forkhead box J1-like protein 4

Overview
Nameforkhead box J1-like protein 4 (AFX62231.1)
Smed IDSMED30002934
Uniprot Best hitForkhead box protein J1-B OS=Danio rerio OX=7955 GN=foxj1b PE=2 SV=1 (E=2.19102e-43)
Length (bp)4282
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of forkhead box J1-like protein 4 (SMED30002934) t-SNE clustered cells

Violin plots show distribution of expression levels for forkhead box J1-like protein 4 (SMED30002934) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of forkhead box J1-like protein 4 (SMED30002934) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for forkhead box J1-like protein 4 (SMED30002934) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002934

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30002934SMESG000010030.1 SmedASXL_009891SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30002934 SmedASXL_064213SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30002934SMESG000010030.1 dd_Smed_v4_10152_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30002934SMESG000010030.1 dd_Smed_v4_10152_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30002934SMESG000010030.1 dd_Smed_v6_10152_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30002934SMESG000010030.1 dd_Smed_v6_10152_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30002934SMESG000010030.1 dd_Smed_v6_10152_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
ventral epidermisSMED30002934SMESG000010030.1 JX842846.1smed_ncbi_20200123PMID:23144623
Vij et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30002934SMESG000010030.1 OX_Smed_1.0.11478ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30002934SMESG000010030.1 dd_Smed_v4_10152_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30002934SMESG000010030.1 dd_Smed_v4_10152_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of forkhead box J1-like protein 4 vs. Ensembl Human
Match: FOXJ1 (forkhead box J1 [Source:HGNC Symbol;Acc:HGNC:3816])

HSP 1 Score: 162.155 bits (409), Expect = 3.619e-42
Identity = 95/211 (45.02%), Postives = 119/211 (56.40%), Query Frame = 2
Query:  257 MDDSLTNLNWLHNVPSILGPESPLNSPVHLLNQANHQLLPNLERPAXXXXXXXXXXXXXXXSKQXXXXXXXXXXXXXTHHLDSALKDGGLLDPLVRH-DYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRRQFPLYNMPKIT 886
            +DDSLT+L WL    SIL  ++P   P        HQ+ P    P + + A+     + +   +             T    S     GL  P     DY TN   KPP+SYATLICM+M+    +KITLS IY WITDNF Y+R +D +WQNS+RHNLSLNKCF KVPR KDE GKGGFWRI+P+YA+RL S   K RR  P++  P   
Sbjct:   29 LDDSLTSLQWLQEF-SILNAKAPALPPGGTDPHGYHQV-PGSAAPGSPLAADPACLGQPHTPGKP------------TSSCTSRSAPPGLQAPPPDDVDYATNPHVKPPYSYATLICMAMQASKATKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFA 225          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Human
Match: FOXJ3 (forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178])

HSP 1 Score: 124.02 bits (310), Expect = 1.683e-29
Identity = 59/105 (56.19%), Postives = 74/105 (70.48%), Query Frame = 2
Query:  512 KDGGLLDP---LVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRI--NPK 811
            K   LLDP   L + + + +  GKPP+SYA+LI  ++    K K+TLS+IY WI DNF YYR + S W+NS+RHNLSLNKCF KVPRSKD+ GKG +W I  NPK
Sbjct:   55 KKNALLDPNTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPK 159          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Human
Match: FOXJ3 (forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178])

HSP 1 Score: 124.02 bits (310), Expect = 2.396e-28
Identity = 59/105 (56.19%), Postives = 74/105 (70.48%), Query Frame = 2
Query:  512 KDGGLLDP---LVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRI--NPK 811
            K   LLDP   L + + + +  GKPP+SYA+LI  ++    K K+TLS+IY WI DNF YYR + S W+NS+RHNLSLNKCF KVPRSKD+ GKG +W I  NPK
Sbjct:   55 KKNALLDPNTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPK 159          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Human
Match: FOXJ3 (forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178])

HSP 1 Score: 124.02 bits (310), Expect = 2.908e-28
Identity = 59/105 (56.19%), Postives = 74/105 (70.48%), Query Frame = 2
Query:  512 KDGGLLDP---LVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRI--NPK 811
            K   LLDP   L + + + +  GKPP+SYA+LI  ++    K K+TLS+IY WI DNF YYR + S W+NS+RHNLSLNKCF KVPRSKD+ GKG +W I  NPK
Sbjct:   55 KKNALLDPNTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPK 159          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Human
Match: FOXJ3 (forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178])

HSP 1 Score: 124.02 bits (310), Expect = 2.908e-28
Identity = 59/105 (56.19%), Postives = 74/105 (70.48%), Query Frame = 2
Query:  512 KDGGLLDP---LVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRI--NPK 811
            K   LLDP   L + + + +  GKPP+SYA+LI  ++    K K+TLS+IY WI DNF YYR + S W+NS+RHNLSLNKCF KVPRSKD+ GKG +W I  NPK
Sbjct:   55 KKNALLDPNTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPK 159          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Celegans
Match: fkh-2 (ForKHead transcription factor family [Source:UniProtKB/TrEMBL;Acc:Q95QA9])

HSP 1 Score: 97.0561 bits (240), Expect = 1.082e-21
Identity = 41/85 (48.24%), Postives = 60/85 (70.59%), Query Frame = 2
Query:  572 KPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRL 826
            KPPFSY  LI M++++  + ++TL+ IY +I  N+ +YR +   WQNS+RHNLSLNKCF KVPR+ D+ GKG +W ++    D +
Sbjct:   93 KPPFSYNALIMMAIKDSPEKRLTLAGIYEYIVTNYPFYRDNKQGWQNSIRHNLSLNKCFVKVPRNFDDPGKGNYWMLDATAEDEV 177          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 99.7525 bits (247), Expect = 1.584e-21
Identity = 49/111 (44.14%), Postives = 69/111 (62.16%), Query Frame = 2
Query:  524 LLDPLVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRRQ 856
            + + + RH   T    KPP+SY +LI M++++ N  ++TLS+IY WI D F YY+ +   WQNS+RH+LS N CF KV RS D+ GKG FW ++    +  E N    RRQ
Sbjct:  158 VTEKIRRHG--TYGQSKPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTLHEHCGNMFE-NGCYLRRQ 265          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 99.3673 bits (246), Expect = 1.614e-21
Identity = 49/111 (44.14%), Postives = 69/111 (62.16%), Query Frame = 2
Query:  524 LLDPLVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRRQ 856
            + + + RH   T    KPP+SY +LI M++++ N  ++TLS+IY WI D F YY+ +   WQNS+RH+LS N CF KV RS D+ GKG FW ++    +  E N    RRQ
Sbjct:  127 VTEKIRRHG--TYGQSKPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTLHEHCGNMFE-NGCYLRRQ 234          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 99.3673 bits (246), Expect = 3.370e-21
Identity = 49/111 (44.14%), Postives = 69/111 (62.16%), Query Frame = 2
Query:  524 LLDPLVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRRQ 856
            + + + RH   T    KPP+SY +LI M++++ N  ++TLS+IY WI D F YY+ +   WQNS+RH+LS N CF KV RS D+ GKG FW ++    +  E N    RRQ
Sbjct:  222 VTEKIRRHG--TYGQSKPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTLHEHCGNMFE-NGCYLRRQ 329          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Celegans
Match: unc-130 (pep chromosome:WBcel235:II:11281986:11283953:1 gene:WBGene00006853.1 transcript:C47G2.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-130)

