +GG +     + A L   Y G    F +  +V+  +F+   + +E++++ K K KYF  FWN +EV +++  F+ + G  + ++           +    +++F Y    +E L Y++  +VF  T++FIK+LRFNRR+ +LG+ +   +K + QF I FT++F++F      +F   L ++ +F       + I LG F +LE+ ++  + G I F  ++ FI+  L+NMF+AI+ D F+ VK   +  +N++E+V+F++ +F    GI+
Sbjct:    1 YSIRVYSSNCLFFDEKNMT--WVNNGCEVGNRTRIWKVHCECNHLTDFGSDFFVAPNPIDFDKVFSA-DLSENFLVITTVCGLFGLYLIAVIFARRADLRDKKKTGATPLPTNAPPGSTSYLLSIHTGVRQNAGTTADVSIVLTGEEGESQPTVLKDPSRPLFTRGADNNLVLTLPNSLGKLTHVRVWHDNDGS--SPSWYLSRISVENMNTKERWYFICERWLAVEEDDGRVDRILPIASKQELTHFNHLFVSKTVKELGDGHLWFSIVTRPPQSVFTRVQRLSCCLSLLYCTMITSCMFYNTGGETNENYVIHIGSLSFDLRQMIIGLQSSLIVFPVNFALVHVFRSIRKEENEPVNKFKDVTADEGFDEISEVPISEAEQNEYEDVINKPEKASIIGEEQEAVEDKGKDFGSDDEPGSVSIGDDGTDLVKNDELEPEDKVDNSTQERAENREDKVKIDPGANDKPSENSQGKEEKKKKKGLHPNW-RYLAWTTFVLSTLACSTFTVFYSLSWGPELANKWLLAFVMSFFQSVLLIQPIKVLCASIIFALIIKKPVDVDEEETELKEVPKHMREKSVQDLLREMEDEEDEIKKGP--PDALH--------LLAARQKRLKEIQMSMILKEILAYFIFIAVLLLVAYGNRDPNAYLLRKTLVEEFVSLDE-----SGVSLDEVQWKNGTIIVGDGDSLWHWARETLIKNLYPGNLYNGKPDKYT-GYLEDRVNYLVGISRLRLERVKNGSCTIPKEMDRFFDECYGEFSYSNSDSDDYEVEWMFLNKSAAPSARKRRSIAEQFSF-------GFPYWGKMNFYSGGGYPADLGYDYPTALTVVADLHSHNWVNSNTRGVFIEFAIYNANTNLFGVAFLYVEFLPTGGAFPHGEFKVARLYS-YVGPFANFVLAMEVIMLLFMFYFVYREVKSMYKLKKKYFKGFWNWLEVAMIVLEFLML-GLFFARMWEVDKNFIELHHNPKDFVSFQYALASDETLNYVIGILVFFVTIRFIKLLRFNRRMALLGNTIALIAKPIGQFLISFTLVFISFAFFGNMIFGIGLDKFRSFTTTMMTQLNICLGDFDYLEMEEENRMLGRIYFFSFMYFIVMYLMNMFLAIINDSFSEVKTSNDDLKNEYEMVEFILDRFKSQIGIN 1125          
BLAST of PKD1L-1 vs. Ensembl Nematostella
Match: EDO43195 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ92])

HSP 1 Score: 323.939 bits (829), Expect = 3.646e-93
Identity = 245/845 (28.99%), Postives = 403/845 (47.69%), Query Frame = 3
Query: 7761 WGTAGCVVGPLTTTKVTQCICNHLTSFASGWIVAPNTIDFDYVFSNF-DFTKNLTLFVTEXXXXXXXXXXXXWARRMDIKDIEKV-----GVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVA*------------------GPTKTTESVLTVGPFALTSREIWIGFVTNIISFVPLFVIIEMFRRSQLKHGHANKLRQAVENHLQISLESKENKGYQGSTATLVRNEDVNSRPTTPSYRSTDQINIQIPEYEVENQDSDANEKYKKRVIKRKLLPWWMRIIVWGFLTFLVIISVVFTTFYGIQFGDIACKKWISSMFISFFTSVLLTQPIKVVLLAIFFALVCKKSSSFXXXXXXXXXXXXXXXLGRRNALMQNEEFLHNELYSAPIKPHRFHVQPPPKEELEKAREIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTSNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKN-CYSTYNIFNQDEGSYGKGWTA---LSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANL-LGLYSGGVKAFEIFCQVLYGIFIL 10208
            W T GC VG LTT     CICNHLT+F  G +VAPN IDFD V++ F + + NL + VT      ++I + +WARR D  D+EKV     G + + ++     +LYE++I T     + T++ V                                       LG L YIR+WHD SG   ++SWY N+    +++T   + F+ + W A+E++DG +DR++ V++  +L  F+ +F+ K+  +L + HLW+S++ +PP+S FTRV+R+                    G  K   S +++GP   + R++ IG  ++ I+     ++I++FR         N   Q V++ +  S  SKE+     S                                  E Q +   +K   + +    LP W+  I W     ++++S   T FY + +G     +W+SSM +SFF    +TQPIKV  +A+F A V K     + +E+   +++  + +G  +++   E+       SA        ++ P    +EKAR+ +LKE QM  +   I+ +IVF   L+ V Y+ RDP +Y     + +   KT       + +   + FW +  N+++P       YN  P+ ++ G  ++ N  +IG    RQ+R K+  C      + I+   CY  Y+ FN+D+  +  GW     LS  + P P +  K   ELN + Y G +G Y GGGY      N+      +  L  N+W+D QTRA FIEFT +N  +NLF++ TF++ES G+GG +++ +++   L   + SG      +   VLYG F +
Sbjct:   53 WRTDGCKVGNLTTLNKIHCICNHLTAFGGGLLVAPNPIDFDKVWAGFKNISDNLAVVVTIATGFGLYIVLVLWARRKDKGDMEKVKLIVLGFSTVETDTPFGEHLYELSIHTGSWRGSSTTAKV---------------------------------------LGPLLYIRIWHDMSGY--DSSWYLNFVIAREIETNANWIFMCDRWLALEKDDGMVDRVLLVSTDKDLKTFKTLFNTKVSTDLFDGHLWMSVVKKPPKSSFTRVQRLTCCMSLLYTTMMTGAMFYNVGGVKD-NSTISLGPLTFSVRQLMIGIQSSFIALPGNMIVIQIFR---------NLKPQEVQSEVNNSAISKEDNLKNAS----------------------------------EKQSNSEEDKPNGKKVCLNELPHWLLYIAWTLCISMILVSATITLFYSMMWGKDISNQWLSSMLVSFFQDAFVTQPIKVCAIAVFVAAVLKTLPK-DFSEFKQRDKKHKSPIGSCSSMKSQEQKDTIGKKSA--------MELPDPVTIEKARKFKLKETQMIGIMSSISLHIVFLTLLVVVGYNSRDPMSYNQMKVIEDGISKT------VSLVVNIKGFWGYVGNIVLPFAFNERGYNGLPR-HKEGVTADTNLFMIGMPRFRQLRVKREKCE-----REITALWCYDAYSAFNEDKSYFLPGWRTRANLSFTECPVP-WRHKDFIELNTVPYWGNLGWYGGGGYTADLGYNIIQAQGIVKDLVRNNWLDQQTRATFIEFTVFNAQVNLFSVTTFLLESLGTGGGFSLLKIDTFRLHPHVGSGQTLVILLESVVLYGAFAI 790          

HSP 2 Score: 51.9878 bits (123), Expect = 5.348e-6
Identity = 25/75 (33.33%), Postives = 46/75 (61.33%), Query Frame = 3
Query: 10575 IMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAIL 10799
            +++ AF +  Y +F   L  + TF+   +A   + LGK  + EL + +PI GP+ F+ + + ++F +LNMF+A+L
Sbjct:  783 VLYGAFAIFAYVVFGPQLGGFGTFMQTCQALFAMMLGKGYYTELSRVDPILGPLFFSFFTVSMMFFMLNMFVAVL 857          
BLAST of PKD1L-1 vs. Ensembl Nematostella
Match: EDO31945 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWG0])

HSP 1 Score: 278.87 bits (712), Expect = 2.570e-77
Identity = 187/578 (32.35%), Postives = 290/578 (50.17%), Query Frame = 3
Query: 7860 APNTIDFDYVFSNFDFTKNLTLFVTEXXXXXXXXXXXXWARRMDIKDIEKVGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVA------------------*GPTKTTESVLTVGPFALTSREIWIGFVTNIISFVPLFV-IIEMFR-------RSQLKHGHANK---------------------LRQAVENH-----LQISLESKENKGYQGSTATLVRNEDVNSRPTTPSYRSTDQINIQIPEYEVENQDSDANEKYKKRVIKRKLLPWWMRIIVWGFLTFLVIISVVFTTFYGIQFGDIACKKWISSMFISFFTSVLLTQPIKVVLLAIFFALVCKKSSSFXXXXXXXXXXXXXXXLGRRNALMQNEEFLHNELYSAPIKPHRF-HVQPPPKEELEKAREIRLKELQMYDVFREIAFYIVFFCTLL 9434
            APN IDFD VF+N +F +N       + +  V++ + I++RR D KDIE+ GVTPL  ND +D Y YE+T+ T     A T++ V FIL+G++ E +PR L D KR   +R  +D FL   P SLG + Y+ +WHDN+  G++ SWY +   V D+   +K+ F+  SW AVEE DG +DRLI VA  DE+  F  +F    + NL++ HLW SI  RP  SRFTR++RV+                   G        L +GP A +  ++ IG +++++  VP+ + ++ +FR        ++LK   + K                     ++   +NH     L +S  S+ N  +  S    + ++D+N R +    R                      +K KK+  K+K LP+W   I W            F   YG+QFG     +WISSM +SFF  VL++QPIKVV +A+  A + KK                  + G +  L ++E+++H++  S  ++P     ++PP KE+LEK R+ R KE++M  + +E+  Y  FF  L+
Sbjct:    5 APNPIDFDKVFANVNFAENPIALSVVLSIFGVYLILAIYSRREDKKDIERAGVTPLEDNDPSDRYHYEITVYTGFGKKAATTAQVSFILAGDEGEGEPRILKDPKRKTFQRRGIDVFLATYPESLGEINYLHIWHDNT--GRSPSWYLSRVMVEDINNDKKYMFINESWLAVEEGDGTVDRLIPVAGKDEMTSFNHLFYSTTQKNLADGHLWFSIFMRPARSRFTRLQRVSCCLTLLYCSMLANAMFYNIGGETDPSQTLQIGPLAFSPAQVGIGIMSSLV-IVPVNIFLVAVFRGVEPMPTPAELKERKSRKYWWFYEIFFCFFDRNPKKNDFIQILHKNHKPDDFLDLSSSSRTNLAFNDSLDLGLGDDDINFRISKQEKREE------------------MEKKQKKKKKKKKQLPYWFLYIAWVVCGLTCFTCSFFVVLYGLQFGHDKSAQWISSMLVSFFQDVLVSQPIKVVAIALIIAAIIKKPPE-------------EEDDGDKKKL-EDEDWMHDDGNSGEMRPKGLIRLKPPNKEKLEKDRQQRFKEMKMSAMIKEVTLYTFFFNKLV 547          

HSP 2 Score: 220.32 bits (560), Expect = 3.590e-58
Identity = 128/395 (32.41%), Postives = 217/395 (54.94%), Query Frame = 3
Query: 9750 NCYSTYNIFNQDEGSYGKGWTALSANDTPAPEFSFKS-----EKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVY-VQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADI-ELQENDHELVKFVVTKFIMWTGISETK 10913
            NC + Y  F +D G Y   W  L       P F+FKS       EL+ M ++  +  Y GGGY  +      +    +  L++N WID QTRA+F E +TYNP  NLF   TFVVE   + G++    ++ + L     GG + F + C+ L  +F L+ I +E++ + + +  YF  FWN IE  +VI    +V  F+  +++  S LT+   Q  G+ +++F+ V+  +E    +V+ +VF   LK IK+LRFN RI ML   L   +  +  F ++F + F+++ +  +++F   +  ++ F+   E+ M + LG F + E+ + +PI GPI F  +++F  F+++NMF+ I+ D FA VK  + E  +++ E+V+F+V +F  +TG+   K
Sbjct:  549 NCKTWYGFFAEDTGQYDIAWEPLKNESLYKPPFTFKSWEFYESAELDSMPFMAYVSSYGGGGYAAELGQTEEHALRVIKTLENNTWIDSQTRAVFTEVSTYNPVSNLFCAMTFVVEFLPTNGVYLYMDLKVSRLFAT-GGGFETFLVVCEFLVVVFFLIFIYQELKQLYRMRKAYFKDFWNNIEFTMVILVLASVCMFLMRLKLVESALTKLEKQ--GNTFVSFSRVSSWSEAFMIVVALLVFTTWLKGIKLLRFNPRILMLTRTLKGAAGPLATFSVVFLVFFMSYALFAFAVFGKDIQSFYNFVTTAESVMGLLLGSFDYGEIEEAQPILGPIFFFTFMVFGNFIIMNMFLTIIMDVFAEVKEQLSEQNDSEFEVVEFMVRRFRKFTGMQPNK 940          
BLAST of PKD1L-1 vs. Ensembl Medaka
Match: pkd1l2a (polycystin 1 like 2 [Source:NCBI gene;Acc:101162200])

HSP 1 Score: 487.263 bits (1253), Expect = 3.996e-141
Identity = 346/1128 (30.67%), Postives = 552/1128 (48.94%), Query Frame = 3
Query: 7689 INNTFRVRIFSTGC-YFNSNNFQGGWGTAGCVVGPLTTTKVTQCICNHLTSFASGWIVAPNTIDFDYVFSNF-DFTKNLTLFVTEXXXXXXXXXXXXWARRMDIKDIEKVGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVA*G-----------------PTKTTESVLTVGPFALTSREIWIGFVTNIISFVPLFVIIEMFRRSQLKHGHANKLRQAVENHLQIS---LESKENKGYQGSTATLVRNEDV----------------NSRPTTPSYRSTDQINIQIPEYEVENQ-DSDA-------NEKYKKRVIKRKLLPWWMRIIVWGFLTFLVIISVVFTTFYGIQFGDIACKKWISSMFISFFTSVLLTQPIKVVLLAIFFALVCKKSSSFXXXXXXXXXXXXXXXLGRRNALMQNEEFLHNELYSAPIKPHRFHV---QPPPKEELEKAREIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTSNPNWQFTGITRE---EQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDT---PAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANL-LGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDV-YLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFVVTKFIMWTGI 10901
            IN T  V   +  C Y+N +     W   GC VGPLTT  VTQC+CNHLT F S + V PN +D       F  F  N  +      +   ++ + +WARR DI+D  KV +T L  ND    Y Y +TI T  R  A TSS V   L G + E++P HL D ++P+ +RG +D FLL    SLG LQ IRLWHDNSG   +   Y N   V DL+   K+HFL NSW AV+  +  +D++  VA+  ++  F   F +  K +  + H+W S+++RPP S FTRV+RV+                   PT  +E  + +     T +++ IG  ++II F    +I+ +FR S+ +            N +++S     S + +    +  T+++N                    SR   P+  +     +Q  +  +E+  D D        N   KK+ I+R L PWW   + W  +     +S  FT  YG+ +G      W+ SM +SFF S+ +TQP+KV+  A FFALV K+                  +L         E F   +    P           QPPP  ++EK R   +KE +++ + +EI  Y+ F   LL V Y  RDPNAY L   +   F K         GI+     +  +TWA   L+ NL     +   P     GFI++ N++L+G A +RQVR +K SC V    +    +C++ Y+   +D GSY  GW+ LS N+    P   + +KS+ +L      G + LY GGG+      ++ N  + +  L DN W+D  T+A+F+EFT YN N+NLF I T ++E+  +      +R E  ++ L   +GG+  F +  +V+Y +FI+  +  + + + +Q+  YF   WNL+E+ I+  S+ A++ F+   +   +     +QY  +  +++F   A  +  LGY+++F+V LAT+K   +LR N ++ M+ + L     D+  F ++  IMFLA+ +    ++   LY Y T L A +  + + LG F + E+    P+ G  +    ++F+ FV+LN+FI+++   F   +   +  E + E+V  ++ K     G+
Sbjct:  562 INATVTVISVAAQCKYWNEST--SSWSEDGCRVGPLTTPLVTQCLCNHLTFFGSSFFVMPNLVDVSRTAELFATFANNPVVVCFVATIFAAYVLVVLWARRKDIQDSAKVKITDLGDNDPLAEYRYMLTISTGHRRGASTSSQVTITLQGTEGESEPHHLTDPEKPVFERGGMDMFLLTTHFSLGELQSIRLWHDNSG---DHPAYVNNVMVQDLELGHKWHFLCNSWLAVDVAECTLDKVFPVATETDMKRFNLFFMKTAK-DFRDGHIWFSVISRPPCSTFTRVQRVSCCFSLLLCTMLTSIMFWGIPTDPSEQTMDLH-IEFTWQQVIIGIQSSIIMFPINLLIVSIFRNSRPREKVTKTDVSKQGNTVRVSPSETSSSQMEMKNITPDTVIKNSKYLYRQLHHVEKELGLLGPSRFPNPNNYNRAMQQVQGLKSHLESSLDGDKPSPEGSINGSTKKKQIQRGL-PWWFVFVGWILVIATSGVSGYFTMMYGLTYGKDRSISWLISMVVSFFESLFITQPLKVLGFAAFFALVLKQ-----------------VDLDEFGEPQIEENFKRTDPEVVPADRRDSTCSFYQPPPPTDIEKMRNSMIKEQKVFSLIKEI-LYMGFMWVLLLVAYGQRDPNAYFLTRHIRQSFSK---------GISDTMSIQDVFTWANTTLLNNL-----FGEYP-----GFITDGNSKLVGNARLRQVRMQKGSCLVALPMQISVPDCHALYSWELEDTGSYSPGWSPLSGNNATLNPHNPWIYKSQHKLRAYPICGNVKLYRGGGFATDLLPDLKN-SSVLQYLYDNIWLDVYTQALFVEFTVYNANVNLFCIVTLILETTATAFQ---FRSELQSVRLYQSTGGLHIFVMASEVVYFLFIIYYMFVQGKLMKRQRLAYFQSKWNLLELAIIFLSWSALSVFIKRTLLGQR---DVSQYENNKDFVSFHETAQADAVLGYLIAFLVLLATVKLWHLLRLNPKLHMITATLQRAWTDISGFLVVIAIMFLAYSVASNLMYGWKLYSYRTLLEAAQTIVSLQLGIFNYEEVLNYNPLLGAFLIGSCIVFMTFVILNLFISVILVAFTQEQIHHKPSE-EEEIVDLMLMKLCSLFGL 1636          
BLAST of PKD1L-1 vs. Ensembl Medaka
Match: pkd1l2a (polycystin 1 like 2 [Source:NCBI gene;Acc:101162200])

HSP 1 Score: 457.603 bits (1176), Expect = 2.942e-133
Identity = 333/1108 (30.05%), Postives = 529/1108 (47.74%), Query Frame = 3
Query: 7689 INNTFRVRIFSTGC-YFNSNNFQGGWGTAGCVVGPLTTTKVTQCICNHLTSFASGWIVAPNTIDFDYVFSNF-DFTKNLTLFVTEXXXXXXXXXXXXWARRMDIKDIEK--VGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVA*G-----------------PTKTTESVLTVGPFALTSREIWIGFVTNIISFVPLFVIIEMFRRSQLKHGHANKLRQAVENHLQISLESKENKGYQGSTATLVRNEDVNSRPTTPSYRSTDQINIQIPEYEVENQ-DSDA-------NEKYKKRVIKRKLLPWWMRIIVWGFLTFLVIISVVFTTFYGIQFGDIACKKWISSMFISFFTSVLLTQPIKVVLLAIFFALVCKKSSSFXXXXXXXXXXXXXXXLGRRNALMQNEEFLHNELYSAPIKPHRFHVQPPPKEELEKAREIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTSNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDT---PAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANL-LGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFVVTKFIMWTGISETK 10913
            IN T  V   +  C Y+N +     W   GC VGPLTT  VTQC+CNHLT F S + V PN +D       F  F  N  +      +   ++ + +WARR DI+D  K  V +T L  ND    Y Y +TI T  R  A TSS V   L G + E++P HL D ++P+ +RG +D FLL    SLG LQ IRLWHDNSG   +   Y N   V DL+   K+HFL NSW AV+  +  +D++  VA+  ++  F   F +  K +  + H+W S+++RPP S FTRV+RV+                   PT  +E  + +     T +++ IG  ++II F    +I+ +FR S+ +       RQ   +H++  L      G  G            SR   P+  +     +Q  +  +E+  D D        N   KK+ I+R  LPWW   + W  +     +S  FT  YG+ +G      W+ SM +SFF S+ +TQP+K              + SF                                 Y  P           P  ++EK R   +KE +++ + +EI  Y+ F   LL V Y  RDPNAY L   +   F K        +     +  +TWA   L+ NL             +  FI++ N++L+G A +RQVR +K SC V    +    +C++ Y+   +D GSY  GW+ LS N+    P   + +KS+ +L      G + LY GGG    F ++V      +  L DN W+D  T+A+F+EFT YN N+NLF I T ++E+  +      +R E  ++ L   +GG+  F +  +V+Y +FI+  +  + + + +Q+  YF   WNL+E+ I+  S+ A++ F+   +   +   ++ +   D +++F   A  +  LGY+++F+V LAT+K   +LR N ++ M+ + L     D+  F ++  IMFLA+ +    ++   LY Y T L A +  + + LG F + E+    P+ G  +    ++F+ FV+LN+FI+++   F   +   +  E + E+V  ++ K     G+   K
Sbjct:  379 INATVTVISVAAQCKYWNEST--SSWSEDGCRVGPLTTPLVTQCLCNHLTFFGSSFFVMPNLVDVSRTAELFATFANNPVVVCFVATIFAAYVLVVLWARRKDIQDSAKLQVKITDLGDNDPLAEYRYMLTISTGHRRGASTSSQVTITLQGTEGESEPHHLTDPEKPVFERGGMDMFLLTTHFSLGELQSIRLWHDNSG---DHPAYVNNVMVQDLELGHKWHFLCNSWLAVDVAECTLDKVFPVATETDMKRFNLFFMKTAK-DFRDGHIWFSVISRPPCSTFTRVQRVSCCFSLLLCTMLTSIMFWGIPTDPSEQTMDLH-IEFTWQQVIIGIQSSIIMFPINLLIVSIFRNSRPREKVTKTDRQL--HHVEKEL------GLLGP-----------SRFPNPNNYNRAMQQVQGLKSHLESSLDGDKPSPEGSINGSTKKKQIQRG-LPWWFVFVGWILVIATSGVSGYFTMMYGLTYGKDRSISWLISMVVSFFESLFITQPLK------------DSTCSF---------------------------------YQPP-----------PPTDIEKMRNSMIKEQKVFSLIKEI-LYMGFMWVLLLVAYGQRDPNAYFLTRHIRQSFSKG------ISDTMSIQDVFTWANTTLLNNLFG-----------EYPFITDGNSKLVGNARLRQVRMQKGSCLVALPMQISVPDCHALYSWELEDTGSYSPGWSPLSGNNATLNPHNPWIYKSQHKLRAYPICGNVKLYRGGG----FATDV------LQYLYDNIWLDVYTQALFVEFTVYNANVNLFCIVTLILETTATAFQ---FRSELQSVRLYQSTGGLHIFVMASEVVYFLFIIYYMFVQGKLMKRQRLAYFQSKWNLLELAIIFLSWSALSVFIKRTLLGQRDVSQY-ENNKDRFVSFHETAQADAVLGYLIAFLVLLATVKLWHLLRLNPKLHMITATLQRAWTDISGFLVVIAIMFLAYSVASNLMYGWKLYSYRTLLEAAQTIVSLQLGIFNYEEVLNYNPLLGAFLIGSCIVFMTFVILNLFISVILVAFTQEQIHHKPSE-EEEIVDLMLMKLCSLFGLKSKK 1370          
BLAST of PKD1L-1 vs. Ensembl Medaka
Match: pkd1l2a (polycystin 1 like 2 [Source:NCBI gene;Acc:101162200])