HSP 1 Score: 90.8929 bits (224), Expect = 3.972e-19
Identity = 42/96 (43.75%), Postives = 58/96 (60.42%), Query Frame = 2
Query:  569 GKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRRQ 856
             KPP+SY  LI MS+    + K+TLS+I  +I + F YY+    +WQNS+RHNLSLN CF KV R     GKG +W ++P   D  ++     RR+
Sbjct:  126 AKPPYSYIALIAMSILNSPEKKLTLSEICEFIINKFEYYKEKFPAWQNSIRHNLSLNDCFVKVARGPGNPGKGNYWALDPNCEDMFDNGSFLRRRK 221          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Fly
Match: fd96Ca (gene:FBgn0004897 transcript:FBtr0339246)

HSP 1 Score: 103.605 bits (257), Expect = 4.581e-23
Identity = 47/100 (47.00%), Postives = 66/100 (66.00%), Query Frame = 2
Query:  572 KPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLE-SNLIKYRRQFPLY 868
            KPP+SY +L  M++    +  + LSDIY +ITD F YYR +   WQNS+RHNLS N CF KVPR  D  GKG +W ++P+  D  E  +L++ R++F L+
Sbjct:   13 KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLH 112          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Fly
Match: fd96Ca (gene:FBgn0004897 transcript:FBtr0084770)

HSP 1 Score: 103.605 bits (257), Expect = 4.581e-23
Identity = 47/100 (47.00%), Postives = 66/100 (66.00%), Query Frame = 2
Query:  572 KPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLE-SNLIKYRRQFPLY 868
            KPP+SY +L  M++    +  + LSDIY +ITD F YYR +   WQNS+RHNLS N CF KVPR  D  GKG +W ++P+  D  E  +L++ R++F L+
Sbjct:   13 KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLH 112          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Fly
Match: FoxK (gene:FBgn0036134 transcript:FBtr0332653)

HSP 1 Score: 104.375 bits (259), Expect = 3.087e-22
Identity = 53/114 (46.49%), Postives = 71/114 (62.28%), Query Frame = 2
Query:  560 NWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRL-SDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRRQ------FPLYNMPK 880
            N + KPP+SYA LI  ++      ++TLS IY +I  ++ YYR  ++  WQNS+RHNLSLN+ F KV RS+DE GKG FWRI+P    +L  +  K RRQ       P Y MP+
Sbjct:  448 NHNEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVARSQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQRSSQGFRPPYGMPR 561          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Fly
Match: FoxK (gene:FBgn0036134 transcript:FBtr0300783)

HSP 1 Score: 104.375 bits (259), Expect = 3.175e-22
Identity = 53/114 (46.49%), Postives = 71/114 (62.28%), Query Frame = 2
Query:  560 NWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRL-SDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRRQ------FPLYNMPK 880
            N + KPP+SYA LI  ++      ++TLS IY +I  ++ YYR  ++  WQNS+RHNLSLN+ F KV RS+DE GKG FWRI+P    +L  +  K RRQ       P Y MP+
Sbjct:  449 NHNEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVARSQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQRSSQGFRPPYGMPR 562          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Fly
Match: FoxK (gene:FBgn0036134 transcript:FBtr0300784)

HSP 1 Score: 104.375 bits (259), Expect = 3.175e-22
Identity = 53/114 (46.49%), Postives = 71/114 (62.28%), Query Frame = 2
Query:  560 NWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRL-SDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRRQ------FPLYNMPK 880
            N + KPP+SYA LI  ++      ++TLS IY +I  ++ YYR  ++  WQNS+RHNLSLN+ F KV RS+DE GKG FWRI+P    +L  +  K RRQ       P Y MP+
Sbjct:  449 NHNEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLSLNRYFIKVARSQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQRSSQGFRPPYGMPR 562          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Zebrafish
Match: foxj1b (forkhead box J1b [Source:NCBI gene;Acc:494105])

HSP 1 Score: 168.318 bits (425), Expect = 2.902e-44
Identity = 106/232 (45.69%), Postives = 134/232 (57.76%), Query Frame = 2
Query:  200 LAEKFQKNWL-----DKKGI-DSKEMDDSLTNLNWLHNVPSILG--PESPLNS---PVHLL---NQANHQLLPNLERPAXXXXXXXXXXXXXXXSKQXXXXXXXXXXXXXTHHLDSALKDGGLLDPLVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRR 853
            +A KF++ WL     D+  +  S   DDSLT+L+WL N  SIL   PE   +S   P HL    NQ      P+   PA +  A        N +       N  +     H++       G  +P    DYKTN   KPP+SYATLICM+M+  NK+KITLS IY WIT+NF YYR ++ SWQNS+RHNLSLNKCF KVPR KDE GKGGFW+I+P+YAD   + + K RR
Sbjct:    9 IANKFKEKWLMLHPEDQDNVSGSVHFDDSLTSLHWLQNF-SILSANPERTPSSGCHPQHLFYYKNQLGGTDSPS-SPPAGDTAATGMPQTPGNPTTSCSSLANPYALQQAGHYIT------GQTNPAEEIDYKTNRHVKPPYSYATLICMAMQASNKTKITLSAIYSWITENFCYYRYAEPSWQNSIRHNLSLNKCFMKVPRQKDEPGKGGFWQIDPQYADMFVNGVFKRRR 232          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Zebrafish
Match: foxj1b (forkhead box J1b [Source:NCBI gene;Acc:494105])

HSP 1 Score: 168.318 bits (425), Expect = 2.902e-44
Identity = 106/232 (45.69%), Postives = 134/232 (57.76%), Query Frame = 2
Query:  200 LAEKFQKNWL-----DKKGI-DSKEMDDSLTNLNWLHNVPSILG--PESPLNS---PVHLL---NQANHQLLPNLERPAXXXXXXXXXXXXXXXSKQXXXXXXXXXXXXXTHHLDSALKDGGLLDPLVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRR 853
            +A KF++ WL     D+  +  S   DDSLT+L+WL N  SIL   PE   +S   P HL    NQ      P+   PA +  A        N +       N  +     H++       G  +P    DYKTN   KPP+SYATLICM+M+  NK+KITLS IY WIT+NF YYR ++ SWQNS+RHNLSLNKCF KVPR KDE GKGGFW+I+P+YAD   + + K RR
Sbjct:    9 IANKFKEKWLMLHPEDQDNVSGSVHFDDSLTSLHWLQNF-SILSANPERTPSSGCHPQHLFYYKNQLGGTDSPS-SPPAGDTAATGMPQTPGNPTTSCSSLANPYALQQAGHYIT------GQTNPAEEIDYKTNRHVKPPYSYATLICMAMQASNKTKITLSAIYSWITENFCYYRYAEPSWQNSIRHNLSLNKCFMKVPRQKDEPGKGGFWQIDPQYADMFVNGVFKRRR 232          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Zebrafish
Match: foxj1a (forkhead box J1a [Source:NCBI gene;Acc:767737])

HSP 1 Score: 158.303 bits (399), Expect = 1.137e-40
Identity = 76/133 (57.14%), Postives = 97/133 (72.93%), Query Frame = 2
Query:  548 DYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRRQFPLYNMPKITNGL---PAASTLLSRTTNYS 937
            DYK+N   KPP+SYATLICM+M+   K+KITLS IY WITDNF Y+R +D +WQNS+RHNLSLNKCF KVPR KDE GKGGFW+I+P+YA+RL +   K RR  P+   P + + L     A+ ++SR  + S
Sbjct:  134 DYKSNPHIKPPYSYATLICMAMQASKKTKITLSCIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPRQKDEPGKGGFWKIDPQYAERLLNGAYKKRRLPPVQINPALQHRLRMNAQATGVISRNLSVS 266          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Zebrafish
Match: foxj1a (forkhead box J1a [Source:NCBI gene;Acc:767737])

HSP 1 Score: 158.303 bits (399), Expect = 1.137e-40
Identity = 76/133 (57.14%), Postives = 97/133 (72.93%), Query Frame = 2
Query:  548 DYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRRQFPLYNMPKITNGL---PAASTLLSRTTNYS 937
            DYK+N   KPP+SYATLICM+M+   K+KITLS IY WITDNF Y+R +D +WQNS+RHNLSLNKCF KVPR KDE GKGGFW+I+P+YA+RL +   K RR  P+   P + + L     A+ ++SR  + S
Sbjct:  134 DYKSNPHIKPPYSYATLICMAMQASKKTKITLSCIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPRQKDEPGKGGFWKIDPQYAERLLNGAYKKRRLPPVQINPALQHRLRMNAQATGVISRNLSVS 266          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Zebrafish
Match: foxj3 (forkhead box J3 [Source:ZFIN;Acc:ZDB-GENE-101005-1])

HSP 1 Score: 123.25 bits (308), Expect = 2.247e-28
Identity = 59/105 (56.19%), Postives = 74/105 (70.48%), Query Frame = 2
Query:  512 KDGGLLDP---LVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRI--NPK 811
            K   LLDP   L + + + +  GKPP+SYA+LI  ++    K K+TLS+IY WI DNF YYR + S W+NS+RHNLSLNKCF KVPRSKD+ GKG +W I  NPK
Sbjct:   39 KKSALLDPNTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPK 143          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Xenopus
Match: foxj1 (forkhead box J1 [Source:NCBI gene;Acc:496834])

HSP 1 Score: 163.31 bits (412), Expect = 5.991e-42
Identity = 75/117 (64.10%), Postives = 90/117 (76.92%), Query Frame = 2
Query:  527 LDPLVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRRQFPLYNMP 877
            L P+   DYKTN   KPP+SYATLICM+M+   K+KITLS IY WITDNF Y+R +D +WQNS+RHNLSLNKCF KVPR KDE GKGGFW+I+P+YADRL +  +K RR  P+   P
Sbjct:  169 LQPMEDIDYKTNPHVKPPYSYATLICMAMQASKKTKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWKIDPQYADRLMNGAMKKRRLPPVQIHP 285          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Xenopus
Match: prss2 (serine protease 2 [Source:Xenbase;Acc:XB-GENE-6065254])

HSP 1 Score: 153.295 bits (386), Expect = 1.417e-39
Identity = 67/107 (62.62%), Postives = 83/107 (77.57%), Query Frame = 2
Query:  533 PLVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRR 853
            P+   DY+TN + KPP+SYATLICM+M    + K+TLS IY WIT NF YYR +D SWQNS+RHNLSLNKCF KVPR KDE GKGGFW+++P+YAD   + ++K RR
Sbjct:   96 PVQEVDYRTNANIKPPYSYATLICMAMEASQQRKLTLSAIYSWITQNFCYYRHADPSWQNSIRHNLSLNKCFMKVPRGKDEPGKGGFWQMDPRYADMFVNGVLKRRR 202          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Xenopus
Match: ndel1 (nudE neurodevelopment protein 1 like 1 [Source:Xenbase;Acc:XB-GENE-989304])

HSP 1 Score: 120.168 bits (300), Expect = 3.024e-27
Identity = 57/105 (54.29%), Postives = 74/105 (70.48%), Query Frame = 2
Query:  512 KDGGLLDP---LVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRI--NPK 811
            K   +LDP   L + + + +  GKPP+SYA+LI  ++    K K+TLS+IY WI DNF YY+ + S W+NS+RHNLSLNKCF KVPRSKD+ GKG +W I  NPK
Sbjct:   57 KKNSVLDPNTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYKEAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPK 161          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Xenopus
Match: ndel1 (nudE neurodevelopment protein 1 like 1 [Source:Xenbase;Acc:XB-GENE-989304])

HSP 1 Score: 120.553 bits (301), Expect = 3.062e-27
Identity = 57/105 (54.29%), Postives = 74/105 (70.48%), Query Frame = 2
Query:  512 KDGGLLDP---LVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRI--NPK 811
            K   +LDP   L + + + +  GKPP+SYA+LI  ++    K K+TLS+IY WI DNF YY+ + S W+NS+RHNLSLNKCF KVPRSKD+ GKG +W I  NPK
Sbjct:   40 KKNSVLDPNTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYKEAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPK 144          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Xenopus
Match: ndel1 (nudE neurodevelopment protein 1 like 1 [Source:Xenbase;Acc:XB-GENE-989304])

HSP 1 Score: 120.168 bits (300), Expect = 3.217e-27
Identity = 57/105 (54.29%), Postives = 74/105 (70.48%), Query Frame = 2
Query:  512 KDGGLLDP---LVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRI--NPK 811
            K   +LDP   L + + + +  GKPP+SYA+LI  ++    K K+TLS+IY WI DNF YY+ + S W+NS+RHNLSLNKCF KVPRSKD+ GKG +W I  NPK
Sbjct:   40 KKNSVLDPNTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYKEAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPK 144          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Mouse
Match: Foxj1 (forkhead box J1 [Source:MGI Symbol;Acc:MGI:1347474])

HSP 1 Score: 163.696 bits (413), Expect = 7.422e-43
Identity = 95/211 (45.02%), Postives = 117/211 (55.45%), Query Frame = 2
Query:  257 MDDSLTNLNWLHNVPSILGPESPLNSPVHLLNQANHQLLPNLERPAXXXXXXXXXXXXXXXSKQXXXXXXXXXXXXXTHHLDSALKDGGLLDPLVRH-DYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRRQFPLYNMPKIT 886
            +DDSLT+L WL    SIL  ++P   P        HQ+ P L  P + +            +          +    T    S     GL  P     DY TN   KPP+SYATLICM+M+    +KITLS IY WITDNF Y+R +D +WQNS+RHNLSLNKCF KVPR KDE GKGGFWRI+P+YA+RL S   K RR  P++  P   
Sbjct:   29 LDDSLTSLQWLQEF-SILNAKAPTLPPGGTDPHGYHQV-PGLVAPGSPL------------AADPACLGQPHTPGKPTSSCTSRSAPPGLQAPPPDDVDYATNPHVKPPYSYATLICMAMQASKATKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFA 225          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Mouse
Match: Foxj3 (forkhead box J3 [Source:MGI Symbol;Acc:MGI:2443432])

HSP 1 Score: 122.865 bits (307), Expect = 3.096e-28
Identity = 59/105 (56.19%), Postives = 74/105 (70.48%), Query Frame = 2
Query:  512 KDGGLLDP---LVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRI--NPK 811
            K   LLDP   L + + + +  GKPP+SYA+LI  ++    K K+TLS+IY WI DNF YYR + S W+NS+RHNLSLNKCF KVPRSKD+ GKG +W I  NPK
Sbjct:   55 KKNALLDPNTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPK 159          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Mouse
Match: Foxj3 (forkhead box J3 [Source:MGI Symbol;Acc:MGI:2443432])