HSP 1 Score: 270.396 bits (690), Expect = 3.860e-73
Identity = 207/688 (30.09%), Postives = 305/688 (44.33%), Query Frame = 3
Query: 7689 INNTFRVRIFSTGC-YFNSNNFQGGWGTAGCVVGPLTTTKVTQCICNHLTSFASGWIVAPNTIDFDYVFSNF-DFTKNLTLFVTEXXXXXXXXXXXXWARRMDIKDIEKVGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVA*GPTKTTESVLTVGPF---ALTSREIWIGFVTNIISFVPLFVIIEMFRRSQLKH--------GHANKLRQAVENHLQISLESK-------------ENKGYQGSTATLVRNEDV-----------------NSRPTTPSYRSTDQINIQIPEYEVENQ-DSDA-------NEKYKKRVIKRKLLPWWMRIIVWGFLTFLVIISVVFTTFYGIQFGDIACKKWISSMFISFFTSVLLTQPIKVVLLAIFFALVCKKSSSFXXXXXXXXXXXXXXXLGRRNALMQNEEFLHNELYSAPIKPH--RFHVQPPPKEELEKAREIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTSNPNWQFTGITREEQFWTWALNVLVPNL 9593
            IN T  V   +  C Y+N +     W   GC VGPLTT  VTQC+CNHLT F S + V PN +D       F  F  N  +      +   ++ + +WARR DI+D  KV +T L  ND    Y Y +TI T  R  A TSS V   L G + E++P HL D ++P+ +RG +D FLL    SLG LQ IRLWHDNS  G + +WY N   V DL+   K+HFL NSW AV+  +  +D++  VA+  ++  F  +F  K   +  + H+W S+++RPP S FTRV+RV+   +    ++LT   F        E  +   ++II F    +I+ +FR S+ +            N +R +        +E K             E+  Y G     + N                     SR   P+  +     +Q  +  +E+  D D        N   KK+ I+R  LPWW   + W  +     +S  FT  YG+ +G      W+ SM +SFF S+ +TQP+K                                    R+ +            ++ I+     F+  PPP  ++EK R   +KE +++ + +EI  Y+ F   LL V Y  RDPNAY L   +   F K        +     +  +TWA   L+ NL
Sbjct:  261 INATVTVISVAAQCKYWNEST--SSWSEDGCRVGPLTTPLVTQCLCNHLTFFGSSFFVMPNLVDVSRTAELFATFANNPVVVCFVATIFAAYVLVVLWARRKDIQDSAKVKITDLGDNDPLAEYRYMLTISTGHRRGASTSSQVTITLQGTEGESEPHHLTDPEKPVFERGGMDMFLLTTHFSLGELQSIRLWHDNS--GDHPAWYVNNVMVQDLELGHKWHFLCNSWLAVDVAECTLDKVFPVATETDMKRFSNLFFMKTAKDFRDGHIWFSVISRPPCSTFTRVQRVSCCFSLLLCTMLTSIMFWGIPTDPSEQTMDLGSSIIMFPINLLIVSIFRNSRPREKVTKTDVSKQGNTVRVSPSETSSSQMEMKNITPDTVIKVKIFESCVYLGCNFQKISNNSKYLYRQLHHVEKELGLLGPSRFPNPNNYNRAMQQVQGLKSHLESSLDGDKPSPEGSINGSTKKKQIQRG-LPWWFVFVGWILVIATSGVSGYFTMMYGLTYGKDRSISWLISMVVSFFESLFITQPLK-----------------------------------NRHGVYFLFFISLFFSMNSYIRDSTCSFYQPPPPT-DIEKMRNSMIKEQKVFSLIKEILGYMGFMWVLLLVAYGQRDPNAYFLTRHIRQSFSK------GISDTMSIQDVFTWANTTLLNNL 901          

HSP 2 Score: 93.5893 bits (231), Expect = 3.423e-18
Identity = 52/190 (27.37%), Postives = 98/190 (51.58%), Query Frame = 3
Query: 10329 VYVQIATSQLTEKFAQYGGDVYLNFA---YVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFVVTKFIM 10889
            V+    T+ L   F +Y G + L+      +   +  LGY+++F+V LAT+K   +LR N ++ M+ + L     D+  F ++  IMFLA+ +    ++   LY Y T L A +  + + LG F + E+    P+ G  +    ++F+ FV+LN+FI+++   F         ++  H+++K +V   +M
Sbjct:  889 VFTWANTTLLNNLFGEYPGQLSLSILSQRLITQADAVLGYLIAFLVLLATVKLWHLLRLNPKLHMITATLQRAWTDISGFLVVIAIMFLAYSVASNLMYGWKLYSYRTLLEAAQTIVSLQLGIFNYEEVLNYNPLLGAFLIGSCIVFMTFVILNLFISVILVAFTQ-------EQIHHKVIKEIVDLMLM 1071          
BLAST of PKD1L-1 vs. Ensembl Medaka
Match: pkd2 (polycystin 2, transient receptor potential cation channel [Source:NCBI gene;Acc:100192346])

HSP 1 Score: 243.432 bits (620), Expect = 1.461e-65
Identity = 147/506 (29.05%), Postives = 249/506 (49.21%), Query Frame = 3
Query: 9366 KELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIK----TSNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFV 10871
            +E  +++V RE+  YI F  T+  +TY     N Y     ++ +F+     + NP   F  ++  E FW +     +  +   VWYNN      + FI    N L+G   +RQVR    +C++ +  +   + CY  Y   N+D   +G        N T    +   +E ++N  ++ G++  Y GGGY             ++  LKD+ W+D  TRAIF++F+ YN N+NL  I   +VE P +GG+ T ++ +   L+  Y      F   C+V + +F+L  +V+E+  I   +  YF   WN ++V IV  S +A+   +        L +    Y    + +F  +A        M + IVF   +K  K + FN+ +  L + ++  +KD+  F I+F I+FLA+  + Y +F   +  + TF  +     +I LG F F E+ +  P+ GPI F  +VLFI F+L+NMF+AI+ D ++ VKAD+    ++ E+  F+
Sbjct:  155 RERYLWNVLRELLTYIAFLITICILTYGMISTNMYYYTKAMSQLFLDAPLSSENPK-TFRSLSTMEDFWKYTQGPFLGGMYWEVWYNNQSLPGNQSFIY-YENILLGVPRLRQVRVHNETCSIHEDLRDEVQGCYGVYTPSNEDNSPFG------PQNGTA---WVHTTESKMNASTHWGQVSKYGGGGYYQDLSRTREESGLQLQFLKDHLWLDRGTRAIFLDFSVYNGNVNLVCIARLLVEFPATGGVLTSWQFQTVRLIK-YVSSWDYFVGVCEVAFCLFVLYYVVEEVLEIHIHRLHYFKNLWNCLDVLIVTLSVVAIIMSITRAAMGGDLLKGLENYTS--HTSFDSLANLQVQFNNMAAVIVFFCWVKLFKFINFNKTMSQLSTTMSRCAKDLVGFAIMFFIIFLAYAQLAYLVFGTQVNDFSTFQGSVFTQFRIILGDFDFFEIKEANPVLGPIYFITFVLFIFFILMNMFLAIINDTYSEVKADMAQHRSEMEMTDFI 646          
BLAST of PKD1L-1 vs. Ensembl Medaka
Match: pkd2 (polycystin 2, transient receptor potential cation channel [Source:NCBI gene;Acc:100192346])

HSP 1 Score: 243.047 bits (619), Expect = 4.523e-65
Identity = 147/506 (29.05%), Postives = 249/506 (49.21%), Query Frame = 3
Query: 9366 KELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIK----TSNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFV 10871
            +E  +++V RE+  YI F  T+  +TY     N Y     ++ +F+     + NP   F  ++  E FW +     +  +   VWYNN      + FI    N L+G   +RQVR    +C++ +  +   + CY  Y   N+D   +G        N T    +   +E ++N  ++ G++  Y GGGY             ++  LKD+ W+D  TRAIF++F+ YN N+NL  I   +VE P +GG+ T ++ +   L+  Y      F   C+V + +F+L  +V+E+  I   +  YF   WN ++V IV  S +A+   +        L +    Y    + +F  +A        M + IVF   +K  K + FN+ +  L + ++  +KD+  F I+F I+FLA+  + Y +F   +  + TF  +     +I LG F F E+ +  P+ GPI F  +VLFI F+L+NMF+AI+ D ++ VKAD+    ++ E+  F+
Sbjct:  155 RERYLWNVLRELLTYIAFLITICILTYGMISTNMYYYTKAMSQLFLDAPLSSENPK-TFRSLSTMEDFWKYTQGPFLGGMYWEVWYNNQSLPGNQSFIY-YENILLGVPRLRQVRVHNETCSIHEDLRDEVQGCYGVYTPSNEDNSPFG------PQNGTA---WVHTTESKMNASTHWGQVSKYGGGGYYQDLSRTREESGLQLQFLKDHLWLDRGTRAIFLDFSVYNGNVNLVCIARLLVEFPATGGVLTSWQFQTVRLIK-YVSSWDYFVGVCEVAFCLFVLYYVVEEVLEIHIHRLHYFKNLWNCLDVLIVTLSVVAIIMSITRAAMGGDLLKGLENYTS--HTSFDSLANLQVQFNNMAAVIVFFCWVKLFKFINFNKTMSQLSTTMSRCAKDLVGFAIMFFIIFLAYAQLAYLVFGTQVNDFSTFQGSVFTQFRIILGDFDFFEIKEANPVLGPIYFITFVLFIFFILMNMFLAIINDTYSEVKADMAQHRSEMEMTDFI 646          
BLAST of PKD1L-1 vs. Planmine SMEST
Match: SMESG000067002.1 (SMESG000067002.1)

HSP 1 Score: 6917.4 bits (17946), Expect = 0.000e+0
Identity = 3447/3476 (99.17%), Postives = 3452/3476 (99.31%), Query Frame = 3
Query:  567 MGTIFKLILSILLIHFSRAEWCIKITLDKVVGIGTYNKDQVSLDRTLCTDECYYSGFPFTVVWKNTYCFCANDISAGINVTDFSTCATVDGFYVSASLASSLTVIFQMAMATTKFIASGNLVSMSPNIYYYAPPGPPPSFKYSYHDKAGIWEYSLDSNAIQRVFSISGIYQIRSQVLKPNNQAKISEVSTEIMAYQSVTNLNITCQPIAIVYIAVNCTVSISNGSFITGQIMADGLIIETLTLPDIPWERVGAVPNFFNNDFITGQSVSGIYLINGQYQYNGIITSIEFNAFKTGNIDLLLLKPSCGTYYCIATGSCAATPSCSRTLACGNEYCPLSQSCSAICNNRLLNKENSSSLPSVSYIINQVQLYPISNTGYQIVTLSVPWPVQAGYRLGFHFGNGITDLIAVTSLRSGETPNFFYNSQTVTSGTLIPSTSFTPKYISHQFSAVSVQQRNTKFKLMFNTTGIKNVTVNLQXXXXXXXXXXXXXXXGLNINDTSFANLGYATTNVSYMFIMNPHTGDQLLYYWDFGDNTTLNSTTRFVNHTFTVAGVYNSSVYVYNTLVSKVQNYLIYVKDAVKINFFNSSGVYNPNVFASFILSMKSGTGFNCTLSGDGIANQTQPSNNLLFGWQWATEGSFNVRIDCYNELTRDYKTLVQVIQANITGLTFVNFGGAAFEQMQLRFSWLTGSNITFLLLVNNISYSLTQNETALTGISQNITISAPGVLIGVIRATNLISDIILVANLTFSQKISNMNLIADKYYTTNGSAFNFYVNMSTGSGVRSVIQYGDGQNNTNINYESPSVYWPGISVPYTYSNVGTYNVTVNCTNIVNSQTSSVVVYVLTGLGTYEIVYNNLFFKKNDLIQLSLNRTSGYPASMTNITINWQNGDITSIPFAAFNESAIYNYVYSANGVYNVTLTLQNPLSTVVKSILLSIIDPIINFRCVNVPANTWNGNQIQLQTLVDQGQNVIYTLNPGDGGALITKNINISXXXXXXXXXXXXXXVGNYTSNIWACNQLGCQNCSNYVQIQYKIQSFDFQVQTNGNIEYLKTNLITTISFTGTNFPTALMATFTLSDGSPPSTVYLSLSMMPYNFVKNLSVVGFGNILVKLENLANSVNISATYGSFEKFSNFNVSLTWGPTRALGFGANFNTFPLNNPVYFRPSAQAKGTVVGYTFLYAPIKNLSAIFQCNATLVNGEFSYTFSTMGDFNVSFKVYNPIDQAFIENTLTIGSSIQNTQISTRPLTLMPNYFGYISIQWSVISTESCICVDFANNTKLIYGAMSGCSNCSGYLFANRKPSNNLLEILVRFSTEGDYNIKVFIYNDYESAFANRTIPVTYAQCAPPVVSMTYTQFQNPMTPQKDIRSSQIIVSAVVLDLPCILTKNNMKLWSATLMDPIYLTPIKAVDMSIIPTSNNTQLIIPPRFLNYGLYKLTFSVTMDKNVTIYTFQSSNFTYLFIDKSPIIVGLSSGGISLIVNGIDQNICFTPLQYSQDPDLNVQDFSKWIWTWTCQKTTESENLTNYVYPKPIGYSFTTPKTGCFGDGPGVVNFTSSPCFWGGNLEINGTYQLGLVGMSSDNRTGSAKIIITVVKGIPPDITVQCLRPLMCKINNVGAFAFNEVVFNPSDALLLSATCYGNGTICGQGLWNLILLNETTQIWTPLDSSIANLYIKGVYSMQISLLPSFFSFYNTIKRFQICYNSINLTPNGKSCIQFYIFPLPSGIICTLDKTTVQQTDTVCVNCTFQPNYQYRMYVNVTNECSTLGFNSTGQFCSIIPYQTVNQTYIVRVTNENGGFIDVIAGIIMVTQLQLVDLTKILTNVINGTDQTLTVAIAKGDFKEMSQVYLKYVSVLTASNQITIRNLFQPLTNNSKENLGGTGYMTTSVNSSTMTIESLPKDIRAKYEIDRDQKSTVINSMTAGLYTMVPGDIQSLHLISSVVNAIGESSDCVNRQSQWQLSTKLASLADNFKELQKTAPRDDVLTIATNLLSANYRSDAAANIQIDNGILRDIKFSKDTYLDYDTNLESGGKNYLNVDDPSAAAYSLTLETNSNFQSKIAFGVGSNSLYTIQTISKVLRDITVLNDVPTDLLTSQMQYYSIKTQINDLSNKAFTKGRSTIILPDICAALNSPPGSCSDPNNPIGLEIIATPNNVRAYAQNPNKNGLPIPMNSDFVSLSLFLGRQISEKPVQPNGNNNFTIFISRDPVFAVPDFNFTEPDPQIQPPKSIPGTGTIFTGPQCFEQKLVVYQFKLIGSDQSVHFQIKSNFSTKCTQYLIVGRLGQPPVLGANPDGSVDSVNFTFWGMIPTHTKYCNLIPSSDMPDPFTFFVDNSMFKQSKISTKSSMPDYSKTLDTLYFGVRELTPAEYDLYTRSNRPPVPYTISAQINNTFRVRIFSTGCYFNSNNFQGGWGTAGCVVGPLTTTKVTQCICNHLTSFASGWIVAPNTIDFDYVFSNFDFTKNLTLFVTEXXXXXXXXXXXXWARRMDIKDIEKVGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVA-------------------*GPTKTTESVLTVGPFALTSREIWIGFVTNIISFVPLFVIIEMFRRSQLKHGHANKLRQAVENHLQISLESKENKGYQGSTATLVRNEDVNSRPTTPSYRSTDQINIQIPEYEVENQDSDANEKYKKRVIKRKLLPWWMRIIVWGFLTFLVIISVVFTTFYGIQFGDIACKKWISSMFISFFTSVLLTQPIKVVLLAIFFALVCKKSSSFXXXXXXXXXXXXXXXLGRRNALMQNEEFLHNELYSAPIKPHRFHVQPPPKEELEKAREIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTSNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFVVTKFIMWTGISETKFGKKFIKT 10937
            MGTIFKLILSILLIHFSRAEWCIKITLDKVVGIGTYNKDQVSLDRTLCTDECYYSGFPFTVVWKNTYCFCANDISAGINVTDFSTCATVDGFYVSASLASSLTVIFQMAMATTKFIASGNLVSMSPNIYYYAPPGPPPSFKYSYHDKAGIWEYSLDSNAIQRVFSISGIYQIRSQVLKPNNQAKISEVSTEIMAYQSVTNLNITCQPIAIVYIAVNCTVSISNGSFITGQIMADGLIIETLTLPDIPWERVGAVPNFFNNDFITGQSVSGIYLINGQYQYNGIITSIEFNAFKTGNIDLLLLKPSCGTYYCIATGSCAATPSCSRTLACGNEYCPLSQSCSAICNNRLLNKENSSSLPSVSYIINQVQLYPISNTGYQIVTLSVPWPVQAGYRLGFHFGNGITDLIAVTSLRSGETPNFFYNSQTVTSGTLIPSTSFTPKYISHQFSAVSVQQRNTKFKLMFNTTGIKNVTVNLQSVDNVVASASSS+IVGLNINDTSFANLGYATTNVSYMFIMNPHTGDQLLYYWDFGDNTTLNSTTRFVNHTFTVAGVYNSSVYVYNTLVSKVQNYLIYVKDAVKINFFNSSGVYNPNVFASFILSM SGTGFNCTLSGDGIANQTQPSNNLLFGWQWATEGSFNVRIDCYNELTRDYKTLVQVIQANITGLTFVNFGGAAFEQMQLRFSWLTGSNITFLLLVNNISYSLTQNETALTGISQNITISAPGVLIGVIRATNLISDIILVANLTFSQKISNMNLIADKYYTTNGSAFNFYVNMSTGSGVRSVIQYGDGQNNTNINYESPSVYWPGISVPYTYSNVGTYNVTVNCTNIVNSQTSSVVVYVLTGLGTYEIVYNNLFFKKNDLIQLSLNRTSGYPASMTNITINW+NGDITSIPFAAFNESAIYNYVYSANGVYNVTLTLQNPLS VVKSILLSIIDPIINFRCVNVPANTWNGNQIQLQTLVDQGQNVIYTLNPGDGGALITKNINISTLNTQYNFNYTYNTVGNYTSNIWACNQLGCQNCSNYVQIQYKIQSFDFQVQTNGNIEYLKTNLITTISFTGTNFPTALMATFTLSDGSPPSTVYLSLSMMPYNFVKNLSVVGFGNILVKLENLANSVNISATYGSFEKFSNFNVSLTWGPTRALGFGANFNTFPLNNPVYFRPSAQAKGTVVGYTFLYAPIKNLSAIFQCNATLVNGEFSYTFSTMGDFNVSFKVYNPIDQAFIENTLTIGSSIQNTQISTRPLTLMPNYFGYISIQWSVISTESCICVDFANNTKLIYGAMSGCSNCSGYLFANRKPSNNLLEILVRFSTEGDYNIKVFIYNDYESAFANRTIPVTYAQCAPPVVSMTYTQFQNPMTPQKDIRSSQIIVSAVVLDLPCILTKNNMKLWSATLMDPIYLTPIKAVDMSIIPTSNNTQLIIPPRFLNYGLYKLTFSVTMDKNVTIYTFQSSNFTYLFIDKSPIIVGLSSGGISLIVNGIDQNICFTPLQYSQDPDLNVQDFSKWIWTWTCQKTTESENLTNYVYPKPIGYSFTTPKTGCFGDGPGVVNFTSSPCFWGGNLEINGTYQLGLVGMSSDNRTGSAKIIITVVKGIPPDITVQCLRPLMCKINNVGAFAFNEVVFNPSDALLLSATCY NGTICGQGLWNLILLNETTQIWTPLDSSIANLYIKGVYSMQISLLPSFFSFYNTIKRFQICYNSINL+ NGKSCIQFYIFPLPSGIICTLDKTTVQQTDTVCVNCTFQPNYQYRMYVNVTNEC+TLGFNSTGQFCSIIPYQTVNQTYIVRVTNENGGFIDVIAGIIMVTQLQLVDLTKILTNVINGTDQTLTVAIAKGDFKEMSQVYLKYVSVLTASNQITIRNLFQPLT+NSKENLGGTGYMTTSVNSSTMTIESLPKDIRAKYEIDRDQKSTVINSMTAGLYTMVPGDIQSLHLISSVVNAIGESSDCVNRQSQWQLSTKLASLADNFKELQKTAPRDDVLTIATNLLSANYRSDAAANIQIDNGILRDIKFSKDTYLDYDTNLESGGKNYLNVDDPSAAAYSLTLETNSNFQSKIAFGVGSNSLYTIQTISKVLRDITVLNDVPTDLLTSQMQYYSIKTQINDLSNKAFTKGRSTIILPDICAALNSPPGSCSDPNNPIGLEIIATPNNVRAYAQNPNKNGLPIPMNSDFVSLSLFLGRQISEKPVQPNGNNNFTIFISRDPVFAVPDFNFTEPDPQIQPPKSIPGTGTIFTGPQCFEQKLVVYQFKLIGSDQSVHFQIKSNFSTKCTQYLIVGRLGQPPVLGANPDGSVDSVNFTFWGMIPTHTKYCNLIPSSDMPDPFTFFVDNSMFKQSKISTKSSMPDYSKTLDTLYFGVRELTPAEYDLYTRSNRPPVPYTISAQINNTFRVRIFSTGCYFNSNNFQGGWGTAGCVVGPLTTTKVTQCICNHLTSFASGWIVAPNTIDFDYVFSNFDFTKNLTLFVTEIVVALVFIAIFIWARRMDIKDIEKVGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVA                    GPTKTTESVLTVGPFALTSREIWIGFVTNIISFVPLFVIIEMFRRSQLKHGHANKLRQAVENHLQISLESKENKGYQGSTATLVRNEDVNSRPTTPSYRSTDQINIQIPEYEVENQDSDANEKYKKRVIKRKLLPWWMRIIVWGFLTFLVIISVVFTTFYGIQFGDIACKKWISSMFISFFTSVLLTQPIKVVLLAIFFALVCKKSSSFNNTEYINEEEELMNELGRRNALMQNEEFLHNELYSAPIKPHRFHVQPPPKEELEKAREIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTSNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFVVTKFIMWTGISETKFGKKFIKT
Sbjct:    1 MGTIFKLILSILLIHFSRAEWCIKITLDKVVGIGTYNKDQVSLDRTLCTDECYYSGFPFTVVWKNTYCFCANDISAGINVTDFSTCATVDGFYVSASLASSLTVIFQMAMATTKFIASGNLVSMSPNIYYYAPPGPPPSFKYSYHDKAGIWEYSLDSNAIQRVFSISGIYQIRSQVLKPNNQAKISEVSTEIMAYQSVTNLNITCQPIAIVYIAVNCTVSISNGSFITGQIMADGLIIETLTLPDIPWERVGAVPNFFNNDFITGQSVSGIYLINGQYQYNGIITSIEFNAFKTGNIDLLLLKPSCGTYYCIATGSCAATPSCSRTLACGNEYCPLSQSCSAICNNRLLNKENSSSLPSVSYIINQVQLYPISNTGYQIVTLSVPWPVQAGYRLGFHFGNGITDLIAVTSLRSGETPNFFYNSQTVTSGTLIPSTSFTPKYISHQFSAVSVQQRNTKFKLMFNTTGIKNVTVNLQSVDNVVASASSSIIVGLNINDTSFANLGYATTNVSYMFIMNPHTGDQLLYYWDFGDNTTLNSTTRFVNHTFTVAGVYNSSVYVYNTLVSKVQNYLIYVKDAVKINFFNSSGVYNPNVFASFILSMTSGTGFNCTLSGDGIANQTQPSNNLLFGWQWATEGSFNVRIDCYNELTRDYKTLVQVIQANITGLTFVNFGGAAFEQMQLRFSWLTGSNITFLLLVNNISYSLTQNETALTGISQNITISAPGVLIGVIRATNLISDIILVANLTFSQKISNMNLIADKYYTTNGSAFNFYVNMSTGSGVRSVIQYGDGQNNTNINYESPSVYWPGISVPYTYSNVGTYNVTVNCTNIVNSQTSSVVVYVLTGLGTYEIVYNNLFFKKNDLIQLSLNRTSGYPASMTNITINWKNGDITSIPFAAFNESAIYNYVYSANGVYNVTLTLQNPLSIVVKSILLSIIDPIINFRCVNVPANTWNGNQIQLQTLVDQGQNVIYTLNPGDGGALITKNINISTLNTQYNFNYTYNTVGNYTSNIWACNQLGCQNCSNYVQIQYKIQSFDFQVQTNGNIEYLKTNLITTISFTGTNFPTALMATFTLSDGSPPSTVYLSLSMMPYNFVKNLSVVGFGNILVKLENLANSVNISATYGSFEKFSNFNVSLTWGPTRALGFGANFNTFPLNNPVYFRPSAQAKGTVVGYTFLYAPIKNLSAIFQCNATLVNGEFSYTFSTMGDFNVSFKVYNPIDQAFIENTLTIGSSIQNTQISTRPLTLMPNYFGYISIQWSVISTESCICVDFANNTKLIYGAMSGCSNCSGYLFANRKPSNNLLEILVRFSTEGDYNIKVFIYNDYESAFANRTIPVTYAQCAPPVVSMTYTQFQNPMTPQKDIRSSQIIVSAVVLDLPCILTKNNMKLWSATLMDPIYLTPIKAVDMSIIPTSNNTQLIIPPRFLNYGLYKLTFSVTMDKNVTIYTFQSSNFTYLFIDKSPIIVGLSSGGISLIVNGIDQNICFTPLQYSQDPDLNVQDFSKWIWTWTCQKTTESENLTNYVYPKPIGYSFTTPKTGCFGDGPGVVNFTSSPCFWGGNLEINGTYQLGLVGMSSDNRTGSAKIIITVVKGIPPDITVQCLRPLMCKINNVGAFAFNEVVFNPSDALLLSATCYVNGTICGQGLWNLILLNETTQIWTPLDSSIANLYIKGVYSMQISLLPSFFSFYNTIKRFQICYNSINLSTNGKSCIQFYIFPLPSGIICTLDKTTVQQTDTVCVNCTFQPNYQYRMYVNVTNECTTLGFNSTGQFCSIIPYQTVNQTYIVRVTNENGGFIDVIAGIIMVTQLQLVDLTKILTNVINGTDQTLTVAIAKGDFKEMSQVYLKYVSVLTASNQITIRNLFQPLTSNSKENLGGTGYMTTSVNSSTMTIESLPKDIRAKYEIDRDQKSTVINSMTAGLYTMVPGDIQSLHLISSVVNAIGESSDCVNRQSQWQLSTKLASLADNFKELQKTAPRDDVLTIATNLLSANYRSDAAANIQIDNGILRDIKFSKDTYLDYDTNLESGGKNYLNVDDPSAAAYSLTLETNSNFQSKIAFGVGSNSLYTIQTISKVLRDITVLNDVPTDLLTSQMQYYSIKTQINDLSNKAFTKGRSTIILPDICAALNSPPGSCSDPNNPIGLEIIATPNNVRAYAQNPNKNGLPIPMNSDFVSLSLFLGRQISEKPVQPNGNNNFTIFISRDPVFAVPDFNFTEPDPQIQPPKSIPGTGTIFTGPQCFEQKLVVYQFKLIGSDQSVHFQIKSNFSTKCTQYLIVGRLGQPPVLGANPDGSVDSVNFTFWGMIPTHTKYCNLIPSSDMPDPFTFFVDNSMFKQSKISTKSSMPDYSKTLDTLYFGVRELTPAEYDLYTRSNRPPVPYTISAQINNTFRVRIFSTGCYFNSNNFQGGWGTAGCVVGPLTTTKVTQCICNHLTSFASGWIVAPNTIDFDYVFSNFDFTKNLTLFVTEIVVALVFIAIFIWARRMDIKDIEKVGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVACCLLLLFLTMLTTCMFYQTEGPTKTTESVLTVGPFALTSREIWIGFVTNIISFVPLFVIIEMFRRSQLKHGHANKLRQAVENHLQISLESKENKGYQGSTATLVRNEDVNSRPTTPSYRSTDQINIQIPEYEVENQDSDANEKYKKRVIKRKLLPWWMRIIVWGFLTFLVIISVVFTTFYGIQFGDIACKKWISSMFISFFTSVLLTQPIKVVLLAIFFALVCKKSSSFNNTEYINEEEELMNELGRRNALMQNEEFLHNELYSAPIKPHRFHVQPPPKEELEKAREIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTSNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFVVTKFIMWTGISETKFGKKFIKT 3476          
BLAST of PKD1L-1 vs. Planmine SMEST
Match: SMESG000067002.1 (SMESG000067002.1)