HSP 1 Score: 123.25 bits (308), Expect = 3.670e-28
Identity = 59/105 (56.19%), Postives = 74/105 (70.48%), Query Frame = 2
Query:  512 KDGGLLDP---LVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRI--NPK 811
            K   LLDP   L + + + +  GKPP+SYA+LI  ++    K K+TLS+IY WI DNF YYR + S W+NS+RHNLSLNKCF KVPRSKD+ GKG +W I  NPK
Sbjct:   55 KKNALLDPNTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPK 159          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Mouse
Match: Foxj3 (forkhead box J3 [Source:MGI Symbol;Acc:MGI:2443432])

HSP 1 Score: 108.227 bits (269), Expect = 1.168e-26
Identity = 53/94 (56.38%), Postives = 67/94 (71.28%), Query Frame = 2
Query:  512 KDGGLLDP---LVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGK 784
            K   LLDP   L + + + +  GKPP+SYA+LI  ++    K K+TLS+IY WI DNF YYR + S W+NS+RHNLSLNKCF KVPRSKD+ GK
Sbjct:   55 KKNALLDPNTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGK 148          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Mouse
Match: Foxj3 (forkhead box J3 [Source:MGI Symbol;Acc:MGI:2443432])

HSP 1 Score: 108.227 bits (269), Expect = 1.168e-26
Identity = 53/94 (56.38%), Postives = 67/94 (71.28%), Query Frame = 2
Query:  512 KDGGLLDP---LVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGK 784
            K   LLDP   L + + + +  GKPP+SYA+LI  ++    K K+TLS+IY WI DNF YYR + S W+NS+RHNLSLNKCF KVPRSKD+ GK
Sbjct:   55 KKNALLDPNTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGK 148          
BLAST of forkhead box J1-like protein 4 vs. UniProt
Match: sp|F1R8Z9|FXJ1B_DANRE (Forkhead box protein J1-B OS=Danio rerio OX=7955 GN=foxj1b PE=2 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 2.191e-43
Identity = 106/232 (45.69%), Postives = 134/232 (57.76%), Query Frame = 2
Query:  200 LAEKFQKNWL-----DKKGI-DSKEMDDSLTNLNWLHNVPSILG--PESPLNS---PVHLL---NQANHQLLPNLERPAXXXXXXXXXXXXXXXSKQXXXXXXXXXXXXXTHHLDSALKDGGLLDPLVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRR 853
            +A KF++ WL     D+  +  S   DDSLT+L+WL N  SIL   PE   +S   P HL    NQ      P+   PA +  A        N +       N  +     H++       G  +P    DYKTN   KPP+SYATLICM+M+  NK+KITLS IY WIT+NF YYR ++ SWQNS+RHNLSLNKCF KVPR KDE GKGGFW+I+P+YAD   + + K RR
Sbjct:    9 IANKFKEKWLMLHPEDQDNVSGSVHFDDSLTSLHWLQNF-SILSANPERTPSSGCHPQHLFYYKNQLGGTDSPS-SPPAGDTAATGMPQTPGNPTTSCSSLANPYALQQAGHYIT------GQTNPAEEIDYKTNRHVKPPYSYATLICMAMQASNKTKITLSAIYSWITENFCYYRYAEPSWQNSIRHNLSLNKCFMKVPRQKDEPGKGGFWQIDPQYADMFVNGVFKRRR 232          
BLAST of forkhead box J1-like protein 4 vs. UniProt
Match: sp|Q61660|FOXJ1_MOUSE (Forkhead box protein J1 OS=Mus musculus OX=10090 GN=Foxj1 PE=1 SV=2)