HSP 1 Score: 6900.07 bits (17901), Expect = 0.000e+0
Identity = 3442/3476 (99.02%), Postives = 3447/3476 (99.17%), Query Frame = 3
Query:  567 MGTIFKLILSILLIHFSRAEWCIKITLDKVVGIGTYNKDQVSLDRTLCTDECYYSGFPFTVVWKNTYCFCANDISAGINVTDFSTCATVDGFYVSASLASSLTVIFQMAMATTKFIASGNLVSMSPNIYYYAPPGPPPSFKYSYHDKAGIWEYSLDSNAIQRVFSISGIYQIRSQVLKPNNQAKISEVSTEIMAYQSVTNLNITCQPIAIVYIAVNCTVSISNGSFITGQIMADGLIIETLTLPDIPWERVGAVPNFFNNDFITGQSVSGIYLINGQYQYNGIITSIEFNAFKTGNIDLLLLKPSCGTYYCIATGSCAATPSCSRTLACGNEYCPLSQSCSAICNNRLLNKENSSSLPSVSYIINQVQLYPISNTGYQIVTLSVPWPVQAGYRLGFHFGNGITDLIAVTSLRSGETPNFFYNSQTVTSGTLIPSTSFTPKYISHQFSAVSVQQRNTKFKLMFNTTGIKNVTVNLQXXXXXXXXXXXXXXXGLNINDTSFANLGYATTNVSYMFIMNPHTGDQLLYYWDFGDNTTLNSTTRFVNHTFTVAGVYNSSVYVYNTLVSKVQNYLIYVKDAVKINFFNSSGVYNPNVFASFILSMKSGTGFNCTLSGDGIANQTQPSNNLLFGWQWATEGSFNVRIDCYNELTRDYKTLVQVIQANITGLTFVNFGGAAFEQMQLRFSWLTGSNITFLLLVNNISYSLTQNETALTGISQNITISAPGVLIGVIRATNLISDIILVANLTFSQKISNMNLIADKYYTTNGSAFNFYVNMSTGSGVRSVIQYGDGQNNTNINYESPSVYWPGISVPYTYSNVGTYNVTVNCTNIVNSQTSSVVVYVLTGLGTYEIVYNNLFFKKNDLIQLSLNRTSGYPASMTNITINWQNGDITSIPFAAFNESAIYNYVYSANGVYNVTLTLQNPLSTVVKSILLSIIDPIINFRCVNVPANTWNGNQIQLQTLVDQGQNVIYTLNPGDGGALITKNINISXXXXXXXXXXXXXXVGNYTSNIWACNQLGCQNCSNYVQIQYKIQSFDFQVQTNGNIEYLKTNLITTISFTGTNFPTALMATFTLSDGSPPSTVYLSLSMMPYNFVKNLSVVGFGNILVKLENLANSVNISATYGSFEKFSNFNVSLTWGPTRALGFGANFNTFPLNNPVYFRPSAQAKGTVVGYTFLYAPIKNLSAIFQCNATLVNGEFSYTFSTMGDFNVSFKVYNPIDQAFIENTLTIGSSIQNTQISTRPLTLMPNYFGYISIQWSVISTESCICVDFANNTKLIYGAMSGCSNCSGYLFANRKPSNNLLEILVRFSTEGDYNIKVFIYNDYESAFANRTIPVTYAQCAPPVVSMTYTQFQNPMTPQKDIRSSQIIVSAVVLDLPCILTKNNMKLWSATLMDPIYLTPIKAVDMSIIPTSNNTQLIIPPRFLNYGLYKLTFSVTMDKNVTIYTFQSSNFTYLFIDKSPIIVGLSSGGISLIVNGIDQNICFTPLQYSQDPDLNVQDFSKWIWTWTCQKTTESENLTNYVYPKPIGYSFTTPKTGCFGDGPGVVNFTSSPCFWGGNLEINGTYQLGLVGMSSDNRTGSAKIIITVVKGIPPDITVQCLRPLMCKINNVGAFAFNEVVFNPSDALLLSATCYGNGTICGQGLWNLILLNETTQIWTPLDSSIANLYIKGVYSMQISLLPSFFSFYNTIKRFQICYNSINLTPNGKSCIQFYIFPLPSGIICTLDKTTVQQTDTVCVNCTFQPNYQYRMYVNVTNECSTLGFNSTGQFCSIIPYQTVNQTYIVRVTNENGGFIDVIAGIIMVTQLQLVDLTKILTNVINGTDQTLTVAIAKGDFKEMSQVYLKYVSVLTASNQITIRNLFQPLTNNSKENLGGTGYMTTSVNSSTMTIESLPKDIRAKYEIDRDQKSTVINSMTAGLYTMVPGDIQSLHLISSVVNAIGESSDCVNRQSQWQLSTKLASLADNFKELQKTAPRDDVLTIATNLLSANYRSDAAANIQIDNGILRDIKFSKDTYLDYDTNLESGGKNYLNVDDPSAAAYSLTLETNSNFQSKIAFGVGSNSLYTIQTISKVLRDITVLNDVPTDLLTSQMQYYSIKTQINDLSNKAFTKGRSTIILPDICAALNSPPGSCSDPNNPIGLEIIATPNNVRAYAQNPNKNGLPIPMNSDFVSLSLFLGRQISEKPVQPNGNNNFTIFISRDPVFAVPDFNFTEPDPQIQPPKSIPGTGTIFTGPQCFEQKLVVYQFKLIGSDQSVHFQIKSNFSTKCTQYLIVGRLGQPPVLGANPDGSVDSVNFTFWGMIPTHTKYCNLIPSSDMPDPFTFFVDNSMFKQSKISTKSSMPDYSKTLDTLYFGVRELTPAEYDLYTRSNRPPVPYTISAQINNTFRVRIFSTGCYFNSNNFQGGWGTAGCVVGPLTTTKVTQCICNHLTSFASGWIVAPNTIDFDYVFSNFDFTKNLTLFVTEXXXXXXXXXXXXWARRMDIKDIEKVGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVA-------------------*GPTKTTESVLTVGPFALTSREIWIGFVTNIISFVPLFVIIEMFRRSQLKHGHANKLRQAVENHLQISLESKENKGYQGSTATLVRNEDVNSRPTTPSYRSTDQINIQIPEYEVENQDSDANEKYKKRVIKRKLLPWWMRIIVWGFLTFLVIISVVFTTFYGIQFGDIACKKWISSMFISFFTSVLLTQPIKVVLLAIFFALVCKKSSSFXXXXXXXXXXXXXXXLGRRNALMQNEEFLHNELYSAPIKPHRFHVQPPPKEELEKAREIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTSNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFVVTKFIMWTGISETKFGKKFIKT 10937
            MGTIFKLILSILLIHFSRAEWCIKITLDKVVGIGTYNKDQVSLDRTLCTDECYYSGFPFTVVWKNTYCFCANDISAGINVTDFSTCATVDGFYVSASLASSLTVIFQMAMATTKFIASGNLVSMSPNIYYYAPPGPPPSFKYSYHDKAGIWEYSLDSNAIQRVFSISGIYQIRSQVLKPNNQAKISEVSTEIMAYQSVTNLNITCQPIAIVYIAVNCTVSISNGSFITGQIMADGLIIETLTLPDIPWERVGAVPNFFNNDFITGQSVSGIYLINGQYQYNGIITSIEFNAFKTGNIDLLLLKPSCGTYYCIATGSCAATPSCSRTLACGNEYCPLSQSCSAICNNRLLNKENSSSLPSVSYIINQVQLYPISNTGYQIVTLSVPWPVQAGYRLGFHFGNGITDLIAVTSLRSGETPNFFYNSQTVTSGTLIPSTSFTPKYISHQFSAVSVQQRNTKFKLMFNTTGIKNVTVNLQSVDNVVASASSS+IVGLNINDTSFANLGYATTNVSYMFIMNPHTGDQLLYYWDFGDNTTLNSTTRFVNHTFTVAGVYNSSVYVYNTLVSKVQNYLIYVKDAVKINFFNSSGVYNPNVFASFILSM SGTGFNCTLSGDGIANQTQPSNNLLFGWQWATEGSFNVRIDCYNELTRDYKTLVQVIQANITGLTFVNFGGAAFEQMQLRFSWLTGSNITFLLLVNNISYSLTQNETALTGISQNITISAPGVLIGVIRATNLISDIILVANLTFSQKISNMNLIADKYYTTNGSAFNFYVNMSTGSGVRSVIQYGDGQNNTNINYESPSVYWPGISVPYTYSNVGTYNVTVNCTNIVNSQTSSVVVYVLTGLGTYEIVYNNLFFKKNDLIQLSLNRTSGYPASMTNITINW+NGDITSIPFAAFNESAIYNYVYSANGVYNVTLTLQNPLS VVKSILLSIIDPIINFRCVNVPANTWNGNQIQLQTLVDQGQNVIYTLNPGDGGALITKNINISTLNTQYNFNYTYNTVGNYTSNIWACNQLGCQNCSNYVQIQYKIQSFDFQVQTNGNIEYLKTNLITTISFTGTNFPTALMATFTLSDGSPPSTVYLSLSMMPYNFVKNLSVVGFGNILVKLENLANSVNISATYGSFEKFSNFNVSLTWGPTRALGFGANFNTFPLNNPVYFRPSAQAKGTVVGYTFLYAPIKNLSAIFQCNATLVNGEFSYTFSTMGDFNVSFKVYNPIDQAFIENTLTIGSSIQNTQISTRPLTLMPNYFGYISIQWSVISTESCICVDFANNTKLIYGAMSGCSNCSGYLFANRKPSNNLLEILVRFSTEGDYNIKVFIYNDYESAFANRTIPVTYAQCAPPVVSMTYTQFQNPMTPQKDIRSSQIIVSAVVLDLPCILTKNNMKLWSATLMDPIYLTPIKAVDMSIIPTSNNTQLIIPPRFLNYGLYKLTFSVTMDKNVTIYTFQSSNFTYLFIDKSPIIVGLSSGGISLIVNGIDQNICFTPLQYSQDPDLNVQDFSKWIWTWTCQKTTESENLTNYVYPKPIGYSFTTPKTGCFGDGPGVVNFTSSPCFWGGNLEINGTYQLGLVGMSSDNRTGSAKIIITVVKGIPPDITVQCLRPLMCKINNVGAFAFNEVVFNPSDALLLSATCY NGTICGQGLWNLILLNETTQIWTPLDSSIANLYIKGVYSMQISLLPSFFSFYNTIKRFQICYNSINL+ NGKSCIQFYIFPLPSGIICTLDKTTVQQTDTVCVNCTFQPNYQYRMYVNVTNEC+TLGFNSTGQFCSIIPYQTVNQTYIVRVTNENGGFIDVIAGIIMVTQLQLVDLTKILTNVINGTDQTLTVAIAKGDFKEMSQVYLKYVSVLTASNQITIR     LT+NSKENLGGTGYMTTSVNSSTMTIESLPKDIRAKYEIDRDQKSTVINSMTAGLYTMVPGDIQSLHLISSVVNAIGESSDCVNRQSQWQLSTKLASLADNFKELQKTAPRDDVLTIATNLLSANYRSDAAANIQIDNGILRDIKFSKDTYLDYDTNLESGGKNYLNVDDPSAAAYSLTLETNSNFQSKIAFGVGSNSLYTIQTISKVLRDITVLNDVPTDLLTSQMQYYSIKTQINDLSNKAFTKGRSTIILPDICAALNSPPGSCSDPNNPIGLEIIATPNNVRAYAQNPNKNGLPIPMNSDFVSLSLFLGRQISEKPVQPNGNNNFTIFISRDPVFAVPDFNFTEPDPQIQPPKSIPGTGTIFTGPQCFEQKLVVYQFKLIGSDQSVHFQIKSNFSTKCTQYLIVGRLGQPPVLGANPDGSVDSVNFTFWGMIPTHTKYCNLIPSSDMPDPFTFFVDNSMFKQSKISTKSSMPDYSKTLDTLYFGVRELTPAEYDLYTRSNRPPVPYTISAQINNTFRVRIFSTGCYFNSNNFQGGWGTAGCVVGPLTTTKVTQCICNHLTSFASGWIVAPNTIDFDYVFSNFDFTKNLTLFVTEIVVALVFIAIFIWARRMDIKDIEKVGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVA                    GPTKTTESVLTVGPFALTSREIWIGFVTNIISFVPLFVIIEMFRRSQLKHGHANKLRQAVENHLQISLESKENKGYQGSTATLVRNEDVNSRPTTPSYRSTDQINIQIPEYEVENQDSDANEKYKKRVIKRKLLPWWMRIIVWGFLTFLVIISVVFTTFYGIQFGDIACKKWISSMFISFFTSVLLTQPIKVVLLAIFFALVCKKSSSFNNTEYINEEEELMNELGRRNALMQNEEFLHNELYSAPIKPHRFHVQPPPKEELEKAREIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTSNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFVVTKFIMWTGISETKFGKKFIKT
Sbjct:    1 MGTIFKLILSILLIHFSRAEWCIKITLDKVVGIGTYNKDQVSLDRTLCTDECYYSGFPFTVVWKNTYCFCANDISAGINVTDFSTCATVDGFYVSASLASSLTVIFQMAMATTKFIASGNLVSMSPNIYYYAPPGPPPSFKYSYHDKAGIWEYSLDSNAIQRVFSISGIYQIRSQVLKPNNQAKISEVSTEIMAYQSVTNLNITCQPIAIVYIAVNCTVSISNGSFITGQIMADGLIIETLTLPDIPWERVGAVPNFFNNDFITGQSVSGIYLINGQYQYNGIITSIEFNAFKTGNIDLLLLKPSCGTYYCIATGSCAATPSCSRTLACGNEYCPLSQSCSAICNNRLLNKENSSSLPSVSYIINQVQLYPISNTGYQIVTLSVPWPVQAGYRLGFHFGNGITDLIAVTSLRSGETPNFFYNSQTVTSGTLIPSTSFTPKYISHQFSAVSVQQRNTKFKLMFNTTGIKNVTVNLQSVDNVVASASSSIIVGLNINDTSFANLGYATTNVSYMFIMNPHTGDQLLYYWDFGDNTTLNSTTRFVNHTFTVAGVYNSSVYVYNTLVSKVQNYLIYVKDAVKINFFNSSGVYNPNVFASFILSMTSGTGFNCTLSGDGIANQTQPSNNLLFGWQWATEGSFNVRIDCYNELTRDYKTLVQVIQANITGLTFVNFGGAAFEQMQLRFSWLTGSNITFLLLVNNISYSLTQNETALTGISQNITISAPGVLIGVIRATNLISDIILVANLTFSQKISNMNLIADKYYTTNGSAFNFYVNMSTGSGVRSVIQYGDGQNNTNINYESPSVYWPGISVPYTYSNVGTYNVTVNCTNIVNSQTSSVVVYVLTGLGTYEIVYNNLFFKKNDLIQLSLNRTSGYPASMTNITINWKNGDITSIPFAAFNESAIYNYVYSANGVYNVTLTLQNPLSIVVKSILLSIIDPIINFRCVNVPANTWNGNQIQLQTLVDQGQNVIYTLNPGDGGALITKNINISTLNTQYNFNYTYNTVGNYTSNIWACNQLGCQNCSNYVQIQYKIQSFDFQVQTNGNIEYLKTNLITTISFTGTNFPTALMATFTLSDGSPPSTVYLSLSMMPYNFVKNLSVVGFGNILVKLENLANSVNISATYGSFEKFSNFNVSLTWGPTRALGFGANFNTFPLNNPVYFRPSAQAKGTVVGYTFLYAPIKNLSAIFQCNATLVNGEFSYTFSTMGDFNVSFKVYNPIDQAFIENTLTIGSSIQNTQISTRPLTLMPNYFGYISIQWSVISTESCICVDFANNTKLIYGAMSGCSNCSGYLFANRKPSNNLLEILVRFSTEGDYNIKVFIYNDYESAFANRTIPVTYAQCAPPVVSMTYTQFQNPMTPQKDIRSSQIIVSAVVLDLPCILTKNNMKLWSATLMDPIYLTPIKAVDMSIIPTSNNTQLIIPPRFLNYGLYKLTFSVTMDKNVTIYTFQSSNFTYLFIDKSPIIVGLSSGGISLIVNGIDQNICFTPLQYSQDPDLNVQDFSKWIWTWTCQKTTESENLTNYVYPKPIGYSFTTPKTGCFGDGPGVVNFTSSPCFWGGNLEINGTYQLGLVGMSSDNRTGSAKIIITVVKGIPPDITVQCLRPLMCKINNVGAFAFNEVVFNPSDALLLSATCYVNGTICGQGLWNLILLNETTQIWTPLDSSIANLYIKGVYSMQISLLPSFFSFYNTIKRFQICYNSINLSTNGKSCIQFYIFPLPSGIICTLDKTTVQQTDTVCVNCTFQPNYQYRMYVNVTNECTTLGFNSTGQFCSIIPYQTVNQTYIVRVTNENGGFIDVIAGIIMVTQLQLVDLTKILTNVINGTDQTLTVAIAKGDFKEMSQVYLKYVSVLTASNQITIRT----LTSNSKENLGGTGYMTTSVNSSTMTIESLPKDIRAKYEIDRDQKSTVINSMTAGLYTMVPGDIQSLHLISSVVNAIGESSDCVNRQSQWQLSTKLASLADNFKELQKTAPRDDVLTIATNLLSANYRSDAAANIQIDNGILRDIKFSKDTYLDYDTNLESGGKNYLNVDDPSAAAYSLTLETNSNFQSKIAFGVGSNSLYTIQTISKVLRDITVLNDVPTDLLTSQMQYYSIKTQINDLSNKAFTKGRSTIILPDICAALNSPPGSCSDPNNPIGLEIIATPNNVRAYAQNPNKNGLPIPMNSDFVSLSLFLGRQISEKPVQPNGNNNFTIFISRDPVFAVPDFNFTEPDPQIQPPKSIPGTGTIFTGPQCFEQKLVVYQFKLIGSDQSVHFQIKSNFSTKCTQYLIVGRLGQPPVLGANPDGSVDSVNFTFWGMIPTHTKYCNLIPSSDMPDPFTFFVDNSMFKQSKISTKSSMPDYSKTLDTLYFGVRELTPAEYDLYTRSNRPPVPYTISAQINNTFRVRIFSTGCYFNSNNFQGGWGTAGCVVGPLTTTKVTQCICNHLTSFASGWIVAPNTIDFDYVFSNFDFTKNLTLFVTEIVVALVFIAIFIWARRMDIKDIEKVGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVACCLLLLFLTMLTTCMFYQTEGPTKTTESVLTVGPFALTSREIWIGFVTNIISFVPLFVIIEMFRRSQLKHGHANKLRQAVENHLQISLESKENKGYQGSTATLVRNEDVNSRPTTPSYRSTDQINIQIPEYEVENQDSDANEKYKKRVIKRKLLPWWMRIIVWGFLTFLVIISVVFTTFYGIQFGDIACKKWISSMFISFFTSVLLTQPIKVVLLAIFFALVCKKSSSFNNTEYINEEEELMNELGRRNALMQNEEFLHNELYSAPIKPHRFHVQPPPKEELEKAREIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTSNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFVVTKFIMWTGISETKFGKKFIKT 3472          
BLAST of PKD1L-1 vs. Planmine SMEST
Match: SMESG000066980.1 (SMESG000066980.1)