HSP 1 Score: 163.696 bits (413), Expect = 5.192e-42
Identity = 95/211 (45.02%), Postives = 117/211 (55.45%), Query Frame = 2
Query:  257 MDDSLTNLNWLHNVPSILGPESPLNSPVHLLNQANHQLLPNLERPAXXXXXXXXXXXXXXXSKQXXXXXXXXXXXXXTHHLDSALKDGGLLDPLVRH-DYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRRQFPLYNMPKIT 886
            +DDSLT+L WL    SIL  ++P   P        HQ+ P L  P + +            +          +    T    S     GL  P     DY TN   KPP+SYATLICM+M+    +KITLS IY WITDNF Y+R +D +WQNS+RHNLSLNKCF KVPR KDE GKGGFWRI+P+YA+RL S   K RR  P++  P   
Sbjct:   29 LDDSLTSLQWLQEF-SILNAKAPTLPPGGTDPHGYHQV-PGLVAPGSPL------------AADPACLGQPHTPGKPTSSCTSRSAPPGLQAPPPDDVDYATNPHVKPPYSYATLICMAMQASKATKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFA 225          
BLAST of forkhead box J1-like protein 4 vs. UniProt
Match: sp|Q708W2|FXJ1A_XENLA (Forkhead box protein J1-A OS=Xenopus laevis OX=8355 GN=foxj1-a PE=2 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 7.811e-42
Identity = 75/117 (64.10%), Postives = 90/117 (76.92%), Query Frame = 2
Query:  527 LDPLVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRRQFPLYNMP 877
            L P+   DYKTN   KPP+SYATLICM+M+   K+KITLS IY WITDNF Y+R +D +WQNS+RHNLSLNKCF KVPR KDE GKGGFW+I+P+YADRL +  +K RR  P+   P
Sbjct:  109 LQPMEEIDYKTNPHVKPPYSYATLICMAMQASKKTKITLSAIYNWITDNFCYFRHADPTWQNSIRHNLSLNKCFMKVPREKDEPGKGGFWKIDPQYADRLINGAMKKRRLPPVQIHP 225          
BLAST of forkhead box J1-like protein 4 vs. UniProt
Match: sp|Q708W1|FXJ1B_XENLA (Forkhead box protein J1-B OS=Xenopus laevis OX=8355 GN=foxj1-b PE=2 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 8.110e-42
Identity = 75/117 (64.10%), Postives = 90/117 (76.92%), Query Frame = 2
Query:  527 LDPLVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRRQFPLYNMP 877
            L P+   DYKTN   KPP+SYATLICM+M+   K+KITLS IY WITDNF Y+R +D +WQNS+RHNLSLNKCF KVPR KDE GKGGFW+I+P+YADRL +  +K RR  P+   P
Sbjct:  109 LQPMEEIDYKTNPHVKPPYSYATLICMAMQASKKTKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWKIDPQYADRLMNGAMKKRRLPPVQIHP 225          
BLAST of forkhead box J1-like protein 4 vs. UniProt
Match: sp|Q63247|FOXJ1_RAT (Forkhead box protein J1 OS=Rattus norvegicus OX=10116 GN=Foxj1 PE=2 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 9.865e-42
Identity = 96/211 (45.50%), Postives = 120/211 (56.87%), Query Frame = 2
Query:  257 MDDSLTNLNWLHNVPSILGPESPLNSPVHLLNQANHQLLPNLERPAXXXXXXXXXXXXXXXSKQXXXXXXXXXXXXXTHHLDSALKDGGLLDPLVRH-DYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRRQFPLYNMPKIT 886
            +DDSLT+L WL    SIL  ++P   P        HQ+ P L  P + + A+     + +   +             T    S     GL  P     DY TN   KPP+SYATLICM+M+    +KITLS IY WITDNF Y+R +D +WQNS+RHNLSLNKCF KVPR KDE GKGGFWRI+P+YA+RL S   K RR  P++  P   
Sbjct:   29 LDDSLTSLQWLQEF-SILNAKAPTLPPGGTDPLGYHQV-PGLVAPGSPLAADPACLGQPHTPGKP------------TSSCTSRSAPPGLQAPPPDDVDYATNPHVKPPYSYATLICMAMQASKATKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFA 225          
BLAST of forkhead box J1-like protein 4 vs. TrEMBL
Match: gnl|BL_ORD_ID|20344509 (tr|K7XGV5|K7XGV5_SCHMD Forkhead box J1-like protein 4 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 998.808 bits (2581), Expect = 0.000e+0
Identity = 529/529 (100.00%), Postives = 529/529 (100.00%), Query Frame = 2
Query:   44 MLTQHDSTCLPKIHIKYSQPEQRLSKNYLTTSKLNSIQIYTTEVFNGKKLSVLAEKFQKNWLDKKGIDSKEMDDSLTNLNWLHNVPSILGPESPLNSPVHLLNQANHQLLPNLERPAXXXXXXXXXXXXXXXSKQXXXXXXXXXXXXXTHHLDSALKDGGLLDPLVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRRQFPLYNMPKITNGLPAASTLLSRTTNYSYMLCQSSVNTDNTWSNSMTTNNQNSFAFRDPQPILSENSLPFKSKRGWDNSGATYLPNLTNYNQGKLISSSAFSNFNNDVTSNEDYCQNRKHNSKTYHTQSYRNHNMTKLQSLDEFRTSETGQKVDTQMRTEITPNHSPTMYSLLNHLNSPPSHVSMXXXXXXXXXXXXXELTANTGSCATLHSHSDDPDEALRFGTSLGDDFMVGSDDYLNCDSIRSHDQLFDSVNSQFI 1630
            MLTQHDSTCLPKIHIKYSQPEQRLSKNYLTTSKLNSIQIYTTEVFNGKKLSVLAEKFQKNWLDKKGIDSKEMDDSLTNLNWLHNVPSILGPESPLNSPVHLLNQANHQLLPNLERPANNIIANNFVNNEINISKQSEFSNNFSSNPSFTHHLDSALKDGGLLDPLVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRRQFPLYNMPKITNGLPAASTLLSRTTNYSYMLCQSSVNTDNTWSNSMTTNNQNSFAFRDPQPILSENSLPFKSKRGWDNSGATYLPNLTNYNQGKLISSSAFSNFNNDVTSNEDYCQNRKHNSKTYHTQSYRNHNMTKLQSLDEFRTSETGQKVDTQMRTEITPNHSPTMYSLLNHLNSPPSHVSMDDIDSAASSSFDAELTANTGSCATLHSHSDDPDEALRFGTSLGDDFMVGSDDYLNCDSIRSHDQLFDSVNSQFI
Sbjct:    1 MLTQHDSTCLPKIHIKYSQPEQRLSKNYLTTSKLNSIQIYTTEVFNGKKLSVLAEKFQKNWLDKKGIDSKEMDDSLTNLNWLHNVPSILGPESPLNSPVHLLNQANHQLLPNLERPANNIIANNFVNNEINISKQSEFSNNFSSNPSFTHHLDSALKDGGLLDPLVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRRQFPLYNMPKITNGLPAASTLLSRTTNYSYMLCQSSVNTDNTWSNSMTTNNQNSFAFRDPQPILSENSLPFKSKRGWDNSGATYLPNLTNYNQGKLISSSAFSNFNNDVTSNEDYCQNRKHNSKTYHTQSYRNHNMTKLQSLDEFRTSETGQKVDTQMRTEITPNHSPTMYSLLNHLNSPPSHVSMDDIDSAASSSFDAELTANTGSCATLHSHSDDPDEALRFGTSLGDDFMVGSDDYLNCDSIRSHDQLFDSVNSQFI 529          
BLAST of forkhead box J1-like protein 4 vs. TrEMBL
Match: gnl|BL_ORD_ID|16006258 (tr|A0A0R3WK74|A0A0R3WK74_HYDTA Fork-head domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS1108 PE=4 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 1.210e-52
Identity = 116/225 (51.56%), Postives = 141/225 (62.67%), Query Frame = 2
Query:  179 NGKKLSVLAEKFQKNWLDKKGIDSKEMDDSLTNLNWLHNVPSILGPESPLNSPVHLLNQANHQLLPNLERPAXXXXXXXXXXXXXXXSKQXXXXXXXXXXXXXTHHLDSALKDGGLLDPLVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRR 853
             G +LS LA++F++NWL K     ++ DDSLTNL WL ++ S    ES    P    N+ N  ++   +RP     A    +                     TH        G LLDP VR DY+T W+GKPPFSYA+LIC++MREL K K+TLSDIYGWI  NF YYR +DSSWQNSVRHNLSLNKCFEKVPR K ERGKGGFWR+NP++AD LE+NL K RR
Sbjct:   38 GGSRLSTLAQRFRENWL-KCNPSFRDTDDSLTNLTWLFDM-SPFSLESDGLGP----NKGNKFVV---DRPTVFTNAKISWHP--------------------THPYA-----GSLLDPQVRMDYRTKWTGKPPFSYASLICLAMRELGKPKVTLSDIYGWIMANFAYYRHTDSSWQNSVRHNLSLNKCFEKVPREKGERGKGGFWRVNPRHADWLEANLAKCRR 228          
BLAST of forkhead box J1-like protein 4 vs. TrEMBL
Match: gnl|BL_ORD_ID|17182670 (tr|A0A4Z2DWG2|A0A4Z2DWG2_SCHJA Forkhead box protein isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_002042 PE=4 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 2.190e-52
Identity = 113/226 (50.00%), Postives = 143/226 (63.27%), Query Frame = 2
Query:  176 FNGKKLSVLAEKFQKNWLDKKGIDSKEMDDSLTNLNWLHNVPSILGPESPLNSPVHLLNQANHQLLPNLERPAXXXXXXXXXXXXXXXSKQXXXXXXXXXXXXXTHHLDSALKDGGLLDPLVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRR 853
            F G  L +LAEK +KNW+ K   DS + DDSLT+L WL++            +P+ +          NLE  A+               ++ +  +    N S   ++ S    G LLDP +R +Y+T W+GKPPFSYATLIC++MREL K K+TLSDIYGWI +NF YYR +DSSWQNSVRHNLSLNKCFEKVPR K ERGKGGFWR+NP++ D LE+NL K RR
Sbjct:   12 FYGNSLKLLAEKLRKNWMQKLS-DSDQTDDSLTSLTWLYDA-----------NPISI----------NLETAASLE------------GQEIKLCSALYDNYSKQSYVGSQPFTGSLLDPQIRLEYRTKWTGKPPFSYATLICLAMRELGKPKVTLSDIYGWIMNNFAYYRHTDSSWQNSVRHNLSLNKCFEKVPRDKGERGKGGFWRVNPRHIDWLEANLAKCRR 203          
BLAST of forkhead box J1-like protein 4 vs. TrEMBL
Match: gnl|BL_ORD_ID|24657734 (tr|A0A5K3FUB3|A0A5K3FUB3_9CEST Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 1.938e-51
Identity = 116/221 (52.49%), Postives = 138/221 (62.44%), Query Frame = 2
Query:  191 LSVLAEKFQKNWLDKKGIDSKEMDDSLTNLNWLHNVPSILGPESPLNSPVHLLNQANHQLLPNLERPAXXXXXXXXXXXXXXXSKQXXXXXXXXXXXXXTHHLDSALKDGGLLDPLVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRR 853
            LS LA++F++NWL K     ++ DDSLTNL WL +    + P S L S     N+ N  +    +RPA    A                          TH        G LLDP VR DY+T W+GKPPFSYA+LIC++MREL K K+TLSDIYGWI  NF YYR +DSSWQNSVRHNLSLNKCFEKVPR K ERGKGGFWR+NP++AD LE+NL K RR
Sbjct:   42 LSSLAQRFRENWL-KCNPPFRDTDDSLTNLTWLFD----MSPFS-LESDGLGTNKNNRFIA---DRPAVFPSAKISWQP--------------------THPYA-----GSLLDPQVRMDYRTKWTGKPPFSYASLICLAMRELGKPKVTLSDIYGWIMTNFAYYRHTDSSWQNSVRHNLSLNKCFEKVPREKGERGKGGFWRVNPRHADWLEANLAKCRR 228          
BLAST of forkhead box J1-like protein 4 vs. TrEMBL
Match: gnl|BL_ORD_ID|22544695 (tr|A0A5J4P2H4|A0A5J4P2H4_9TREM Fork-head domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0008079 PE=4 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 2.424e-51
Identity = 114/232 (49.14%), Postives = 139/232 (59.91%), Query Frame = 2
Query:  158 IYTTEVFNGKKLSVLAEKFQKNWLDKKGIDSKEMDDSLTNLNWLHNVPSILGPESPLNSPVHLLNQANHQLLPNLERPAXXXXXXXXXXXXXXXSKQXXXXXXXXXXXXXTHHLDSALKDGGLLDPLVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRR 853
            I  T  F    L+VL+E+ + NWL K    S   DDSLTNL WL+++            PV       H+                        S ++      +++ S   +       G LLDP VR DY+T W+GKPPFSYATLIC++MREL K K+TLSDIYGWI +NF YYR +DSSWQNSVRHNLSLNKCFEKVPR K+ERGKGGFWR+NPK+AD LE+NL K RR
Sbjct:    6 INQTLEFYEDSLNVLSERLRANWLQKLN-KSDATDDSLTNLTWLYDM-----------HPVGFEVDVTHK------------------------SNEASAELGGTNSDSHVPNFGQLPFSGSLLDPQVRLDYRTKWTGKPPFSYATLICLAMRELGKPKVTLSDIYGWIMNNFAYYRHTDSSWQNSVRHNLSLNKCFEKVPRDKNERGKGGFWRVNPKHADWLEANLAKCRR 201          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Cavefish
Match: ENSAMXT00000049290.1 (forkhead box J1 [Source:NCBI gene;Acc:103028087])