HSP 1 Score: 4213.3 bits (10926), Expect = 0.000e+0
Identity = 2084/3506 (59.44%), Postives = 2647/3506 (75.50%), Query Frame = 3
Query:  567 MGTIFKLILSILLIHFSRAEWCIKIT---LDKVVGIGTYNKDQVSLDRTLCTDECYYSGFPFTVVWKNTYCFCANDISAGINVTDFSTCATVDGFYVSASLASSLTVIFQMAMATTKFIASGNLVSMSPNIYYYAPPGPPPSFKYSYHDKAGIWEYSLDSNAIQRVFSISGIYQIRSQVLKPNNQAKISEVSTEIMAYQSVTNLNITCQPIAIVYIAVNCTVSISNGSFITGQIMADGLIIETLTLPDIPWERVGAVPNFFNNDFITGQSVSGIYLINGQYQYNGIITSIEFNAFKTGNIDLLLLKPSCGTYYCIATGSCAATPSCSRTLACGNEYCPLSQSCSAICNNRLLNKENSSSLPSVSYIINQVQLYPISNTGYQIVTLSVPWPVQAGYRLGFHFGNGITDLIAVTSLRSGETPNFFYNSQTVTSGTLIPSTSFTPKYISHQFSAVSVQQRNTKFKLMFNTTGIKNVTVNLQXXXXXXXXXXXXXXXGLNINDTSFANLGYATTNVSYMFIMNPHTGDQLLYYWDFGDNTTLNSTTRFVNHTFTVAGVYNSSVYVYNTLVSKVQNYLIYVKDAVKINFFNSSGVYNPNVFASFILSMKSGTGFNCTLSGDGIANQTQPSNNLLFGWQWATEGSFNVRIDCYNELTRDYKTLVQVIQANITGLTFVNFGGAAFEQMQLRFSWLTGSNITFLLLVNNISYSLTQNETALTGISQNITISAPGVLIGVIRATNLISDIILVANLTFSQKISNMNLIADKYYTTNGSAFNFYVNMSTGSGVRSVIQYGDGQNNTNIN--YESPSVYWPGISVPYTYSNVGTYNVTVNCTNIVNSQTSSVVVYVLTGLGTYEIVYNNLFFKKNDLIQLSLNRTSGYPASMTNITINWQNGDITSIPFAAFNESAIYNYVYSANGVYNVTLTLQNPLSTVVKSILLSIIDPIINFRCVNVPANTWNGNQIQLQTLVDQGQNVIYTLNPGDGGALITKNINISXXXXXXXXXXXXXXVGNYTSNIWACNQLGCQNCSNYVQIQYKIQSFDFQVQTNGNIEYLKTNLITTISFTGTNFPTALMATFTLSDGSPPSTVYLSLSMMPYNFVKNLSVVGFGNILVKLENLANSVNISATYGSFEKFSNFNVSLTWGPTRALGFGANFNTFPLNNPVYFRPSAQAKGTVVGYTFLYAPIKNLSAIFQCNATLVNGEFSYTFSTMGDFNVSFKVYNPIDQAFIENTLTIGSSIQNTQISTRPLTLMPNYFGYISIQWSVISTESCICVDFANNTKLIYGAMSGCSNCSGYLFANRKPSNNLLEILVRFSTEGDYNIKVFIYNDYESAFANRTIPVTYAQCAPPVVSMTYTQFQNPMTPQKDIRSSQIIVSAVVLDLPCILTKNNMKLWSATLMDPIYLTPIKAVDMSIIPTSNNTQLIIPPRFLNYGLYKLTFSVTMDKNVTIYTFQSSNFTYLFIDKSPIIVGLSSGGISLIVNGIDQNICFTPLQYSQDPDLNVQDFSKWIWTWTCQKTTESENLTNYVYPKPIGYSFTTPKTGCFGDGPGVVNFTSSPCFWGGNLEINGTYQLGLVGMSSDNRTGSAKIIITVVKGIPPDITVQCLRPLMCKINNVGAFAFNEVVFNPSDALLLSATCYGNGTICGQGLWNLILLNETTQIWTPLDSSIANLYIKGVYSMQISLLPSFFSFYNTIKRFQICYNSINLTPNGKSCIQFYIFPLPSGIICTLDKTTVQQTDTVCVNCTFQPNYQYRMYVNVTNECSTLGFNSTGQFCSIIPYQTVNQTYIVRVTNENGGFIDVIAGIIMVTQLQLVDLTKILTNVINGTDQTLTVAIAKGDFKEMSQVYLKYVSVLTASNQITIRNLF----------------------QPLTN--NSKENLGGTGYMTTSVNSSTMTIESLPKDIRAKYEIDRDQKSTVINSMTAGLYTMVPGDIQSLHLISSVVNAIGESSDCVNRQSQWQLSTKLASLADNFKELQKTAPRDDVLTIATNLLSANYRSDAAANIQIDNGILRDIKFSKDTYLDYDTNLESGGKNYLNVDDPSAAAYSLTLETNSNFQSKIAFGVGSNSLYTIQTISKVLRDITVLNDVPTDLLTSQMQYYSIKTQINDLSNKAFTKGRSTIILPDICAALNSPPGSCSDPNNPIGLEIIATPNNVRAYAQNPNKNGLPIPMNSDFVSLSLFLGRQISEKPVQPNGNNNFTIFISRDPVFAVPDFNFTEPDPQIQPPKSIPGTGTIFTGPQCFEQKLVVYQFKLIGSDQSVHFQIKSNFSTKCTQYLIVGRLGQPPVLGANPDGSVDSVNFTFWGMIPTHTKYCNLIPSSDMPDPFTFFVDNSMFKQSKISTKSSMPDYSKTLDTLYFGVRELTPAEYDLYTRSNRPPVPYTISAQINNTFRVRIFSTGCYFNSNNFQGGWGTAGCVVGPLTTTKVTQCICNHLTSFASGWIVAPNTIDFDYVFSNFDFTKNLTLFVTEXXXXXXXXXXXXWARRMDIKDIEKVGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVA-------------------*GPTKTTESVLTVGPFALTSREIWIGFVTNIISFVPLFVIIEMFRRSQLKHGHANKLRQAVENHLQISLESKENKGYQGSTATLVRNEDVN-SRPTTPSYRSTDQINIQIPEYEVENQDSDANEKYKKRVIKRKLLPWWMRIIVWGFLTFLVIISVVFTTFYGIQFGDIACKKWISSMFISFFTSVLLTQPIKVVLLAIFFALVCKKSSSFXXXXXXXXXXXXXXXLGRRNALMQNEEFLHNELYSAPIKPHRFHVQPPPKEELEKAREIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTSNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFVVTKFIMWTGISETKFGKKFIKT 10937
            M  +  +IL ++L++ S+AEWCI +T        G GTY    +S D T C DEC+  G  +++VWKN YCFCAND+S  IN TD   C + DG  VS++++ S+  +F +    +  +   N +  +P  Y   P      FKYSY D+ GIWE++ + + IQR++S  G+YQ+R+Q  K  N+AKI E  +EI+ Y++++N+N+TCQ +A+VYI  NCTV I  GS++ G I  +GL  E + + D   ER+G+VPNFFNNDFI+G S++GI +IN  +QY+G+++ +EFNA +   ID+LLL+P C   +C A   C  +  C R L C +E+CPLS  CS +CN+RLLN EN + LP ++YII++     I   GYQI  L VPWPV+AG+RL FH      D+IAVT LRSGE+ NF+ N+ TVT GT + + SFTP  + HQFSA+S  QRN  FK+MFNT+GIKNV++NLQSVDN++ S S+S++V LNINDTSFA  G+  TN S  F MNPHTG+ L YYW FGDNTTLNST+  VNHTF   G YN+SVYVYN +V+KVQ YL+ VKD V IN+FNS+G+  PNV A+F L M SGTGFNCTLSGD I N TQPS NL F +QW T+G +NVRIDCYNE +RD K+LVQ+IQ+N+TGL F +  G   E   L+F+W TGSNITF +L+NN+SY+   NE+   G ++NIT+   GV IG+IRA N +SD ILV+N+T+ Q+I+ +  I DK Y +NGSA  F VN++TGS V S+I + DG N T I+  YE+   +    SVP+ + +VG+YNVTVNC+N V+SQ + ++VY++T LGTY I  +N FFK +D+IQLSLNRTSG PA MTN+TINWQN +I +IP+ +FNESAIY   YS NG YNVT  LQNPLST V S+L++I++PI+NFRC  VPANTWNGN + L+T  D G NV+ TLNPGDG A     INI+ +N +Y+FNYTYNTVGNY+SNIWACNQLGCQNCSNYVQIQYKI   DFQ  T+GNIEY+ TNL TT++F+GTNFPTAL A F  SDGSPP ++ L+  MMPY  +KNLS  GFG   V L+NLANS N +A+Y +F K+ N +V++ WGP + +GFG+  N FPLNN +Y RP++Q  GT+V  T  Y   K+ S +  CN+T +NGE ++T S+MG+ N+S  +YNPID       + IGSSIQNT+I+T P TL+P Y+G+I + WS+IS  +CICVD A+  K IYGA SGC  C  Y + N  P NN + I VR+  +GDY I V IYN +ES  A+R I VT   CAPP + MTY  +QN  +PQ +IRS+QII+S +V D+PC +T NN KLW+A L+DP YLT +K +D+S IPT+NN+QLIIPP+FL+YGLYK T +VTMDK++T++TFQSSNFT+L I KSP+IVGLSSGG+++I   I ++ICFTPL YSQDPDLNVQDF  W W WTCQ+  E  N +N VYPKP  Y ++ PKTGCFGDGPGVVNFT+SPCF G NL+I+  Y   L   + DNRTGS+ I + VV G  P+IT+QC RPLMC IN  G +AFNEV+FNPSD+L+LSATC     IC +G W++  LN+    W   + +I N Y+KG  S+Q+SL+P FF+ Y+ + R QICYNS  L  NG  CIQF I+PLP G+ C L+   + Q   +CVNCTF  +YQYRM++N T    TLG+  TG  CSI+PYQ   Q Y+VRVTN NGGF DV+AG + VTQ+   DL   + N+++G D++L +AIAK +F++M+Q+Y+KY+SVL+ SNQ T++NLF                      +  +N  N +  LGG+GY++ +V    + I++LP D R  YE DRDQKS+VIN MT+GL + VPG+I+SL+L SSV+++ G+SSDC+NR SQ Q+S  L ++A  F+ LQ TA ++D+L I  NLL AN+ SD AAN+QI++GILRDI+ SKD Y+DYDTN+ S GK+YL V DP+ A  SL LETN+NFQSK+A G+GSN+  +I  I +++R + V+ D P    T+ + Y + K   + L NK F  GRS + LPDIC +LN  PG+CS+PNNPI +E+I TPNN+R+Y  N N +GLPIP  SD+++++L+ G   S+    PN + NFTIF++RDP F +PDFN +E DPQI PPK+IPGTGT+F+GP  FEQKLVVY F L G+DQS+HFQ+KSNFS  CTQYL+VGRL QPP+LG NPDG+ DS+NFTFWGMIP+ TKYCN+ P ++ PDPFTFFV N++FKQSK S   SMPDYSKTL+T+YFGVRELTP E++ YT +NRPPVPYTISAQIN+TFRVRIFS+GCYF S++ +  WGT GCVVGPLTT++ TQCICNHLTSF+SGW+VAPN IDF+Y+FSNFDFTKN+TLF TEI +A+VFI + +WARR DIKDIEKVG+TPL SND  DMYLYEV +DTSIR NAGT+SNVYFILSGE +ETDP HLVD+KR ILKRGNVDRFLLAVPRSLG +Q+IRLWHDNSGKG NASWYCN  G+ DLQTKEKF+FLVN WFAVEE+DGQIDR+I VA ++ELL+F+E+FSRKMK NLSEDHLWLSI+ARPPESRFTRVERVA                    GP+K   ++LT+GPFAL+++E+W GF++NII+FVPLFV+IE+FRRS LKHG+AN LR+AVENHLQISL S + KGY  STA L+ NED+N SRP +   RS   INIQ+ E + +  D D  EK +  V+++KL PWWMRI  W FL  L+I++ V TTFYGIQFGD+ACKKWISSMFISFFTSVLL QPIKV+ LAIFFAL+CK SS+F + EYI EE+E+M+ELGRRNA+MQNEE+LH ELY+APIKPH+   +PP +EE+EKARE+RLKELQMYDV RE+ FY+ FFCTLLF++YS R P++Y L+NEL N+FIK + P+  FT IT E  FW W L V VP +RAPVWYNNDP ++QRGFISNRNNRLIGYA++RQVR+KK+SC V DY K + K+CYS Y+IFNQDE SYG GWT L+ +DT    F + +E  L+G+ YIGR+  YSGGGYVY+ + +V+ L+ +++AL+DN WIDFQTRAIFIEFTT+NPNINLFAI+T+V E PG+GG+WTIYR+EPANLLGLYSGGVKAFEIFCQVLYGIFILVI+VKEIRN +KQKWKYF+QFWN IE+FI+IGS ++ AGF YV IAT++LT KF+QYGG VYLNFA VAF NE   Y+VS I+F AT+KFI++LRFN+RIGMLG+VL+YT+ DMKQFFIIF IMFLAFVM+FYSLFMDSLYRYH+FLFA E+SM I LGKF FLELYQK PIFGPIVFAG+VLFI+FVLLNMF+AILY+GF VVK DI+LQ +DHEL++F+ TKF+MWTGI++TK GKKFIKT
Sbjct:    1 MKFVVTIILIVVLLNDSKAEWCISLTELPFSNFAGAGTYLSSDLSSDNTTCLDECFAMGMTYSLVWKNLYCFCANDLSKQINTTDSIPCLSSDGLMVSSAVSGSIITVFDVLQTNSSAVTGTNPIFFTPKSYITDPSNSQFGFKYSYQDRPGIWEFTPNQSPIQRIYSAPGVYQVRAQAAKLINRAKIRETYSEILVYETLSNINLTCQSLAVVYITANCTVMIGTGSYLKGTISVNGLEFEKINIFDFKCERIGSVPNFFNNDFISG-SMAGINIINTVFQYDGVVSYVEFNARQIATIDILLLRPDCPASFCTANNICDPSSKCPRKLLC-SEFCPLSICCSNVCNSRLLNGENITVLP-INYIIDRSVTINILQVGYQIANLGVPWPVKAGHRLAFHSLTN-NDVIAVTILRSGESSNFYSNAHTVTVGTYLTAASFTPINMEHQFSAISQPQRNLVFKIMFNTSGIKNVSINLQSVDNIMVSGSTSILVSLNINDTSFAPPGFCITNESCTFRMNPHTGELLQYYWTFGDNTTLNSTSGIVNHTFPAFGTYNASVYVYNAIVTKVQYYLVTVKDKVIINYFNSTGICGPNVSANFNLWMISGTGFNCTLSGDLITNITQPSTNLQFAFQWPTDGYYNVRIDCYNEGSRDTKSLVQIIQSNVTGLAFTSTIGITSEPTSLQFTWSTGSNITFSVLINNVSYNFVANESIKLGSTENITLPIIGVYIGIIRAINFVSDAILVSNITYYQRITGLQFIPDKIYISNGSAITFTVNLTTGSLVTSLINFSDGTNQTFISSLYET---WTNNYSVPHIFPDVGSYNVTVNCSNPVSSQFAYIIVYIITNLGTYTIQRDNQFFKLSDIIQLSLNRTSGTPALMTNLTINWQNANIVNIPYTSFNESAIYYNQYSTNGAYNVTFLLQNPLSTFVASVLITIMNPIVNFRCSYVPANTWNGNMMSLKTFADSGDNVVLTLNPGDGSASTVNTINITNINQEYDFNYTYNTVGNYSSNIWACNQLGCQNCSNYVQIQYKIIKTDFQYITSGNIEYINTNLTTTLTFSGTNFPTALTAIFNFSDGSPPLSLLLTSGMMPYTLMKNLSKPGFGVSTVILQNLANSENFTASYEAFVKYINVSVTVLWGPKKLIGFGSLLNIFPLNNYLYLRPNSQMIGTIVNGTVTYYDSKSSSTVLLCNSTFINGELNFTISSMGNVNLSLTLYNPIDTITSSLPIIIGSSIQNTEITTSPSTLLPGYYGFIIVTWSIISATNCICVDVADGRKFIYGATSGCDKCINYNYTNIVPVNNQISISVRYLIQGDYKINVSIYNSFESGNASRIISVTTNPCAPPTLLMTYPTYQNSFSPQTEIRSNQIIISGIVSDIPCTMTTNNYKLWTAVLIDPNYLTTMKEIDLSSIPTANNSQLIIPPKFLSYGLYKFTLTVTMDKSITVFTFQSSNFTFLQIVKSPLIVGLSSGGLTIISRSIQEDICFTPLIYSQDPDLNVQDFLNWNWVWTCQEKNEIMNTSNIVYPKPRNYQYSFPKTGCFGDGPGVVNFTTSPCFAGNNLDIDKMYMFNLTARAPDNRTGSSLINVRVVNGTSPNITIQCSRPLMCNINKNGQYAFNEVLFNPSDSLILSATCVCLNVICEKGFWSI--LNQVASSWETFNQTIVNSYVKGFNSLQMSLIPDFFTAYSNLTRIQICYNSDGLPTNGFGCIQFAIYPLPKGVTCQLNTNIIPQVANLCVNCTFNSDYQYRMFINNTGSILTLGYTGTGYLCSIVPYQPFAQAYMVRVTNSNGGFTDVLAGNVTVTQMTSQDLNSTINNLLSGADKSLQLAIAKANFQDMAQIYMKYISVLSVSNQNTLQNLFGSKNLLSCVYTIRFLLNEIDWLEKASNLSNIQPYLGGSGYLSQNVGPGVLVIDNLPADKRLLYEKDRDQKSSVINLMTSGLSSFVPGNIKSLYLASSVLSSFGDSSDCINRISQMQISNNLRNMAGYFQNLQGTATKEDILEIGKNLLQANFLSDTAANVQINDGILRDIQQSKDNYMDYDTNMYSKGKSYLAVSDPNQAGNSLVLETNANFQSKVASGIGSNAGQSINIIKRIMRSVMVVGDEPISFQTNNLHYVASKQVGSALKNKTFLAGRSVVQLPDICQSLNISPGNCSNPNNPISVEMIGTPNNIRSYLSNSNVDGLPIPSKSDYLTVNLYTGTNSSDISASPNDSQNFTIFVTRDPSFQIPDFNMSESDPQISPPKTIPGTGTLFSGPASFEQKLVVYTFTLSGTDQSIHFQMKSNFSINCTQYLVVGRLAQPPILGPNPDGTSDSINFTFWGMIPSDTKYCNMSPQNNEPDPFTFFVSNNLFKQSKFSALQSMPDYSKTLNTIYFGVRELTPPEWNSYTSNNRPPVPYTISAQINHTFRVRIFSSGCYFLSDDNKNSWGTNGCVVGPLTTSQKTQCICNHLTSFSSGWLVAPNAIDFNYIFSNFDFTKNVTLFATEIAIAVVFILLLVWARRQDIKDIEKVGLTPLASNDPKDMYLYEVIVDTSIRNNAGTTSNVYFILSGELNETDPTHLVDSKRKILKRGNVDRFLLAVPRSLGAMQFIRLWHDNSGKGTNASWYCNCLGIIDLQTKEKFNFLVNKWFAVEEDDGQIDRIIPVAGINELLYFQEMFSRKMKANLSEDHLWLSIIARPPESRFTRVERVACCLLLLFLTMLTTCMFYQTEGPSKPVSNILTIGPFALSAKELWTGFISNIIAFVPLFVLIELFRRSSLKHGYANLLREAVENHLQISLNSDKVKGYHSSTANLIWNEDLNISRPAS---RSMGHINIQLNENDTKIDDMDVQEK-ETPVVRQKLFPWWMRIFAWTFLITLLIVASVLTTFYGIQFGDLACKKWISSMFISFFTSVLLVQPIKVICLAIFFALLCKDSSAF-DVEYIGEEDEIMDELGRRNAIMQNEEYLHQELYTAPIKPHKICFRPPSQEEIEKARELRLKELQMYDVIREVGFYLAFFCTLLFISYSLRHPDSYDLQNELKNVFIKQA-PDSSFTDITSETLFWNWILLVFVPRIRAPVWYNNDPPIFQRGFISNRNNRLIGYAIIRQVRSKKDSCKVNDYVKHLIKHCYSQYDIFNQDEKSYGFGWTELNTSDTSESPFLYSNESSLDGLPYIGRLSTYSGGGYVYKLKDDVNTLYNDLSALRDNKWIDFQTRAIFIEFTTFNPNINLFAIHTYVAEMPGNGGLWTIYRIEPANLLGLYSGGVKAFEIFCQVLYGIFILVIVVKEIRNFLKQKWKYFSQFWNFIELFIIIGSLLSAAGFAYVTIATNKLTGKFSQYGGSVYLNFAQVAFWNEYFSYLVSLIIFCATIKFIRVLRFNKRIGMLGAVLSYTATDMKQFFIIFFIMFLAFVMMFYSLFMDSLYRYHSFLFAIESSMNIPLGKFGFLELYQKAPIFGPIVFAGFVLFIVFVLLNMFVAILYNGFTVVKEDIDLQSSDHELMRFIFTKFVMWTGINDTKLGKKFIKT 3491          
BLAST of PKD1L-1 vs. Planmine SMEST
Match: SMESG000066980.1 (SMESG000066980.1)

HSP 1 Score: 4213.3 bits (10926), Expect = 0.000e+0
Identity = 2082/3484 (59.76%), Postives = 2644/3484 (75.89%), Query Frame = 3
Query:  567 MGTIFKLILSILLIHFSRAEWCIKIT---LDKVVGIGTYNKDQVSLDRTLCTDECYYSGFPFTVVWKNTYCFCANDISAGINVTDFSTCATVDGFYVSASLASSLTVIFQMAMATTKFIASGNLVSMSPNIYYYAPPGPPPSFKYSYHDKAGIWEYSLDSNAIQRVFSISGIYQIRSQVLKPNNQAKISEVSTEIMAYQSVTNLNITCQPIAIVYIAVNCTVSISNGSFITGQIMADGLIIETLTLPDIPWERVGAVPNFFNNDFITGQSVSGIYLINGQYQYNGIITSIEFNAFKTGNIDLLLLKPSCGTYYCIATGSCAATPSCSRTLACGNEYCPLSQSCSAICNNRLLNKENSSSLPSVSYIINQVQLYPISNTGYQIVTLSVPWPVQAGYRLGFHFGNGITDLIAVTSLRSGETPNFFYNSQTVTSGTLIPSTSFTPKYISHQFSAVSVQQRNTKFKLMFNTTGIKNVTVNLQXXXXXXXXXXXXXXXGLNINDTSFANLGYATTNVSYMFIMNPHTGDQLLYYWDFGDNTTLNSTTRFVNHTFTVAGVYNSSVYVYNTLVSKVQNYLIYVKDAVKINFFNSSGVYNPNVFASFILSMKSGTGFNCTLSGDGIANQTQPSNNLLFGWQWATEGSFNVRIDCYNELTRDYKTLVQVIQANITGLTFVNFGGAAFEQMQLRFSWLTGSNITFLLLVNNISYSLTQNETALTGISQNITISAPGVLIGVIRATNLISDIILVANLTFSQKISNMNLIADKYYTTNGSAFNFYVNMSTGSGVRSVIQYGDGQNNTNIN--YESPSVYWPGISVPYTYSNVGTYNVTVNCTNIVNSQTSSVVVYVLTGLGTYEIVYNNLFFKKNDLIQLSLNRTSGYPASMTNITINWQNGDITSIPFAAFNESAIYNYVYSANGVYNVTLTLQNPLSTVVKSILLSIIDPIINFRCVNVPANTWNGNQIQLQTLVDQGQNVIYTLNPGDGGALITKNINISXXXXXXXXXXXXXXVGNYTSNIWACNQLGCQNCSNYVQIQYKIQSFDFQVQTNGNIEYLKTNLITTISFTGTNFPTALMATFTLSDGSPPSTVYLSLSMMPYNFVKNLSVVGFGNILVKLENLANSVNISATYGSFEKFSNFNVSLTWGPTRALGFGANFNTFPLNNPVYFRPSAQAKGTVVGYTFLYAPIKNLSAIFQCNATLVNGEFSYTFSTMGDFNVSFKVYNPIDQAFIENTLTIGSSIQNTQISTRPLTLMPNYFGYISIQWSVISTESCICVDFANNTKLIYGAMSGCSNCSGYLFANRKPSNNLLEILVRFSTEGDYNIKVFIYNDYESAFANRTIPVTYAQCAPPVVSMTYTQFQNPMTPQKDIRSSQIIVSAVVLDLPCILTKNNMKLWSATLMDPIYLTPIKAVDMSIIPTSNNTQLIIPPRFLNYGLYKLTFSVTMDKNVTIYTFQSSNFTYLFIDKSPIIVGLSSGGISLIVNGIDQNICFTPLQYSQDPDLNVQDFSKWIWTWTCQKTTESENLTNYVYPKPIGYSFTTPKTGCFGDGPGVVNFTSSPCFWGGNLEINGTYQLGLVGMSSDNRTGSAKIIITVVKGIPPDITVQCLRPLMCKINNVGAFAFNEVVFNPSDALLLSATCYGNGTICGQGLWNLILLNETTQIWTPLDSSIANLYIKGVYSMQISLLPSFFSFYNTIKRFQICYNSINLTPNGKSCIQFYIFPLPSGIICTLDKTTVQQTDTVCVNCTFQPNYQYRMYVNVTNECSTLGFNSTGQFCSIIPYQTVNQTYIVRVTNENGGFIDVIAGIIMVTQLQLVDLTKILTNVINGTDQTLTVAIAKGDFKEMSQVYLKYVSVLTASNQITIR--NLFQPLTNNSKENLGGTGYMTTSVNSSTMTIESLPKDIRAKYEIDRDQKSTVINSMTAGLYTMVPGDIQSLHLISSVVNAIGESSDCVNRQSQWQLSTKLASLADNFKELQKTAPRDDVLTIATNLLSANYRSDAAANIQIDNGILRDIKFSKDTYLDYDTNLESGGKNYLNVDDPSAAAYSLTLETNSNFQSKIAFGVGSNSLYTIQTISKVLRDITVLNDVPTDLLTSQMQYYSIKTQINDLSNKAFTKGRSTIILPDICAALNSPPGSCSDPNNPIGLEIIATPNNVRAYAQNPNKNGLPIPMNSDFVSLSLFLGRQISEKPVQPNGNNNFTIFISRDPVFAVPDFNFTEPDPQIQPPKSIPGTGTIFTGPQCFEQKLVVYQFKLIGSDQSVHFQIKSNFSTKCTQYLIVGRLGQPPVLGANPDGSVDSVNFTFWGMIPTHTKYCNLIPSSDMPDPFTFFVDNSMFKQSKISTKSSMPDYSKTLDTLYFGVRELTPAEYDLYTRSNRPPVPYTISAQINNTFRVRIFSTGCYFNSNNFQGGWGTAGCVVGPLTTTKVTQCICNHLTSFASGWIVAPNTIDFDYVFSNFDFTKNLTLFVTEXXXXXXXXXXXXWARRMDIKDIEKVGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVA-------------------*GPTKTTESVLTVGPFALTSREIWIGFVTNIISFVPLFVIIEMFRRSQLKHGHANKLRQAVENHLQISLESKENKGYQGSTATLVRNEDVN-SRPTTPSYRSTDQINIQIPEYEVENQDSDANEKYKKRVIKRKLLPWWMRIIVWGFLTFLVIISVVFTTFYGIQFGDIACKKWISSMFISFFTSVLLTQPIKVVLLAIFFALVCKKSSSFXXXXXXXXXXXXXXXLGRRNALMQNEEFLHNELYSAPIKPHRFHVQPPPKEELEKAREIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTSNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFVVTKFIMWTGISETKFGKKFIKT 10937
            M  +  +IL ++L++ S+AEWCI +T        G GTY    +S D T C DEC+  G  +++VWKN YCFCAND+S  IN TD   C + DG  VS++++ S+  +F +    +  +   N +  +P  Y   P      FKYSY D+ GIWE++ + + IQR++S  G+YQ+R+Q  K  N+AKI E  +EI+ Y++++N+N+TCQ +A+VYI  NCTV I  GS++ G I  +GL  E + + D   ER+G+VPNFFNNDFI+G S++GI +IN  +QY+G+++ +EFNA +   ID+LLL+P C   +C A   C  +  C R L C +E+CPLS  CS +CN+RLLN EN + LP ++YII++     I   GYQI  L VPWPV+AG+RL FH      D+IAVT LRSGE+ NF+ N+ TVT GT + + SFTP  + HQFSA+S  QRN  FK+MFNT+GIKNV++NLQSVDN++ S S+S++V LNINDTSFA  G+  TN S  F MNPHTG+ L YYW FGDNTTLNST+  VNHTF   G YN+SVYVYN +V+KVQ YL+ VKD V IN+FNS+G+  PNV A+F L M SGTGFNCTLSGD I N TQPS NL F +QW T+G +NVRIDCYNE +RD K+LVQ+IQ+N+TGL F +  G   E   L+F+W TGSNITF +L+NN+SY+   NE+   G ++NIT+   GV IG+IRA N +SD ILV+N+T+ Q+I+ +  I DK Y +NGSA  F VN++TGS V S+I + DG N T I+  YE+   +    SVP+ + +VG+YNVTVNC+N V+SQ + ++VY++T LGTY I  +N FFK +D+IQLSLNRTSG PA MTN+TINWQN +I +IP+ +FNESAIY   YS NG YNVT  LQNPLST V S+L++I++PI+NFRC  VPANTWNGN + L+T  D G NV+ TLNPGDG A     INI+ +N +Y+FNYTYNTVGNY+SNIWACNQLGCQNCSNYVQIQYKI   DFQ  T+GNIEY+ TNL TT++F+GTNFPTAL A F  SDGSPP ++ L+  MMPY  +KNLS  GFG   V L+NLANS N +A+Y +F K+ N +V++ WGP + +GFG+  N FPLNN +Y RP++Q  GT+V  T  Y   K+ S +  CN+T +NGE ++T S+MG+ N+S  +YNPID       + IGSSIQNT+I+T P TL+P Y+G+I + WS+IS  +CICVD A+  K IYGA SGC  C  Y + N  P NN + I VR+  +GDY I V IYN +ES  A+R I VT   CAPP + MTY  +QN  +PQ +IRS+QII+S +V D+PC +T NN KLW+A L+DP YLT +K +D+S IPT+NN+QLIIPP+FL+YGLYK T +VTMDK++T++TFQSSNFT+L I KSP+IVGLSSGG+++I   I ++ICFTPL YSQDPDLNVQDF  W W WTCQ+  E  N +N VYPKP  Y ++ PKTGCFGDGPGVVNFT+SPCF G NL+I+  Y   L   + DNRTGS+ I + VV G  P+IT+QC RPLMC IN  G +AFNEV+FNPSD+L+LSATC     IC +G W++  LN+    W   + +I N Y+KG  S+Q+SL+P FF+ Y+ + R QICYNS  L  NG  CIQF I+PLP G+ C L+   + Q   +CVNCTF  +YQYRM++N T    TLG+  TG  CSI+PYQ   Q Y+VRVTN NGGF DV+AG + VTQ+   DL   + N+++G D++L +AIAK +F++M+Q+Y+KY+SVL+ SNQ T++  NL     +N +  LGG+GY++ +V    + I++LP D R  YE DRDQKS+VIN MT+GL + VPG+I+SL+L SSV+++ G+SSDC+NR SQ Q+S  L ++A  F+ LQ TA ++D+L I  NLL AN+ SD AAN+QI++GILRDI+ SKD Y+DYDTN+ S GK+YL V DP+ A  SL LETN+NFQSK+A G+GSN+  +I  I +++R + V+ D P    T+ + Y + K   + L NK F  GRS + LPDIC +LN  PG+CS+PNNPI +E+I TPNN+R+Y  N N +GLPIP  SD+++++L+ G   S+    PN + NFTIF++RDP F +PDFN +E DPQI PPK+IPGTGT+F+GP  FEQKLVVY F L G+DQS+HFQ+KSNFS  CTQYL+VGRL QPP+LG NPDG+ DS+NFTFWGMIP+ TKYCN+ P ++ PDPFTFFV N++FKQSK S   SMPDYSKTL+T+YFGVRELTP E++ YT +NRPPVPYTISAQIN+TFRVRIFS+GCYF S++ +  WGT GCVVGPLTT++ TQCICNHLTSF+SGW+VAPN IDF+Y+FSNFDFTKN+TLF TEI +A+VFI + +WARR DIKDIEKVG+TPL SND  DMYLYEV +DTSIR NAGT+SNVYFILSGE +ETDP HLVD+KR ILKRGNVDRFLLAVPRSLG +Q+IRLWHDNSGKG NASWYCN  G+ DLQTKEKF+FLVN WFAVEE+DGQIDR+I VA ++ELL+F+E+FSRKMK NLSEDHLWLSI+ARPPESRFTRVERVA                    GP+K   ++LT+GPFAL+++E+W GF++NII+FVPLFV+IE+FRRS LKHG+AN LR+AVENHLQISL S + KGY  STA L+ NED+N SRP +   RS   INIQ+ E + +  D D  EK +  V+++KL PWWMRI  W FL  L+I++ V TTFYGIQFGD+ACKKWISSMFISFFTSVLL QPIKV+ LAIFFAL+CK SS+F + EYI EE+E+M+ELGRRNA+MQNEE+LH ELY+APIKPH+   +PP +EE+EKARE+RLKELQMYDV RE+ FY+ FFCTLLF++YS R P++Y L+NEL N+FIK + P+  FT IT E  FW W L V VP +RAPVWYNNDP ++QRGFISNRNNRLIGYA++RQVR+KK+SC V DY K + K+CYS Y+IFNQDE SYG GWT L+ +DT    F + +E  L+G+ YIGR+  YSGGGYVY+ + +V+ L+ +++AL+DN WIDFQTRAIFIEFTT+NPNINLFAI+T+V E PG+GG+WTIYR+EPANLLGLYSGGVKAFEIFCQVLYGIFILVI+VKEIRN +KQKWKYF+QFWN IE+FI+IGS ++ AGF YV IAT++LT KF+QYGG VYLNFA VAF NE   Y+VS I+F AT+KFI++LRFN+RIGMLG+VL+YT+ DMKQFFIIF IMFLAFVM+FYSLFMDSLYRYH+FLFA E+SM I LGKF FLELYQK PIFGPIVFAG+VLFI+FVLLNMF+AILY+GF VVK DI+LQ +DHEL++F+ TKF+MWTGI++TK GKKFIKT
Sbjct:    1 MKFVVTIILIVVLLNDSKAEWCISLTELPFSNFAGAGTYLSSDLSSDNTTCLDECFAMGMTYSLVWKNLYCFCANDLSKQINTTDSIPCLSSDGLMVSSAVSGSIITVFDVLQTNSSAVTGTNPIFFTPKSYITDPSNSQFGFKYSYQDRPGIWEFTPNQSPIQRIYSAPGVYQVRAQAAKLINRAKIRETYSEILVYETLSNINLTCQSLAVVYITANCTVMIGTGSYLKGTISVNGLEFEKINIFDFKCERIGSVPNFFNNDFISG-SMAGINIINTVFQYDGVVSYVEFNARQIATIDILLLRPDCPASFCTANNICDPSSKCPRKLLC-SEFCPLSICCSNVCNSRLLNGENITVLP-INYIIDRSVTINILQVGYQIANLGVPWPVKAGHRLAFHSLTN-NDVIAVTILRSGESSNFYSNAHTVTVGTYLTAASFTPINMEHQFSAISQPQRNLVFKIMFNTSGIKNVSINLQSVDNIMVSGSTSILVSLNINDTSFAPPGFCITNESCTFRMNPHTGELLQYYWTFGDNTTLNSTSGIVNHTFPAFGTYNASVYVYNAIVTKVQYYLVTVKDKVIINYFNSTGICGPNVSANFNLWMISGTGFNCTLSGDLITNITQPSTNLQFAFQWPTDGYYNVRIDCYNEGSRDTKSLVQIIQSNVTGLAFTSTIGITSEPTSLQFTWSTGSNITFSVLINNVSYNFVANESIKLGSTENITLPIIGVYIGIIRAINFVSDAILVSNITYYQRITGLQFIPDKIYISNGSAITFTVNLTTGSLVTSLINFSDGTNQTFISSLYET---WTNNYSVPHIFPDVGSYNVTVNCSNPVSSQFAYIIVYIITNLGTYTIQRDNQFFKLSDIIQLSLNRTSGTPALMTNLTINWQNANIVNIPYTSFNESAIYYNQYSTNGAYNVTFLLQNPLSTFVASVLITIMNPIVNFRCSYVPANTWNGNMMSLKTFADSGDNVVLTLNPGDGSASTVNTINITNINQEYDFNYTYNTVGNYSSNIWACNQLGCQNCSNYVQIQYKIIKTDFQYITSGNIEYINTNLTTTLTFSGTNFPTALTAIFNFSDGSPPLSLLLTSGMMPYTLMKNLSKPGFGVSTVILQNLANSENFTASYEAFVKYINVSVTVLWGPKKLIGFGSLLNIFPLNNYLYLRPNSQMIGTIVNGTVTYYDSKSSSTVLLCNSTFINGELNFTISSMGNVNLSLTLYNPIDTITSSLPIIIGSSIQNTEITTSPSTLLPGYYGFIIVTWSIISATNCICVDVADGRKFIYGATSGCDKCINYNYTNIVPVNNQISISVRYLIQGDYKINVSIYNSFESGNASRIISVTTNPCAPPTLLMTYPTYQNSFSPQTEIRSNQIIISGIVSDIPCTMTTNNYKLWTAVLIDPNYLTTMKEIDLSSIPTANNSQLIIPPKFLSYGLYKFTLTVTMDKSITVFTFQSSNFTFLQIVKSPLIVGLSSGGLTIISRSIQEDICFTPLIYSQDPDLNVQDFLNWNWVWTCQEKNEIMNTSNIVYPKPRNYQYSFPKTGCFGDGPGVVNFTTSPCFAGNNLDIDKMYMFNLTARAPDNRTGSSLINVRVVNGTSPNITIQCSRPLMCNINKNGQYAFNEVLFNPSDSLILSATCVCLNVICEKGFWSI--LNQVASSWETFNQTIVNSYVKGFNSLQMSLIPDFFTAYSNLTRIQICYNSDGLPTNGFGCIQFAIYPLPKGVTCQLNTNIIPQVANLCVNCTFNSDYQYRMFINNTGSILTLGYTGTGYLCSIVPYQPFAQAYMVRVTNSNGGFTDVLAGNVTVTQMTSQDLNSTINNLLSGADKSLQLAIAKANFQDMAQIYMKYISVLSVSNQNTLQTSNL-----SNIQPYLGGSGYLSQNVGPGVLVIDNLPADKRLLYEKDRDQKSSVINLMTSGLSSFVPGNIKSLYLASSVLSSFGDSSDCINRISQMQISNNLRNMAGYFQNLQGTATKEDILEIGKNLLQANFLSDTAANVQINDGILRDIQQSKDNYMDYDTNMYSKGKSYLAVSDPNQAGNSLVLETNANFQSKVASGIGSNAGQSINIIKRIMRSVMVVGDEPISFQTNNLHYVASKQVGSALKNKTFLAGRSVVQLPDICQSLNISPGNCSNPNNPISVEMIGTPNNIRSYLSNSNVDGLPIPSKSDYLTVNLYTGTNSSDISASPNDSQNFTIFVTRDPSFQIPDFNMSESDPQISPPKTIPGTGTLFSGPASFEQKLVVYTFTLSGTDQSIHFQMKSNFSINCTQYLVVGRLAQPPILGPNPDGTSDSINFTFWGMIPSDTKYCNMSPQNNEPDPFTFFVSNNLFKQSKFSALQSMPDYSKTLNTIYFGVRELTPPEWNSYTSNNRPPVPYTISAQINHTFRVRIFSSGCYFLSDDNKNSWGTNGCVVGPLTTSQKTQCICNHLTSFSSGWLVAPNAIDFNYIFSNFDFTKNVTLFATEIAIAVVFILLLVWARRQDIKDIEKVGLTPLASNDPKDMYLYEVIVDTSIRNNAGTTSNVYFILSGELNETDPTHLVDSKRKILKRGNVDRFLLAVPRSLGAMQFIRLWHDNSGKGTNASWYCNCLGIIDLQTKEKFNFLVNKWFAVEEDDGQIDRIIPVAGINELLYFQEMFSRKMKANLSEDHLWLSIIARPPESRFTRVERVACCLLLLFLTMLTTCMFYQTEGPSKPVSNILTIGPFALSAKELWTGFISNIIAFVPLFVLIELFRRSSLKHGYANLLREAVENHLQISLNSDKVKGYHSSTANLIWNEDLNISRPAS---RSMGHINIQLNENDTKIDDMDVQEK-ETPVVRQKLFPWWMRIFAWTFLITLLIVASVLTTFYGIQFGDLACKKWISSMFISFFTSVLLVQPIKVICLAIFFALLCKDSSAF-DVEYIGEEDEIMDELGRRNAIMQNEEYLHQELYTAPIKPHKICFRPPSQEEIEKARELRLKELQMYDVIREVGFYLAFFCTLLFISYSLRHPDSYDLQNELKNVFIKQA-PDSSFTDITSETLFWNWILLVFVPRIRAPVWYNNDPPIFQRGFISNRNNRLIGYAIIRQVRSKKDSCKVNDYVKHLIKHCYSQYDIFNQDEKSYGFGWTELNTSDTSESPFLYSNESSLDGLPYIGRLSTYSGGGYVYKLKDDVNTLYNDLSALRDNKWIDFQTRAIFIEFTTFNPNINLFAIHTYVAEMPGNGGLWTIYRIEPANLLGLYSGGVKAFEIFCQVLYGIFILVIVVKEIRNFLKQKWKYFSQFWNFIELFIIIGSLLSAAGFAYVTIATNKLTGKFSQYGGSVYLNFAQVAFWNEYFSYLVSLIIFCATIKFIRVLRFNKRIGMLGAVLSYTATDMKQFFIIFFIMFLAFVMMFYSLFMDSLYRYHSFLFAIESSMNIPLGKFGFLELYQKAPIFGPIVFAGFVLFIVFVLLNMFVAILYNGFTVVKEDIDLQSSDHELMRFIFTKFVMWTGINDTKLGKKFIKT 3464          
BLAST of PKD1L-1 vs. Planmine SMEST
Match: SMESG000066980.1 (SMESG000066980.1)