HSP 1 Score: 163.31 bits (412), Expect = 2.059e-42
Identity = 76/116 (65.52%), Postives = 89/116 (76.72%), Query Frame = 2
Query:  548 DYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRRQFPLYNMPKITNGL 895
            DYKTN   KPP+SYATLICM+M+   KSKITLS IY WITDNF Y+R +D +WQNS+RHNLSLNKCF KVPR KDE GKGGFW+I+P+YA+RL S   K RR  P+   P + N L
Sbjct:  139 DYKTNPHIKPPYSYATLICMAMQASKKSKITLSCIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPRQKDEPGKGGFWKIDPQYAERLLSGAYKKRRTPPVQINPALQNHL 254          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Cavefish
Match: foxj3 (forkhead box J3 [Source:NCBI gene;Acc:103033658])

HSP 1 Score: 122.865 bits (307), Expect = 2.560e-28
Identity = 60/111 (54.05%), Postives = 75/111 (67.57%), Query Frame = 2
Query:  494 HLDSALKDGGLLDP---LVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRI--NPK 811
            H     K   LLDP   L + + + +  GKPP+SYA+LI  ++    K K+TLS+IY WI DNF YYR + S W+NS+RHNLSLNKCF KVPRSKD+ GKG +W I  NPK
Sbjct:   43 HGPGMAKKSALLDPNTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPK 153          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Cavefish
Match: foxj3 (forkhead box J3 [Source:NCBI gene;Acc:103033658])

HSP 1 Score: 123.25 bits (308), Expect = 3.223e-28
Identity = 60/111 (54.05%), Postives = 75/111 (67.57%), Query Frame = 2
Query:  494 HLDSALKDGGLLDP---LVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRI--NPK 811
            H     K   LLDP   L + + + +  GKPP+SYA+LI  ++    K K+TLS+IY WI DNF YYR + S W+NS+RHNLSLNKCF KVPRSKD+ GKG +W I  NPK
Sbjct:   33 HGPGMAKKSALLDPNTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPK 143          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Cavefish
Match: foxj3 (forkhead box J3 [Source:NCBI gene;Acc:103033658])

HSP 1 Score: 112.464 bits (280), Expect = 5.673e-25
Identity = 54/101 (53.47%), Postives = 68/101 (67.33%), Query Frame = 2
Query:  494 HLDSALKDGGLLDP---LVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKG 787
            H     K   LLDP   L + + + +  GKPP+SYA+LI  ++    K K+TLS+IY WI DNF YYR + S W+NS+RHNLSLNKCF KVPRSKD+ GK 
Sbjct:   33 HGPGMAKKSALLDPNTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKA 133          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Cavefish
Match: foxk1 (forkhead box K1 [Source:NCBI gene;Acc:103029597])

HSP 1 Score: 111.309 bits (277), Expect = 1.777e-24
Identity = 48/95 (50.53%), Postives = 64/95 (67.37%), Query Frame = 2
Query:  572 KPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRRQ 856
            KPP+SYA LI  ++      ++TLS IY  IT ++ YYR +D  WQNS+RHNLSLN+ F KVPRS++E GKG FWR++P    +L     + RRQ
Sbjct:  257 KPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRVDPSSEAKLVEQAFRKRRQ 351          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Sea Lamprey
Match: foxj1b (forkhead box J1b [Source:NCBI gene;Acc:494105])

HSP 1 Score: 159.458 bits (402), Expect = 4.444e-42
Identity = 68/102 (66.67%), Postives = 83/102 (81.37%), Query Frame = 2
Query:  548 DYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRR 853
            DY+TN + KPP+SYATLICM+M+   KSK+TL+ IY WITDNF YYR +D  W+NS+RHNLSLNKCF KVPR KDE GKGGFW INP+YAD + + L++ RR
Sbjct:  125 DYRTNGAAKPPYSYATLICMAMQASKKSKVTLATIYKWITDNFCYYRHADPCWRNSIRHNLSLNKCFSKVPRQKDEPGKGGFWSINPQYADVVANGLLRRRR 226          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Sea Lamprey
Match: foxj1b (forkhead box J1b [Source:NCBI gene;Acc:494105])

HSP 1 Score: 152.91 bits (385), Expect = 5.674e-40
Identity = 65/97 (67.01%), Postives = 80/97 (82.47%), Query Frame = 2
Query:  548 DYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNL 838
            DY+T+ S KPP+SYATLICM+MR  +KSK+TL+ IY WI DNF YYR +D +WQNS+RHNLSLNKCF KVPR KDE GKGGFW ++P+YAD  E+ +
Sbjct:   85 DYRTDASVKPPYSYATLICMAMRSTHKSKVTLASIYKWIMDNFCYYRHADPTWQNSIRHNLSLNKCFVKVPRQKDEPGKGGFWAMDPQYADLFENGM 181          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Sea Lamprey
Match: foxk1 (forkhead box K1 [Source:ZFIN;Acc:ZDB-GENE-030131-6402])