HSP 1 Score: 3544.98 bits (9191), Expect = 0.000e+0
Identity = 1737/2818 (61.64%), Postives = 2183/2818 (77.47%), Query Frame = 3
Query: 2556 GLTFVNFGGAAFEQMQLRFSWLTGSNITFLLLVNNISYSLTQNETALTGISQNITISAPGVLIGVIRATNLISDIILVANLTFSQKISNMNLIADKYYTTNGSAFNFYVNMSTGSGVRSVIQYGDGQNNTNIN--YESPSVYWPGISVPYTYSNVGTYNVTVNCTNIVNSQTSSVVVYVLTGLGTYEIVYNNLFFKKNDLIQLSLNRTSGYPASMTNITINWQNGDITSIPFAAFNESAIYNYVYSANGVYNVTLTLQNPLSTVVKSILLSIIDPIINFRCVNVPANTWNGNQIQLQTLVDQGQNVIYTLNPGDGGALITKNINISXXXXXXXXXXXXXXVGNYTSNIWACNQLGCQNCSNYVQIQYKIQSFDFQVQTNGNIEYLKTNLITTISFTGTNFPTALMATFTLSDGSPPSTVYLSLSMMPYNFVKNLSVVGFGNILVKLENLANSVNISATYGSFEKFSNFNVSLTWGPTRALGFGANFNTFPLNNPVYFRPSAQAKGTVVGYTFLYAPIKNLSAIFQCNATLVNGEFSYTFSTMGDFNVSFKVYNPIDQAFIENTLTIGSSIQNTQISTRPLTLMPNYFGYISIQWSVISTESCICVDFANNTKLIYGAMSGCSNCSGYLFANRKPSNNLLEILVRFSTEGDYNIKVFIYNDYESAFANRTIPVTYAQCAPPVVSMTYTQFQNPMTPQKDIRSSQIIVSAVVLDLPCILTKNNMKLWSATLMDPIYLTPIKAVDMSIIPTSNNTQLIIPPRFLNYGLYKLTFSVTMDKNVTIYTFQSSNFTYLFIDKSPIIVGLSSGGISLIVNGIDQNICFTPLQYSQDPDLNVQDFSKWIWTWTCQKTTESENLTNYVYPKPIGYSFTTPKTGCFGDGPGVVNFTSSPCFWGGNLEINGTYQLGLVGMSSDNRTGSAKIIITVVKGIPPDITVQCLRPLMCKINNVGAFAFNEVVFNPSDALLLSATCYGNGTICGQGLWNLILLNETTQIWTPLDSSIANLYIKGVYSMQISLLPSFFSFYNTIKRFQICYNSINLTPNGKSCIQFYIFPLPSGIICTLDKTTVQQTDTVCVNCTFQPNYQYRMYVNVTNECSTLGFNSTGQFCSIIPYQTVNQTYIVRVTNENGGFIDVIAGIIMVTQLQLVDLTKILTNVINGTDQTLTVAIAKGDFKEMSQVYLKYVSVLTASNQITIR--NLFQPLTNNSKENLGGTGYMTTSVNSSTMTIESLPKDIRAKYEIDRDQKSTVINSMTAGLYTMVPGDIQSLHLISSVVNAIGESSDCVNRQSQWQLSTKLASLADNFKELQKTAPRDDVLTIATNLLSANYRSDAAANIQIDNGILRDIKFSKDTYLDYDTNLESGGKNYLNVDDPSAAAYSLTLETNSNFQSKIAFGVGSNSLYTIQTISKVLRDITVLNDVPTDLLTSQMQYYSIKTQINDLSNKAFTKGRSTIILPDICAALNSPPGSCSDPNNPIGLEIIATPNNVRAYAQNPNKNGLPIPMNSDFVSLSLFLGRQISEKPVQPNGNNNFTIFISRDPVFAVPDFNFTEPDPQIQPPKSIPGTGTIFTGPQCFEQKLVVYQFKLIGSDQSVHFQIKSNFSTKCTQYLIVGRLGQPPVLGANPDGSVDSVNFTFWGMIPTHTKYCNLIPSSDMPDPFTFFVDNSMFKQSKISTKSSMPDYSKTLDTLYFGVRELTPAEYDLYTRSNRPPVPYTISAQINNTFRVRIFSTGCYFNSNNFQGGWGTAGCVVGPLTTTKVTQCICNHLTSFASGWIVAPNTIDFDYVFSNFDFTKNLTLFVTEXXXXXXXXXXXXWARRMDIKDIEKVGVTPLPSNDANDMYLYEVTIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLLAVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSWFAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARPPESRFTRVERVA-------------------*GPTKTTESVLTVGPFALTSREIWIGFVTNIISFVPLFVIIEMFRRSQLKHGHANKLRQAVENHLQISLESKENKGYQGSTATLVRNEDVN-SRPTTPSYRSTDQINIQIPEYEVENQDSDANEKYKKRVIKRKLLPWWMRIIVWGFLTFLVIISVVFTTFYGIQFGDIACKKWISSMFISFFTSVLLTQPIKVVLLAIFFALVCKKSSSFXXXXXXXXXXXXXXXLGRRNALMQNEEFLHNELYSAPIKPHRFHVQPPPKEELEKAREIRLKELQMYDVFREIAFYIVFFCTLLFVTYSFRDPNAYQLKNELTNIFIKTSNPNWQFTGITREEQFWTWALNVLVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFDYAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDTPAPEFSFKSEKELNGMSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEFTTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIFCQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGFVYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKFIKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSLYRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLLNMFIAILYDGFAVVKADIELQENDHELVKFVVTKFIMWTGISETKFGKKFIKT 10937
            GL F +  G   E   L+F+W TGSNITF +L+NN+SY+   NE+   G ++NIT+   GV IG+IRA N +SD ILV+N+T+ Q+I+ +  I DK Y +NGSA  F VN++TGS V S+I + DG N T I+  YE+   +    SVP+ + +VG+YNVTVNC+N V+SQ + ++VY++T LGTY I  +N FFK +D+IQLSLNRTSG PA MTN+TINWQN +I +IP+ +FNESAIY   YS NG YNVT  LQNPLST V S+L++I++PI+NFRC  VPANTWNGN + L+T  D G NV+ TLNPGDG A     INI+ +N +Y+FNYTYNTVGNY+SNIWACNQLGCQNCSNYVQIQYKI   DFQ  T+GNIEY+ TNL TT++F+GTNFPTAL A F  SDGSPP ++ L+  MMPY  +KNLS  GFG   V L+NLANS N +A+Y +F K+ N +V++ WGP + +GFG+  N FPLNN +Y RP++Q  GT+V  T  Y   K+ S +  CN+T +NGE ++T S+MG+ N+S  +YNPID       + IGSSIQNT+I+T P TL+P Y+G+I + WS+IS  +CICVD A+  K IYGA SGC  C  Y + N  P NN + I VR+  +GDY I V IYN +ES  A+R I VT   CAPP + MTY  +QN  +PQ +IRS+QII+S +V D+PC +T NN KLW+A L+DP YLT +K +D+S IPT+NN+QLIIPP+FL+YGLYK T +VTMDK++T++TFQSSNFT+L I KSP+IVGLSSGG+++I   I ++ICFTPL YSQDPDLNVQDF  W W WTCQ+  E  N +N VYPKP  Y ++ PKTGCFGDGPGVVNFT+SPCF G NL+I+  Y   L   + DNRTGS+ I + VV G  P+IT+QC RPLMC IN  G +AFNEV+FNPSD+L+LSATC     IC +G W++  LN+    W   + +I N Y+KG  S+Q+SL+P FF+ Y+ + R QICYNS  L  NG  CIQF I+PLP G+ C L+   + Q   +CVNCTF  +YQYRM++N T    TLG+  TG  CSI+PYQ   Q Y+VRVTN NGGF DV+AG + VTQ+   DL   + N+++G D++L +AIAK +F++M+Q+Y+KY+SVL+ SNQ T++  NL     +N +  LGG+GY++ +V    + I++LP D R  YE DRDQKS+VIN MT+GL + VPG+I+SL+L SSV+++ G+SSDC+NR SQ Q+S  L ++A  F+ LQ TA ++D+L I  NLL AN+ SD AAN+QI++GILRDI+ SKD Y+DYDTN+ S GK+YL V DP+ A  SL LETN+NFQSK+A G+GSN+  +I  I +++R + V+ D P    T+ + Y + K   + L NK F  GRS + LPDIC +LN  PG+CS+PNNPI +E+I TPNN+R+Y  N N +GLPIP  SD+++++L+ G   S+    PN + NFTIF++RDP F +PDFN +E DPQI PPK+IPGTGT+F+GP  FEQKLVVY F L G+DQS+HFQ+KSNFS  CTQYL+VGRL QPP+LG NPDG+ DS+NFTFWGMIP+ TKYCN+ P ++ PDPFTFFV N++FKQSK S   SMPDYSKTL+T+YFGVRELTP E++ YT +NRPPVPYTISAQIN+TFRVRIFS+GCYF S++ +  WGT GCVVGPLTT++ TQCICNHLTSF+SGW+VAPN IDF+Y+FSNFDFTKN+TLF TEI +A+VFI + +WARR DIKDIEKVG+TPL SND  DMYLYEV +DTSIR NAGT+SNVYFILSGE +ETDP HLVD+KR ILKRGNVDRFLLAVPRSLG +Q+IRLWHDNSGKG NASWYCN  G+ DLQTKEKF+FLVN WFAVEE+DGQIDR+I VA ++ELL+F+E+FSRKMK NLSEDHLWLSI+ARPPESRFTRVERVA                    GP+K   ++LT+GPFAL+++E+W GF++NII+FVPLFV+IE+FRRS LKHG+AN LR+AVENHLQISL S + KGY  STA L+ NED+N SRP +   RS   INIQ+ E + +  D D  EK +  V+++KL PWWMRI  W FL  L+I++ V TTFYGIQFGD+ACKKWISSMFISFFTSVLL QPIKV+ LAIFFAL+CK SS+F + EYI EE+E+M+ELGRRNA+MQNEE+LH ELY+APIKPH+   +PP +EE+EKARE+RLKELQMYDV RE+ FY+ FFCTLLF++YS R P++Y L+NEL N+FIK + P+  FT IT E  FW W L V VP +RAPVWYNNDP ++QRGFISNRNNRLIGYA++RQVR+KK+SC V DY K + K+CYS Y+IFNQDE SYG GWT L+ +DT    F + +E  L+G+ YIGR+  YSGGGYVY+ + +V+ L+ +++AL+DN WIDFQTRAIFIEFTT+NPNINLFAI+T+V E PG+GG+WTIYR+EPANLLGLYSGGVKAFEIFCQVLYGIFILVI+VKEIRN +KQKWKYF+QFWN IE+FI+IGS ++ AGF YV IAT++LT KF+QYGG VYLNFA VAF NE   Y+VS I+F AT+KFI++LRFN+RIGMLG+VL+YT+ DMKQFFIIF IMFLAFVM+FYSLFMDSLYRYH+FLFA E+SM I LGKF FLELYQK PIFGPIVFAG+VLFI+FVLLNMF+AILY+GF VVK DI+LQ +DHEL++F+ TKF+MWTGI++TK GKKFIKT
Sbjct:    6 GLAFTSTIGITSEPTSLQFTWSTGSNITFSVLINNVSYNFVANESIKLGSTENITLPIIGVYIGIIRAINFVSDAILVSNITYYQRITGLQFIPDKIYISNGSAITFTVNLTTGSLVTSLINFSDGTNQTFISSLYET---WTNNYSVPHIFPDVGSYNVTVNCSNPVSSQFAYIIVYIITNLGTYTIQRDNQFFKLSDIIQLSLNRTSGTPALMTNLTINWQNANIVNIPYTSFNESAIYYNQYSTNGAYNVTFLLQNPLSTFVASVLITIMNPIVNFRCSYVPANTWNGNMMSLKTFADSGDNVVLTLNPGDGSASTVNTINITNINQEYDFNYTYNTVGNYSSNIWACNQLGCQNCSNYVQIQYKIIKTDFQYITSGNIEYINTNLTTTLTFSGTNFPTALTAIFNFSDGSPPLSLLLTSGMMPYTLMKNLSKPGFGVSTVILQNLANSENFTASYEAFVKYINVSVTVLWGPKKLIGFGSLLNIFPLNNYLYLRPNSQMIGTIVNGTVTYYDSKSSSTVLLCNSTFINGELNFTISSMGNVNLSLTLYNPIDTITSSLPIIIGSSIQNTEITTSPSTLLPGYYGFIIVTWSIISATNCICVDVADGRKFIYGATSGCDKCINYNYTNIVPVNNQISISVRYLIQGDYKINVSIYNSFESGNASRIISVTTNPCAPPTLLMTYPTYQNSFSPQTEIRSNQIIISGIVSDIPCTMTTNNYKLWTAVLIDPNYLTTMKEIDLSSIPTANNSQLIIPPKFLSYGLYKFTLTVTMDKSITVFTFQSSNFTFLQIVKSPLIVGLSSGGLTIISRSIQEDICFTPLIYSQDPDLNVQDFLNWNWVWTCQEKNEIMNTSNIVYPKPRNYQYSFPKTGCFGDGPGVVNFTTSPCFAGNNLDIDKMYMFNLTARAPDNRTGSSLINVRVVNGTSPNITIQCSRPLMCNINKNGQYAFNEVLFNPSDSLILSATCVCLNVICEKGFWSI--LNQVASSWETFNQTIVNSYVKGFNSLQMSLIPDFFTAYSNLTRIQICYNSDGLPTNGFGCIQFAIYPLPKGVTCQLNTNIIPQVANLCVNCTFNSDYQYRMFINNTGSILTLGYTGTGYLCSIVPYQPFAQAYMVRVTNSNGGFTDVLAGNVTVTQMTSQDLNSTINNLLSGADKSLQLAIAKANFQDMAQIYMKYISVLSVSNQNTLQTSNL-----SNIQPYLGGSGYLSQNVGPGVLVIDNLPADKRLLYEKDRDQKSSVINLMTSGLSSFVPGNIKSLYLASSVLSSFGDSSDCINRISQMQISNNLRNMAGYFQNLQGTATKEDILEIGKNLLQANFLSDTAANVQINDGILRDIQQSKDNYMDYDTNMYSKGKSYLAVSDPNQAGNSLVLETNANFQSKVASGIGSNAGQSINIIKRIMRSVMVVGDEPISFQTNNLHYVASKQVGSALKNKTFLAGRSVVQLPDICQSLNISPGNCSNPNNPISVEMIGTPNNIRSYLSNSNVDGLPIPSKSDYLTVNLYTGTNSSDISASPNDSQNFTIFVTRDPSFQIPDFNMSESDPQISPPKTIPGTGTLFSGPASFEQKLVVYTFTLSGTDQSIHFQMKSNFSINCTQYLVVGRLAQPPILGPNPDGTSDSINFTFWGMIPSDTKYCNMSPQNNEPDPFTFFVSNNLFKQSKFSALQSMPDYSKTLNTIYFGVRELTPPEWNSYTSNNRPPVPYTISAQINHTFRVRIFSSGCYFLSDDNKNSWGTNGCVVGPLTTSQKTQCICNHLTSFSSGWLVAPNAIDFNYIFSNFDFTKNVTLFATEIAIAVVFILLLVWARRQDIKDIEKVGLTPLASNDPKDMYLYEVIVDTSIRNNAGTTSNVYFILSGELNETDPTHLVDSKRKILKRGNVDRFLLAVPRSLGAMQFIRLWHDNSGKGTNASWYCNCLGIIDLQTKEKFNFLVNKWFAVEEDDGQIDRIIPVAGINELLYFQEMFSRKMKANLSEDHLWLSIIARPPESRFTRVERVACCLLLLFLTMLTTCMFYQTEGPSKPVSNILTIGPFALSAKELWTGFISNIIAFVPLFVLIELFRRSSLKHGYANLLREAVENHLQISLNSDKVKGYHSSTANLIWNEDLNISRPAS---RSMGHINIQLNENDTKIDDMDVQEK-ETPVVRQKLFPWWMRIFAWTFLITLLIVASVLTTFYGIQFGDLACKKWISSMFISFFTSVLLVQPIKVICLAIFFALLCKDSSAF-DVEYIGEEDEIMDELGRRNAIMQNEEYLHQELYTAPIKPHKICFRPPSQEEIEKARELRLKELQMYDVIREVGFYLAFFCTLLFISYSLRHPDSYDLQNELKNVFIKQA-PDSSFTDITSETLFWNWILLVFVPRIRAPVWYNNDPPIFQRGFISNRNNRLIGYAIIRQVRSKKDSCKVNDYVKHLIKHCYSQYDIFNQDEKSYGFGWTELNTSDTSESPFLYSNESSLDGLPYIGRLSTYSGGGYVYKLKDDVNTLYNDLSALRDNKWIDFQTRAIFIEFTTFNPNINLFAIHTYVAEMPGNGGLWTIYRIEPANLLGLYSGGVKAFEIFCQVLYGIFILVIVVKEIRNFLKQKWKYFSQFWNFIELFIIIGSLLSAAGFAYVTIATNKLTGKFSQYGGSVYLNFAQVAFWNEYFSYLVSLIIFCATIKFIRVLRFNKRIGMLGAVLSYTATDMKQFFIIFFIMFLAFVMMFYSLFMDSLYRYHSFLFAIESSMNIPLGKFGFLELYQKAPIFGPIVFAGFVLFIVFVLLNMFVAILYNGFTVVKEDIDLQSSDHELMRFIFTKFVMWTGINDTKLGKKFIKT 2807          
The following BLAST results are available for this feature:
BLAST of PKD1L-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PKD2L11.747e-5828.83polycystin 2 like 1, transient receptor potential ... [more]
PKD27.721e-5629.94polycystin 2, transient receptor potential cation ... [more]
PKD2L23.265e-5029.76polycystin 2 like 2, transient receptor potential ... [more]
PKD2L25.704e-5029.76polycystin 2 like 2, transient receptor potential ... [more]
PKD1L36.998e-5035.40polycystin 1 like 3, transient receptor potential ... [more]
back to top
BLAST of PKD1L-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lov-11.868e-4825.15Location of vulva defective 1 [Source:UniProtKB/S... [more]
pkd-22.037e-4527.41Polycystin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9U... [more]
back to top
BLAST of PKD1L-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pkd22.224e-3225.95gene:FBgn0041195 transcript:FBtr0080365[more]
brv38.282e-1322.10gene:FBgn0040333 transcript:FBtr0300708[more]
brv31.014e-1222.10gene:FBgn0040333 transcript:FBtr0340092[more]
brv23.496e-823.86gene:FBgn0036712 transcript:FBtr0075242[more]
brv24.183e-823.86gene:FBgn0036712 transcript:FBtr0331846[more]
back to top
BLAST of PKD1L-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkd1l2a3.336e-8830.76polycystic kidney disease 1 like 2a [Source:ZFIN;A... [more]
pkd1l2a6.998e-8631.19polycystic kidney disease 1 like 2a [Source:ZFIN;A... [more]
pkd1l2b1.201e-7127.53polycystic kidney disease 1 like 2b [Source:ZFIN;A... [more]
pkd1l2b9.477e-6726.70polycystic kidney disease 1 like 2b [Source:ZFIN;A... [more]
pkd25.260e-6629.81polycystic kidney disease 2 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of PKD1L-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000038579.12.780e-8230.04polycystin 1 like 2 (gene/pseudogene) [Source:NCBI... [more]
PKD2L11.307e-6630.52polycystic kidney disease 2-like 1 [Source:NCBI ge... [more]
PKD2L15.957e-6630.65polycystic kidney disease 2-like 1 [Source:NCBI ge... [more]
usp336.053e-6530.68ubiquitin specific peptidase 33 [Source:Xenbase;Ac... [more]
usp332.294e-6430.87ubiquitin specific peptidase 33 [Source:Xenbase;Ac... [more]
back to top
BLAST of PKD1L-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pkd1l28.170e-8930.76polycystic kidney disease 1 like 2 [Source:MGI Sym... [more]
Pkd1l28.315e-8930.76polycystic kidney disease 1 like 2 [Source:MGI Sym... [more]
Pkd2l18.683e-6230.89polycystic kidney disease 2-like 1 [Source:MGI Sym... [more]
Pkd29.882e-5830.06polycystin 2, transient receptor potential cation ... [more]
Pkd2l25.639e-5629.88polycystic kidney disease 2-like 2 [Source:MGI Sym... [more]
back to top
BLAST of PKD1L-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7TN88|PK1L2_MOUSE1.085e-8730.61Polycystic kidney disease protein 1-like 2 OS=Mus ... [more]
sp|Q7Z442|PK1L2_HUMAN1.101e-8329.40Polycystic kidney disease protein 1-like 2 OS=Homo... [more]
sp|Q6IVV8|PKD2_DANRE3.971e-6529.81Polycystin-2 OS=Danio rerio OX=7955 GN=pkd2 PE=1 S... [more]
sp|H2LRU7|PKD2_ORYLA2.846e-6429.05Polycystin-2 OS=Oryzias latipes OX=8090 GN=pkd2 PE... [more]
sp|A2A259|PK2L1_MOUSE6.074e-6130.89Polycystic kidney disease 2-like 1 protein OS=Mus ... [more]
back to top
BLAST of PKD1L-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJQ50.000e+0100.00PKD1L-1 OS=Schmidtea mediterranea OX=79327 GN=PKD1... [more]
A0A0H3YJK50.000e+062.58PKD1L-3 OS=Schmidtea mediterranea OX=79327 GN=PKD1... [more]
A0A267FSJ80.000e+034.41Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8J0W50.000e+032.13Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A3Q0KRY70.000e+030.09Polycystin 1-related OS=Schistosoma mansoni OX=618... [more]
back to top
BLAST of PKD1L-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkd1l2a2.198e-8531.50polycystin 1 like 2 [Source:NCBI gene;Acc:10304417... [more]
ENSAMXT00000006495.21.342e-8429.78pep primary_assembly:Astyanax_mexicanus-2.0:5:3500... [more]
pkd28.221e-6330.89polycystin 2, transient receptor potential cation ... [more]
pkd2l16.613e-5731.62polycystic kidney disease 2-like 1 protein [Source... [more]
pkd1a2.912e-3332.18polycystic kidney disease 1a [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of PKD1L-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkd2l11.684e-6729.98polycystic kidney disease 2-like 1 [Source:ZFIN;Ac... [more]