HSP 1 Score: 109.768 bits (273), Expect = 6.626e-27
Identity = 51/104 (49.04%), Postives = 67/104 (64.42%), Query Frame = 2
Query:  572 KPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRRQ--FPLYNMP 877
            KPP+SYA LI  ++      ++TLS IY  IT ++ YYR +D  WQNS+RHNLSLN+ F KVPRS++E GKG FWRI+P    +L     + RRQ   P +  P
Sbjct:  127 KPPYSYAQLIVQAITSALDKQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFVKVPRSQEEPGKGSFWRIDPPSEGKLAEQAFRKRRQRGVPCFRTP 230          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Sea Lamprey
Match: foxj3 (forkhead box J3 [Source:ZFIN;Acc:ZDB-GENE-101005-1])

HSP 1 Score: 110.538 bits (275), Expect = 3.567e-25
Identity = 49/94 (52.13%), Postives = 65/94 (69.15%), Query Frame = 2
Query:  569 GKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYR 850
            GKPP+SYA LI  ++    + ++TLS+IY WI DNF YY+ +   W+NS+RHNLSLNKCF KVPRS+D+ GKG +W I+   +D   S   K R
Sbjct:   67 GKPPYSYANLITFAINSSARKRMTLSEIYQWICDNFPYYKEAGIGWKNSIRHNLSLNKCFIKVPRSRDDPGKGSYWAIDQNPSDENSSTRPKKR 160          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Sea Lamprey
Match: foxk1 (forkhead box K1 [Source:ZFIN;Acc:ZDB-GENE-030131-6402])

HSP 1 Score: 110.538 bits (275), Expect = 3.880e-25
Identity = 49/104 (47.12%), Postives = 67/104 (64.42%), Query Frame = 2
Query:  572 KPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRRQ--FPLYNMP 877
            KPP+SYA LI  ++      ++TLS IY +I+ ++ YYR SD  WQNS+RHNLSLN+ F KVPRS+++ GKG FWRI+P    +L     + RR    P +  P
Sbjct:  199 KPPYSYAQLIVQAITSAASKQLTLSGIYAYISKHYPYYRASDKGWQNSIRHNLSLNRYFVKVPRSQEDPGKGSFWRIDPASEGKLAEQAYRKRRARGVPCFRAP 302          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Yeast
Match: FKH2 (Forkhead family transcription factor; rate-limiting activator of replication origins; evolutionarily conserved regulator of lifespan; binds multiple chromosomal elements with distinct specificities, cell cycle dynamics; positively regulates transcriptional elongation; facilitates clustering, activation of early-firing replication origins; negative role in chromatin silencing at HML and HMR; major role in expression of G2/M phase genes; relocalizes to cytosol under hypoxia [Source:SGD;Acc:S000005012])

HSP 1 Score: 102.834 bits (255), Expect = 1.481e-22
Identity = 48/92 (52.17%), Postives = 62/92 (67.39%), Query Frame = 2
Query:  539 VRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKY 814
            + HD   N   KPP SYAT+I  ++    +  I+L+DIY +I+ N+ YYR + S WQNS+RHNLSLNK FEKVPR  +E GKG  WRI+  Y
Sbjct:  331 LSHDENRNV--KPPHSYATMITQAILSSPEGVISLADIYKYISSNYAYYRFAKSGWQNSIRHNLSLNKAFEKVPRRPNEPGKGMKWRISESY 420          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Yeast
Match: HCM1 (Forkhead transcription factor; drives S-phase activation of genes involved in chromosome segregation, spindle dynamics, budding; also activates genes involved in respiration, use of alternative energy sources (like proline), NAD synthesis, oxidative stress resistance; key factor in early adaptation to nutrient deficiency and diauxic shift; suppressor of calmodulin mutants with specific SPB assembly defects; ortholog of C. elegans lifespan regulator PHA-4 [Source:SGD;Acc:S000000661])

HSP 1 Score: 100.138 bits (248), Expect = 5.040e-22
Identity = 47/95 (49.47%), Postives = 62/95 (65.26%), Query Frame = 2
Query:  524 LLDPLVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINP 808
            +L  L R       + KPP+SYATLIC+++ +  + K+TLS IY WI  +F YY+  D+SWQNS+RHNLSLN  F K  +S D  GKG FW + P
Sbjct:   93 ILQSLERRRINGELAKKPPYSYATLICLAILQSQEGKLTLSQIYHWIHVHFPYYKQKDASWQNSIRHNLSLNDAFIKTEKSCD--GKGHFWEVRP 185          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Yeast
Match: FKH1 (Forkhead family transcription factor; rate-limiting replication origin activator; evolutionarily conserved lifespan regulator; binds multiple chromosomal elements with distinct specificities, cell cycle dynamics; regulates transcription elongation, chromatin silencing at mating loci, expression of G2/M phase genes; facilitates clustering, activation of early-firing replication origins; binds HML recombination enhancer, regulates donor preference during mating-type switching [Source:SGD;Acc:S000001393])

HSP 1 Score: 95.5153 bits (236), Expect = 9.287e-21
Identity = 41/77 (53.25%), Postives = 57/77 (74.03%), Query Frame = 2
Query:  572 KPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRI 802
            KPP SYA++I  ++    +  I+L+DIY +I+DN+ +YR S  +WQNSVRHNLSLNK FEKVP+   ++GKG  W+I
Sbjct:  303 KPPQSYASMITQAILSTPEGSISLADIYKFISDNYAFYRFSQMAWQNSVRHNLSLNKAFEKVPKRAGQQGKGMNWKI 379          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Yeast
Match: FHL1 (Regulator of ribosomal protein (RP) transcription; has forkhead associated domain that binds phosphorylated proteins; recruits coactivator Ifh1p or corepressor Crf1p to RP gene promoters; also has forkhead DNA-binding domain though in vitro DNA binding assays give inconsistent results; computational analyses suggest it binds DNA directly at highly active RP genes and indirectly through Rap1p motifs at others; suppresses RNA pol III and splicing factor prp4 mutants [Source:SGD;Acc:S000006308])

HSP 1 Score: 69.707 bits (169), Expect = 2.565e-12
Identity = 36/89 (40.45%), Postives = 55/89 (61.80%), Query Frame = 2
Query:  563 WSGKPPFSYATLICMSMRELNKSK-ITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKY-ADR 823
            +  KP  SY+ ++   +R+ + +K ++LS+IY  I + F YY+     WQ+SVRHNLSLNK F KV +     GKG  W ++ +Y A+R
Sbjct:  458 YRTKPTVSYSAMLTTCIRKYSTAKGMSLSEIYAGIRELFPYYKYCPDGWQSSVRHNLSLNKSFRKVSK----EGKGWLWGLDEEYIAER 542          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Nematostella
Match: EDO44876 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUL7])