pkd2l15.787e-6030.18polycystic kidney disease 2-like 1 [Source:ZFIN;Ac... [more]
ENSPMAT00000007306.19.256e-4628.16pep scaffold:Pmarinus_7.0:GL480012:400827:419749:1... [more]
pkd22.171e-3924.95polycystic kidney disease 2 [Source:NCBI gene;Acc:... [more]
ENSPMAT00000010654.11.739e-3331.34pep scaffold:Pmarinus_7.0:GL477016:137097:160647:-... [more]
back to top
BLAST of PKD1L-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PKD1L-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO448841.486e-17232.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447441.821e-17030.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492008.923e-16530.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431953.646e-9328.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319452.570e-7732.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of PKD1L-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkd1l2a3.996e-14130.67polycystin 1 like 2 [Source:NCBI gene;Acc:10116220... [more]
pkd1l2a2.942e-13330.05polycystin 1 like 2 [Source:NCBI gene;Acc:10116220... [more]
pkd1l2a3.860e-7330.09polycystin 1 like 2 [Source:NCBI gene;Acc:10116220... [more]
pkd21.461e-6529.05polycystin 2, transient receptor potential cation ... [more]
pkd24.523e-6529.05polycystin 2, transient receptor potential cation ... [more]
back to top
BLAST of PKD1L-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067002.10.000e+099.17SMESG000067002.1[more]
SMESG000067002.10.000e+099.02SMESG000067002.1[more]
SMESG000066980.10.000e+059.44SMESG000066980.1[more]
SMESG000066980.10.000e+059.76SMESG000066980.1[more]
SMESG000066980.10.000e+061.64SMESG000066980.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30002946
GenBankAKN21724.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002946 ID=SMED30002946|Name=PKD1L-1|organism=Schmidtea mediterranea sexual|type=transcript|length=10938bp
CGACGCTAGCAACGAGACAATGTTGGAGAAATCTGTATTCAAATGTAGCA
AATGAAACCTAATAAAAAATAACAAAAGAAATAGATACTTGACCGAAACA
TAGAGTCACATTTAATTATCCTCCCAAGAGGATACATGCATAAATATTAC
AATGAGGAATTTGTATTTCACCAATCCAAACGGAAACCATCTCCCAATCT
TATCAAAACTACAATGGGGTTATAATCTTACTGTTGTTATTTACATGGTT
ACCATGATACATTTGGTTGTTTACAACAGGGTGAACATTAAGAAATCGGG
ATATATTTAAGTTCTGTCCCAGGAAATTATTCCCGTGCTTGGTGCCTGCT
GAAGAAGACGAGGATGACAATGAAAACTGTTCCCAACTGTTGTTATTCCA
TTGTGTGGATATTACCAGCAAAGTTTGTCCCAACAGGCAAACAGCAAAAC
ATTTTCTCAATATCAGCAAATCGAATTCGAGTTAATTTGAAATAATAAAA
ACATTGAAAACTGTTGTGAAAAATTATTTTTATTGTTTTTCTTTTTCTTG
AGAACAACAAATTCCGATGGGCACAATTTTTAAATTAATTCTTTCGATAC
TACTCATTCATTTCTCGAGAGCTGAATGGTGTATAAAAATTACTTTGGAC
AAGGTCGTCGGTATTGGAACATACAATAAAGACCAAGTTTCTCTTGATAG
AACGCTTTGTACTGACGAATGCTACTACAGTGGATTCCCATTTACTGTTG
TTTGGAAAAATACGTACTGTTTCTGTGCAAATGACATTAGTGCTGGAATA
AATGTGACTGATTTTAGCACATGTGCTACAGTGGATGGATTCTACGTATC
AGCATCATTAGCTTCAAGCCTCACAGTTATTTTCCAAATGGCTATGGCCA
CAACAAAATTTATTGCAAGTGGAAATTTAGTTTCAATGTCACCGAATATT
TATTATTATGCACCACCTGGACCCCCACCATCCTTTAAATATAGTTATCA
TGATAAAGCCGGGATATGGGAATACAGTCTCGACTCGAATGCCATTCAAA
GAGTATTTTCAATATCAGGAATTTATCAGATCCGTTCACAAGTTTTAAAA
CCGAATAATCAAGCAAAGATTAGCGAAGTAAGTACAGAAATCATGGCTTA
TCAGTCCGTAACTAATCTTAACATAACGTGTCAACCCATTGCAATAGTGT
ATATTGCTGTAAATTGTACAGTTTCAATCAGTAACGGCAGTTTTATCACT
GGACAAATAATGGCTGATGGATTAATTATCGAAACTTTAACTTTACCGGA
TATCCCATGGGAAAGAGTTGGAGCAGTTCCGAACTTCTTTAATAACGATT
TTATAACTGGTCAGTCTGTGAGTGGAATCTATTTAATTAATGGACAATAC
CAATATAATGGCATCATAACCTCAATTGAATTTAATGCTTTCAAGACTGG
AAACATAGATCTTTTGCTCCTCAAGCCGAGTTGTGGAACGTACTATTGCA
TTGCAACGGGTTCTTGCGCAGCTACTCCGTCGTGTTCTAGAACGCTGGCT
TGTGGCAATGAATATTGCCCCCTATCTCAAAGCTGTTCTGCGATTTGCAA
CAATCGACTGCTTAACAAGGAAAACTCCAGCTCATTACCGTCAGTGTCTT
ACATAATTAATCAAGTTCAACTTTATCCAATCTCAAACACTGGATATCAA
ATCGTCACTCTTAGTGTTCCATGGCCAGTACAAGCTGGTTACAGACTGGG
CTTTCATTTTGGAAATGGAATTACGGATTTAATAGCAGTCACTTCATTGA
GGTCTGGGGAGACACCAAATTTCTTTTATAATTCCCAAACCGTAACCTCT
GGCACATTGATTCCCAGCACTTCATTTACTCCAAAGTACATTTCACATCA
GTTTTCTGCAGTTTCTGTGCAACAGAGAAATACCAAATTCAAATTAATGT
TTAATACAACTGGAATCAAGAATGTTACTGTAAATTTGCAGTCAGTTGAT
AACGTCGTCGCTTCTGCTTCCTCGTCCGTTATTGTCGGCCTCAATATCAA
TGATACATCTTTTGCAAATCTGGGATACGCAACAACAAACGTATCATACA
TGTTCATAATGAATCCCCACACAGGTGACCAATTGCTTTATTATTGGGAT
TTCGGTGACAATACAACACTGAATTCAACAACAAGATTTGTCAATCACAC
TTTCACCGTGGCTGGAGTTTACAACTCTTCGGTTTATGTTTACAATACCC
TTGTTTCAAAAGTTCAAAATTATCTAATTTACGTAAAAGATGCAGTTAAA
ATTAATTTTTTCAACTCATCTGGAGTTTATAATCCAAATGTCTTCGCAAG
TTTTATCCTATCAATGAAAAGCGGAACCGGATTCAATTGCACTTTAAGTG
GGGACGGAATAGCCAATCAAACTCAACCATCAAATAACCTTTTATTTGGT
TGGCAATGGGCAACCGAAGGATCCTTCAATGTCCGAATTGACTGTTACAA
TGAATTGACAAGAGATTATAAAACATTGGTACAGGTCATTCAAGCAAATA
TTACTGGTTTGACATTTGTAAATTTTGGAGGAGCAGCATTCGAGCAGATG
CAATTGCGATTCTCGTGGCTTACTGGGAGTAACATAACGTTCCTATTGCT
GGTGAACAATATATCATACTCTCTGACACAAAATGAGACAGCACTGACTG
GAATATCCCAAAACATCACAATATCAGCTCCTGGAGTCTTGATTGGAGTC
ATACGAGCGACAAACCTCATATCTGACATAATTTTAGTTGCGAATCTAAC
TTTCTCTCAAAAGATTAGTAATATGAATTTGATTGCCGATAAATACTACA
CAACAAATGGTTCCGCCTTTAACTTTTACGTGAACATGTCAACAGGATCT
GGAGTTCGGTCAGTAATTCAGTATGGTGACGGACAGAATAATACGAATAT
CAATTACGAATCTCCATCCGTTTATTGGCCGGGTATCTCAGTACCATATA
CCTACTCGAATGTTGGGACGTACAATGTCACTGTAAATTGTACAAACATA
GTCAACAGTCAGACATCTTCAGTAGTCGTTTACGTTTTAACAGGTCTTGG
AACGTACGAAATTGTGTACAATAATCTCTTTTTTAAAAAGAACGACCTCA
TACAATTATCATTGAATCGAACTTCCGGTTACCCAGCCAGCATGACCAAC
ATTACCATTAATTGGCAAAATGGAGATATCACTTCAATTCCGTTCGCAGC
CTTCAATGAATCTGCCATCTACAACTACGTATACTCAGCCAACGGCGTTT
ATAATGTCACTTTAACCCTTCAAAATCCTCTGAGCACTGTTGTTAAATCG
ATTTTACTCTCCATTATCGATCCGATAATCAATTTCCGATGCGTCAATGT
TCCGGCAAATACGTGGAACGGAAATCAAATCCAACTACAGACGTTAGTCG
ATCAAGGACAGAATGTAATTTATACACTAAACCCAGGAGATGGAGGAGCA
CTAATCACCAAAAATATTAATATAAGCACGTTGAATACGCAATACAATTT
CAATTATACGTACAATACAGTGGGAAATTATACGTCAAATATTTGGGCTT
GCAACCAACTGGGGTGCCAGAACTGCTCAAATTATGTTCAGATTCAATAC
AAAATCCAAAGTTTTGATTTTCAAGTTCAAACAAATGGCAACATTGAATA
TTTAAAAACAAATCTTATAACAACAATTTCTTTCACTGGAACAAACTTTC
CGACAGCCTTAATGGCAACCTTTACTCTAAGTGACGGCTCTCCTCCATCA
ACTGTATATCTTTCCCTGTCGATGATGCCATACAATTTTGTGAAAAACCT
CTCAGTTGTGGGCTTTGGAAACATTTTGGTTAAATTAGAGAATTTAGCAA
ATTCCGTCAATATCAGTGCAACTTATGGATCATTCGAAAAGTTTTCCAAT
TTCAATGTCAGTTTAACATGGGGGCCAACAAGAGCTCTTGGTTTTGGAGC
AAATTTCAACACTTTTCCGCTGAATAATCCAGTTTATTTCAGACCCAGTG
CTCAGGCAAAAGGAACAGTCGTTGGATATACCTTTCTCTACGCTCCTATT
AAAAACTTAAGTGCAATTTTCCAATGCAATGCAACTTTGGTGAATGGAGA
ATTCAGTTACACCTTTTCAACGATGGGTGATTTTAATGTCTCCTTCAAAG
TATACAACCCCATAGATCAAGCCTTTATTGAAAATACCCTCACAATCGGT
AGTAGCATTCAAAATACTCAAATCAGTACTCGTCCTTTGACTTTGATGCC
GAATTATTTTGGATACATATCCATTCAATGGTCAGTTATTTCTACGGAGT
CATGTATTTGTGTGGATTTTGCAAATAATACCAAACTGATCTATGGAGCC
ATGAGTGGATGTTCAAATTGTTCAGGCTACTTGTTCGCAAACAGGAAACC
CAGCAATAATTTGTTGGAAATATTGGTTCGATTTAGTACCGAAGGTGATT
ACAATATCAAGGTTTTTATTTATAATGACTACGAGTCGGCTTTCGCTAAT
CGTACGATACCGGTGACTTATGCTCAATGTGCCCCACCGGTAGTGTCAAT
GACTTACACCCAATTTCAGAATCCTATGACTCCGCAAAAAGACATCCGAA
GTTCCCAGATAATCGTTTCGGCAGTTGTTCTCGATCTGCCATGCATTTTG
ACTAAAAATAATATGAAATTGTGGTCAGCTACACTTATGGATCCTATTTA
TTTAACTCCTATAAAAGCTGTCGACATGAGCATAATTCCGACAAGTAATA
ATACACAGCTGATTATCCCCCCGAGGTTTCTCAATTACGGTTTATATAAA
CTTACTTTCTCGGTGACTATGGACAAAAATGTGACGATTTACACTTTTCA
GTCTAGTAATTTTACATATTTGTTTATCGACAAAAGTCCCATAATAGTTG
GGCTGTCAAGCGGAGGAATAAGTTTGATTGTCAATGGAATTGACCAGAAT
ATTTGTTTTACTCCATTACAATATTCACAGGATCCAGATTTGAATGTGCA
AGATTTTTCAAAATGGATCTGGACTTGGACATGCCAGAAAACAACAGAGA
GTGAAAATCTTACAAATTATGTCTATCCGAAACCGATTGGTTATTCATTT
ACAACTCCAAAAACTGGTTGTTTTGGCGACGGTCCTGGTGTTGTGAATTT
CACATCATCCCCCTGTTTCTGGGGAGGAAATTTAGAAATAAATGGCACTT
ATCAATTAGGTTTGGTTGGAATGAGTTCTGATAACCGGACGGGGTCCGCA
AAAATTATAATAACCGTCGTCAAGGGAATCCCTCCGGATATAACTGTTCA
GTGCTTGAGGCCGTTAATGTGCAAAATCAATAACGTTGGAGCCTTTGCCT
TTAATGAAGTCGTTTTCAATCCTTCTGACGCCTTACTGCTTAGTGCAACT
TGCTATGGAAATGGGACGATTTGTGGTCAAGGGTTATGGAACTTGATTTT
ATTGAATGAAACTACTCAAATATGGACACCGCTAGATTCATCTATAGCAA
ACTTGTACATCAAAGGTGTTTACAGCATGCAAATATCTCTCCTTCCGAGC
TTCTTCTCATTCTATAACACGATTAAACGTTTTCAGATCTGTTACAACTC
GATCAATTTAACCCCAAACGGAAAAAGCTGCATTCAGTTTTATATATTCC
CTTTGCCCAGTGGGATCATTTGCACTCTCGATAAAACAACAGTTCAACAA
ACGGACACCGTATGCGTCAACTGTACGTTTCAACCAAATTACCAATATCG
TATGTATGTAAATGTCACCAATGAATGTTCGACTCTCGGATTCAACAGCA
CTGGCCAGTTTTGCAGCATCATTCCGTACCAAACGGTCAATCAAACCTAC
ATAGTGCGAGTGACAAATGAAAATGGCGGATTCATTGACGTGATCGCCGG
AATTATTATGGTTACTCAATTGCAGTTGGTAGACCTAACAAAGATTCTGA
CAAATGTTATCAACGGCACAGATCAGACGTTGACTGTAGCCATTGCCAAA
GGCGACTTCAAAGAAATGTCCCAGGTCTATTTGAAATACGTTTCTGTCCT
TACAGCTTCGAATCAGATAACAATACGAAACCTCTTTCAACCACTCACAA
ACAATTCCAAAGAAAACCTTGGTGGAACAGGCTACATGACAACCTCCGTA
AATTCATCAACAATGACAATTGAAAGTTTACCTAAAGATATCAGAGCCAA
ATATGAAATTGACCGAGACCAGAAAAGCACTGTTATCAATTCAATGACCG
CCGGCTTGTATACAATGGTTCCAGGAGACATTCAGAGCTTGCATTTAATT
TCGAGCGTTGTCAACGCAATAGGAGAATCATCAGATTGCGTCAACCGGCA
AAGCCAATGGCAACTCTCAACAAAACTGGCAAGTTTAGCAGATAATTTCA
AGGAACTCCAAAAAACTGCCCCCCGAGACGACGTGTTGACGATTGCAACG
AATTTGCTTTCGGCCAATTATCGCAGTGACGCGGCTGCGAACATTCAAAT
TGACAATGGTATTTTGAGAGATATCAAATTTTCCAAAGACACATATCTTG
ATTATGACACAAATCTCGAGAGTGGTGGGAAAAACTATTTGAATGTCGAT
GATCCAAGCGCGGCTGCTTATTCATTGACATTGGAGACAAACTCGAATTT
TCAGTCGAAAATAGCCTTTGGAGTTGGCTCAAATTCTTTATATACGATTC
AAACCATAAGCAAAGTTCTCAGAGATATCACAGTATTGAATGATGTCCCT
ACGGACCTCTTAACATCTCAGATGCAATATTATTCCATTAAAACACAAAT
TAATGATTTATCGAATAAAGCCTTCACAAAAGGAAGAAGCACAATAATTC
TTCCAGACATCTGTGCAGCTTTGAACAGCCCTCCCGGAAGCTGTTCCGAT
CCTAATAATCCTATCGGGCTAGAGATTATCGCAACTCCGAATAACGTACG
GGCGTACGCGCAGAATCCAAACAAAAACGGGCTTCCAATACCGATGAACA
GCGACTTCGTTTCGTTGAGTTTATTTCTTGGTAGGCAAATCTCAGAGAAA
CCAGTTCAGCCAAATGGAAACAATAATTTCACAATTTTTATTTCGCGAGA
TCCAGTTTTTGCAGTTCCAGACTTCAATTTCACAGAGCCTGATCCCCAGA
TCCAACCGCCGAAATCTATCCCAGGCACCGGGACGATATTTACTGGGCCC
CAATGTTTTGAACAGAAACTTGTTGTTTATCAATTCAAATTGATTGGCAG
TGATCAAAGTGTTCATTTTCAGATCAAATCAAATTTTTCAACCAAATGCA
CTCAATATTTAATTGTCGGAAGACTTGGTCAACCCCCCGTTTTGGGGGCA
AACCCAGATGGGTCTGTTGATTCTGTAAATTTTACATTTTGGGGAATGAT
TCCGACTCATACAAAATATTGCAATCTCATTCCATCTAGTGATATGCCTG
ATCCTTTTACTTTTTTTGTCGATAACAGTATGTTTAAGCAATCCAAAATT
TCAACAAAGTCTTCCATGCCAGATTACTCGAAAACATTGGATACCCTTTA
TTTTGGAGTTAGAGAGCTAACTCCGGCAGAATATGATTTATATACCAGAA
GCAATCGACCACCTGTCCCGTATACAATAAGTGCTCAAATAAATAATACA
TTTAGAGTACGGATATTTTCAACTGGGTGCTATTTTAATTCCAACAACTT
TCAAGGCGGATGGGGAACAGCCGGATGTGTTGTCGGCCCGCTCACAACGA
CCAAAGTGACCCAGTGCATTTGTAACCATTTAACAAGTTTTGCCAGCGGC
TGGATTGTTGCGCCAAATACGATAGATTTTGACTACGTTTTCTCAAATTT
TGATTTTACAAAAAATTTGACATTGTTCGTCACCGAAATAGTGGTGGCTT
TGGTTTTCATTGCAATTTTTATCTGGGCACGAAGAATGGACATCAAGGAC
ATTGAGAAAGTCGGCGTTACTCCTCTCCCGAGCAATGATGCCAATGACAT
GTATTTATATGAAGTAACTATAGACACAAGCATACGTGCAAACGCGGGAA
CTTCGTCAAATGTCTATTTTATCTTATCAGGAGAACAAGATGAAACCGAT
CCTAGACATCTAGTAGATAACAAACGTCCCATTTTAAAAAGAGGAAATGT
CGACAGGTTTTTATTGGCTGTACCAAGGTCTCTTGGTATCTTACAATATA
TAAGACTTTGGCATGATAATAGTGGGAAAGGAAAAAATGCTTCTTGGTAT
TGCAATTATTTCGGTGTTACTGATTTACAAACCAAAGAAAAATTTCACTT
TCTCGTCAACAGCTGGTTTGCAGTAGAAGAAAATGATGGACAGATTGATA
GATTAATTGCTGTGGCAAGTGTTGATGAGCTGTTACATTTTGAGGAAGTA
TTTTCCCGAAAAATGAAATTGAATTTGTCGGAAGACCATCTTTGGTTGTC
AATAATGGCACGACCCCCAGAAAGTCGATTTACGAGGGTTGAAAGAGTTG
CTTAAGGTCCCACGAAAACTACTGAGAGCGTTTTAACAGTTGGTCCGTTT
GCTCTTACGTCTAGAGAAATATGGATAGGATTTGTCACCAATATTATATC
ATTTGTGCCACTATTTGTGATAATTGAAATGTTCCGCAGGTCTCAATTAA
AACATGGACATGCGAATAAGCTAAGACAGGCAGTCGAAAATCATTTACAA
ATCTCTTTAGAATCAAAAGAAAATAAGGGCTATCAAGGTTCAACGGCCAC
ATTAGTAAGGAACGAAGATGTGAATTCAAGACCAACAACCCCGAGTTATA
GAAGTACAGATCAAATAAACATCCAAATACCAGAATATGAAGTAGAAAAT
CAAGATTCTGATGCGAATGAAAAGTACAAAAAACGAGTGATCAAAAGGAA
ACTGCTACCGTGGTGGATGAGAATAATTGTTTGGGGATTTTTAACATTCC
TTGTGATAATCTCGGTGGTATTCACAACCTTCTATGGCATTCAATTTGGA
GATATTGCATGCAAAAAGTGGATTTCATCAATGTTTATAAGTTTTTTTAC
ATCTGTTTTATTGACACAACCAATTAAGGTCGTTTTATTGGCGATATTCT
TCGCTCTCGTCTGTAAAAAGTCGAGCTCATTCAATAATACTGAATATATA
AACGAAGAAGAAGAACTTATGAACGAGTTGGGTCGAAGGAATGCTCTTAT
GCAAAATGAAGAATTCTTACACAATGAATTATATAGTGCTCCCATCAAAC
CGCACCGATTTCATGTTCAACCCCCACCCAAGGAGGAATTGGAAAAGGCG
AGAGAAATTCGTTTGAAAGAATTACAAATGTATGATGTATTCCGTGAGAT
TGCGTTCTATATTGTCTTCTTCTGCACTCTTCTGTTCGTCACATACAGTT
TCCGGGATCCAAATGCCTATCAACTGAAAAACGAATTGACAAATATTTTC
ATCAAAACTTCAAATCCCAATTGGCAATTTACAGGGATTACTCGTGAAGA
ACAATTTTGGACATGGGCATTGAATGTACTAGTTCCGAATTTAAGGGCCC
CGGTTTGGTATAACAATGATCCACAACTTTATCAAAGAGGATTCATCAGC
AATAGAAATAACAGATTAATTGGATATGCAGTTATGAGGCAAGTTCGAAC
AAAAAAAAATTCTTGTGCGGTTTTTGATTACGCCAAATCAATTTCAAAAA
ATTGCTATTCAACTTACAATATTTTCAATCAAGACGAAGGCAGCTACGGT
AAAGGCTGGACAGCTCTTTCTGCTAATGACACTCCGGCTCCGGAGTTTTC
ATTCAAATCCGAAAAAGAGTTGAATGGTATGTCATACATTGGAAGAATTG
GACTTTATTCTGGAGGAGGATATGTTTATCAATTTAGGAGTAATGTCAGC
AATTTATTCACAGAAATGAACGCTTTAAAAGACAATCATTGGATAGATTT
CCAAACAAGAGCGATCTTTATAGAGTTCACCACCTATAATCCGAATATTA
ATCTTTTTGCCATTAACACATTCGTTGTTGAATCTCCGGGCAGTGGAGGA
ATGTGGACCATATATCGAGTAGAACCGGCGAACTTATTGGGTTTGTATTC
TGGTGGAGTTAAAGCCTTTGAAATATTCTGTCAAGTCCTCTATGGCATAT
TCATTCTTGTGATTATTGTGAAAGAGATTCGAAACATTATCAAGCAGAAA
TGGAAATATTTTACCCAATTTTGGAACCTAATCGAAGTTTTCATAGTTAT
CGGCTCCTTTATTGCAGTTGCGGGATTTGTCTACGTTCAAATAGCGACGA
GTCAGTTAACGGAAAAGTTCGCGCAATACGGTGGAGATGTTTATCTGAAT
TTCGCATACGTAGCGTTCTGCAATGAAAATCTCGGCTATATGGTTTCGTT
TATCGTCTTTTTGGCCACTTTGAAATTTATAAAAATTTTGAGATTCAACC
GCCGAATCGGGATGCTCGGCTCCGTACTAAATTATACTTCAAAGGATATG
AAGCAGTTTTTCATTATATTTACCATAATGTTTTTGGCTTTTGTGATGGT
ATTCTACTCGCTTTTCATGGATTCTTTATATCGGTACCACACGTTTCTGT
TTGCAACGGAGGCGAGTATGCAAATCGCATTGGGAAAATTTGCCTTCCTA
GAACTGTATCAAAAAGAACCGATATTTGGACCAATTGTTTTCGCTGGATA
TGTTTTGTTCATTATTTTTGTTTTACTCAACATGTTTATTGCTATTCTTT
ATGATGGATTCGCTGTTGTGAAAGCCGATATTGAGTTGCAGGAAAATGAT
CATGAGTTGGTGAAATTCGTTGTGACGAAATTTATCATGTGGACAGGAAT
CAGTGAAACGAAATTCGGAAAGAAGTTCATCAAAACCG
back to top

protein sequence of SMED30002946-orf-1

>SMED30002946-orf-1 ID=SMED30002946-orf-1|Name=SMED30002946-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=753bp
MFRRSQLKHGHANKLRQAVENHLQISLESKENKGYQGSTATLVRNEDVNS
RPTTPSYRSTDQINIQIPEYEVENQDSDANEKYKKRVIKRKLLPWWMRII
VWGFLTFLVIISVVFTTFYGIQFGDIACKKWISSMFISFFTSVLLTQPIK
VVLLAIFFALVCKKSSSFNNTEYINEEEELMNELGRRNALMQNEEFLHNE
LYSAPIKPHRFHVQPPPKEELEKAREIRLKELQMYDVFREIAFYIVFFCT
LLFVTYSFRDPNAYQLKNELTNIFIKTSNPNWQFTGITREEQFWTWALNV
LVPNLRAPVWYNNDPQLYQRGFISNRNNRLIGYAVMRQVRTKKNSCAVFD
YAKSISKNCYSTYNIFNQDEGSYGKGWTALSANDTPAPEFSFKSEKELNG
MSYIGRIGLYSGGGYVYQFRSNVSNLFTEMNALKDNHWIDFQTRAIFIEF
TTYNPNINLFAINTFVVESPGSGGMWTIYRVEPANLLGLYSGGVKAFEIF
CQVLYGIFILVIIVKEIRNIIKQKWKYFTQFWNLIEVFIVIGSFIAVAGF
VYVQIATSQLTEKFAQYGGDVYLNFAYVAFCNENLGYMVSFIVFLATLKF
IKILRFNRRIGMLGSVLNYTSKDMKQFFIIFTIMFLAFVMVFYSLFMDSL
YRYHTFLFATEASMQIALGKFAFLELYQKEPIFGPIVFAGYVLFIIFVLL
NMFIAILYDGFAVVKADIELQENDHELVKFVVTKFIMWTGISETKFGKKF
IKT
back to top

protein sequence of SMED30002946-orf-2

>SMED30002946-orf-2 ID=SMED30002946-orf-2|Name=SMED30002946-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2663bp
MGTIFKLILSILLIHFSRAEWCIKITLDKVVGIGTYNKDQVSLDRTLCTD
ECYYSGFPFTVVWKNTYCFCANDISAGINVTDFSTCATVDGFYVSASLAS
SLTVIFQMAMATTKFIASGNLVSMSPNIYYYAPPGPPPSFKYSYHDKAGI
WEYSLDSNAIQRVFSISGIYQIRSQVLKPNNQAKISEVSTEIMAYQSVTN
LNITCQPIAIVYIAVNCTVSISNGSFITGQIMADGLIIETLTLPDIPWER
VGAVPNFFNNDFITGQSVSGIYLINGQYQYNGIITSIEFNAFKTGNIDLL
LLKPSCGTYYCIATGSCAATPSCSRTLACGNEYCPLSQSCSAICNNRLLN
KENSSSLPSVSYIINQVQLYPISNTGYQIVTLSVPWPVQAGYRLGFHFGN
GITDLIAVTSLRSGETPNFFYNSQTVTSGTLIPSTSFTPKYISHQFSAVS
VQQRNTKFKLMFNTTGIKNVTVNLQSVDNVVASASSSVIVGLNINDTSFA
NLGYATTNVSYMFIMNPHTGDQLLYYWDFGDNTTLNSTTRFVNHTFTVAG
VYNSSVYVYNTLVSKVQNYLIYVKDAVKINFFNSSGVYNPNVFASFILSM
KSGTGFNCTLSGDGIANQTQPSNNLLFGWQWATEGSFNVRIDCYNELTRD
YKTLVQVIQANITGLTFVNFGGAAFEQMQLRFSWLTGSNITFLLLVNNIS
YSLTQNETALTGISQNITISAPGVLIGVIRATNLISDIILVANLTFSQKI
SNMNLIADKYYTTNGSAFNFYVNMSTGSGVRSVIQYGDGQNNTNINYESP
SVYWPGISVPYTYSNVGTYNVTVNCTNIVNSQTSSVVVYVLTGLGTYEIV
YNNLFFKKNDLIQLSLNRTSGYPASMTNITINWQNGDITSIPFAAFNESA
IYNYVYSANGVYNVTLTLQNPLSTVVKSILLSIIDPIINFRCVNVPANTW
NGNQIQLQTLVDQGQNVIYTLNPGDGGALITKNINISTLNTQYNFNYTYN
TVGNYTSNIWACNQLGCQNCSNYVQIQYKIQSFDFQVQTNGNIEYLKTNL
ITTISFTGTNFPTALMATFTLSDGSPPSTVYLSLSMMPYNFVKNLSVVGF
GNILVKLENLANSVNISATYGSFEKFSNFNVSLTWGPTRALGFGANFNTF
PLNNPVYFRPSAQAKGTVVGYTFLYAPIKNLSAIFQCNATLVNGEFSYTF
STMGDFNVSFKVYNPIDQAFIENTLTIGSSIQNTQISTRPLTLMPNYFGY
ISIQWSVISTESCICVDFANNTKLIYGAMSGCSNCSGYLFANRKPSNNLL
EILVRFSTEGDYNIKVFIYNDYESAFANRTIPVTYAQCAPPVVSMTYTQF
QNPMTPQKDIRSSQIIVSAVVLDLPCILTKNNMKLWSATLMDPIYLTPIK
AVDMSIIPTSNNTQLIIPPRFLNYGLYKLTFSVTMDKNVTIYTFQSSNFT
YLFIDKSPIIVGLSSGGISLIVNGIDQNICFTPLQYSQDPDLNVQDFSKW
IWTWTCQKTTESENLTNYVYPKPIGYSFTTPKTGCFGDGPGVVNFTSSPC
FWGGNLEINGTYQLGLVGMSSDNRTGSAKIIITVVKGIPPDITVQCLRPL
MCKINNVGAFAFNEVVFNPSDALLLSATCYGNGTICGQGLWNLILLNETT
QIWTPLDSSIANLYIKGVYSMQISLLPSFFSFYNTIKRFQICYNSINLTP
NGKSCIQFYIFPLPSGIICTLDKTTVQQTDTVCVNCTFQPNYQYRMYVNV
TNECSTLGFNSTGQFCSIIPYQTVNQTYIVRVTNENGGFIDVIAGIIMVT
QLQLVDLTKILTNVINGTDQTLTVAIAKGDFKEMSQVYLKYVSVLTASNQ
ITIRNLFQPLTNNSKENLGGTGYMTTSVNSSTMTIESLPKDIRAKYEIDR
DQKSTVINSMTAGLYTMVPGDIQSLHLISSVVNAIGESSDCVNRQSQWQL
STKLASLADNFKELQKTAPRDDVLTIATNLLSANYRSDAAANIQIDNGIL
RDIKFSKDTYLDYDTNLESGGKNYLNVDDPSAAAYSLTLETNSNFQSKIA
FGVGSNSLYTIQTISKVLRDITVLNDVPTDLLTSQMQYYSIKTQINDLSN
KAFTKGRSTIILPDICAALNSPPGSCSDPNNPIGLEIIATPNNVRAYAQN
PNKNGLPIPMNSDFVSLSLFLGRQISEKPVQPNGNNNFTIFISRDPVFAV
PDFNFTEPDPQIQPPKSIPGTGTIFTGPQCFEQKLVVYQFKLIGSDQSVH
FQIKSNFSTKCTQYLIVGRLGQPPVLGANPDGSVDSVNFTFWGMIPTHTK
YCNLIPSSDMPDPFTFFVDNSMFKQSKISTKSSMPDYSKTLDTLYFGVRE
LTPAEYDLYTRSNRPPVPYTISAQINNTFRVRIFSTGCYFNSNNFQGGWG
TAGCVVGPLTTTKVTQCICNHLTSFASGWIVAPNTIDFDYVFSNFDFTKN
LTLFVTEIVVALVFIAIFIWARRMDIKDIEKVGVTPLPSNDANDMYLYEV
TIDTSIRANAGTSSNVYFILSGEQDETDPRHLVDNKRPILKRGNVDRFLL
AVPRSLGILQYIRLWHDNSGKGKNASWYCNYFGVTDLQTKEKFHFLVNSW
FAVEENDGQIDRLIAVASVDELLHFEEVFSRKMKLNLSEDHLWLSIMARP
PESRFTRVERVA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002056medial muscle cell
PLANA:0002075pigment cell
Vocabulary: INTERPRO
TermDefinition
IPR013783Ig-like_fold
IPR042060PLAT_polycystin1
IPR035986PKD_dom_sf
IPR036392PLAT/LH2_dom_sf
IPR003915PKD_2
IPR013122PKD1_2_channel
IPR001024PLAT/LH2_dom
IPR000203GPS
IPR022409PKD/Chitinase_dom
IPR000601PKD_dom
IPR002859PKD/REJ-like
IPR000651Ras-like_Gua-exchang_fac_N
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR022409PKD/Chitinase domainSMARTSM00089PKD_9coord: 861..936
e-value: 0.56
score: 14.1
coord: 942..1033
e-value: 0.29
score: 17.0
coord: 502..576
e-value: 1.6
score: 9.9
coord: 780..841
e-value: 10.0
score: 2.0
IPR000203GPS motifSMARTSM00303GPS_3coord: 2384..2434
e-value: 5.6E-4
score: 29.2
IPR000203GPS motifPFAMPF01825GPScoord: 2390..2426
e-value: 3.5E-7
score: 30.6
IPR000203GPS motifPROSITEPS50221GPScoord: 2389..2436
score: 10.489
IPR001024PLAT/LH2 domainSMARTSM00308LH2_4coord: 2496..2618
e-value: 3.7E-9
score: 46.4
IPR001024PLAT/LH2 domainPFAMPF01477PLATcoord: 2498..2607
e-value: 3.1E-17
score: 63.2
IPR001024PLAT/LH2 domainPROSITEPS50095PLATcoord: 2496..2615
score: 34.829
NoneNo IPR availableGENE3DG3DSA:2.60.220.50coord: 2352..2426
e-value: 4.3E-6
score: 28.6
NoneNo IPR availableGENE3DG3DSA:2.60.60.20coord: 2495..2622
e-value: 1.6E-27
score: 97.8
NoneNo IPR availablePANTHERPTHR10877POLYCYSTIN-RELATEDcoord: 2308..2661
NoneNo IPR availablePANTHERPTHR10877:SF150LOCATION OF VULVA DEFECTIVE 1coord: 2308..2661
NoneNo IPR availableCDDcd00146PKDcoord: 525..564
e-value: 0.00113939
score: 37.8614
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.895
NoneNo IPR availableTMHMMTMhelixcoord: 2452..2471
IPR002859PKD/REJ-like domainPFAMPF02010REJcoord: 1412..1837
e-value: 8.7E-17
score: 61.0
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 748..842
e-value: 4.3E-7
score: 31.7
coord: 493..576
e-value: 2.4E-6
score: 29.3
IPR000601PKD domainPROSITEPS50093PKDcoord: 519..561
score: 11.882
IPR000601PKD domainPROSITEPS50093PKDcoord: 870..923
score: 8.522
IPR042060Polycystin-1 like, PLAT/LH2 domainCDDcd01752PLAT_polycystincoord: 2496..2617
e-value: 2.24748E-50
score: 172.46
IPR035986PKD domain superfamilySUPERFAMILYSSF49299PKD domaincoord: 718..841
IPR035986PKD domain superfamilySUPERFAMILYSSF49299PKD domaincoord: 500..573
IPR035986PKD domain superfamilySUPERFAMILYSSF49299PKD domaincoord: 904..1028
IPR036392PLAT/LH2 domain superfamilySUPERFAMILYSSF49723Lipase/lipooxygenase domain (PLAT/LH2 domain)coord: 2497..2604