HSP 1 Score: 145.976 bits (367), Expect = 3.281e-41
Identity = 63/94 (67.02%), Postives = 76/94 (80.85%), Query Frame = 2
Query:  572 KPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRR 853
            KPP+SYATLICM+MR+  + KITLS IY WI +NF++YR++D +WQNS+RHNLSLNKCF KVPR KDE GKGGFWRI+P YAD     + K RR
Sbjct:    1 KPPYSYATLICMAMRDTKRVKITLSAIYKWIKENFMFYRVADPTWQNSIRHNLSLNKCFVKVPRKKDEPGKGGFWRIDPAYADMFVDGVFKRRR 94          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Nematostella
Match: EDO36951 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SH30])

HSP 1 Score: 110.153 bits (274), Expect = 1.482e-28
Identity = 51/96 (53.12%), Postives = 65/96 (67.71%), Query Frame = 2
Query:  569 GKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRRQ 856
            GKPP+SYA LI  ++      ++TLS IY  IT N+ YYR +D  WQNS+RHNLSLN+ F KVPR++DE GKG FWRI+P    +L     + RRQ
Sbjct:    3 GKPPYSYAQLIVQAILSATDKQLTLSGIYAHITKNYPYYRTADKGWQNSIRHNLSLNRYFVKVPRAQDEPGKGSFWRIDPSCEQKLAEQAFRKRRQ 98          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Nematostella
Match: EDO42654 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0W7])

HSP 1 Score: 108.227 bits (269), Expect = 7.060e-28
Identity = 46/86 (53.49%), Postives = 62/86 (72.09%), Query Frame = 2
Query:  572 KPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLE 829
            KPP+SY  LI M++++    KITLS IY +I +NF YYRL+   WQNS+RHNLSLNKCF K+PR + + GKG +W ++P Y +  E
Sbjct:    3 KPPYSYVALISMAIKQSKGQKITLSGIYQFIIENFPYYRLNKRGWQNSIRHNLSLNKCFVKIPRERSDPGKGCYWALDPAYEEMFE 88          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Nematostella
Match: EDO46828 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP00])

HSP 1 Score: 98.2117 bits (243), Expect = 2.434e-24
Identity = 45/85 (52.94%), Postives = 59/85 (69.41%), Query Frame = 2
Query:  572 KPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRL 826
            KP FSY  LI M++R   + ++TLS IY +I  NF YYR +   WQNS+RHNLSLNKCF KVPR+ D+ GKG +W ++P   D +
Sbjct:    2 KPAFSYNALIMMAIRGSEEKRLTLSGIYEYIMKNFPYYRNNKQGWQNSIRHNLSLNKCFVKVPRNYDDPGKGNYWMLDPSADDVI 86          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Nematostella
Match: EDO36306 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIZ2])

HSP 1 Score: 97.4413 bits (241), Expect = 2.335e-23
Identity = 52/105 (49.52%), Postives = 68/105 (64.76%), Query Frame = 2
Query:  503 SALKDGGLLDPLVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGF---WRINP 808
            S L    +LD      ++T  S KPP+SYA LI  ++    + K+TLS+IY WI D+F YY+ + + W+NS+RHNLSLNKCF KVPRSKD+ GK       RINP
Sbjct:   51 SPLDPSAVLDETEARQHQTKES-KPPYSYANLITFAINSSPEKKMTLSEIYQWICDHFPYYKEAGNGWKNSIRHNLSLNKCFIKVPRSKDDPGKVYIRYTLRINP 154          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Medaka
Match: foxj1 (forkhead box J1 [Source:NCBI gene;Acc:100301616])

HSP 1 Score: 160.229 bits (404), Expect = 2.018e-41
Identity = 99/219 (45.21%), Postives = 122/219 (55.71%), Query Frame = 2
Query:  248 SKEMDDSLTNLNWLHNVPSILGPESPLNSPVHLLNQA---NHQLLPNLERPAXXXXXXXXXXXXXXXSKQXXXXXXXXXXXXXTHHLDSALKDGGLLDPLVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRRQFPLYNMPKITNGL 895
            S  +DDSLT+L WL +  SILG     N P H   Q      QL   L+ PA+ +  +           +   ++     P           DG         DY+ N   KPPFSYATLICM+M+   KSKITLS IY WITDNF YYR +D +WQNS+RHNLSLNKCF KVPR KDE GKGGFW+I+P+YA+ L S   K RR  P+   P + + L
Sbjct:   39 SDNLDDSLTSLQWLQDF-SILG----ANVPQHAHQQPHFFGQQL--GLDAPASPLAGDPASMGMPLTPGKPTAASYSRIQPGVVAR--GLTPDGA--------DYRNNARVKPPFSYATLICMAMQASKKSKITLSCIYKWITDNFCYYRHADPTWQNSIRHNLSLNKCFIKVPRQKDEPGKGGFWKIDPQYAEHLLSGSHKKRRMPPVQINPALQSRL 240          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Medaka
Match: foxj1 (forkhead box J1 [Source:NCBI gene;Acc:100301616])

HSP 1 Score: 160.229 bits (404), Expect = 2.403e-41
Identity = 99/219 (45.21%), Postives = 122/219 (55.71%), Query Frame = 2
Query:  248 SKEMDDSLTNLNWLHNVPSILGPESPLNSPVHLLNQA---NHQLLPNLERPAXXXXXXXXXXXXXXXSKQXXXXXXXXXXXXXTHHLDSALKDGGLLDPLVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRRQFPLYNMPKITNGL 895
            S  +DDSLT+L WL +  SILG     N P H   Q      QL   L+ PA+ +  +           +   ++     P           DG         DY+ N   KPPFSYATLICM+M+   KSKITLS IY WITDNF YYR +D +WQNS+RHNLSLNKCF KVPR KDE GKGGFW+I+P+YA+ L S   K RR  P+   P + + L
Sbjct:   57 SDNLDDSLTSLQWLQDF-SILG----ANVPQHAHQQPHFFGQQL--GLDAPASPLAGDPASMGMPLTPGKPTAASYSRIQPGVVAR--GLTPDGA--------DYRNNARVKPPFSYATLICMAMQASKKSKITLSCIYKWITDNFCYYRHADPTWQNSIRHNLSLNKCFIKVPRQKDEPGKGGFWKIDPQYAEHLLSGSHKKRRMPPVQINPALQSRL 258          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Medaka
Match: foxj1b (forkhead box protein J1-B [Source:NCBI gene;Acc:101165351])

HSP 1 Score: 154.066 bits (388), Expect = 1.773e-39
Identity = 67/107 (62.62%), Postives = 82/107 (76.64%), Query Frame = 2
Query:  533 PLVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRR 853
            P    DYKTN   KPP+SYA+LICM+M+   + K+TLS IY WIT NF YYR ++ SWQNS+RHNLSLNKCF+KVPR KDE GKGGFW+I+P+YAD   + + K RR
Sbjct:  130 PSAEVDYKTNPKVKPPYSYASLICMAMQASKQPKVTLSTIYNWITQNFCYYRHAEPSWQNSIRHNLSLNKCFKKVPRQKDEPGKGGFWQIDPQYADMFVNGIFKRRR 236          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Medaka
Match: ENSORLT00000031716.1 (forkhead box protein J3 [Source:NCBI gene;Acc:101156973])

HSP 1 Score: 112.079 bits (279), Expect = 1.947e-27
Identity = 55/100 (55.00%), Postives = 71/100 (71.00%), Query Frame = 2
Query:  527 LDP---LVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRI--NPK 811
            LDP   L + +   +  GKPP+SYA+LI  ++    + ++TLS+IY WI DNF YYR + S W+NS+RHNLSLNKCF KVPRSKD+ GKG +W I  NPK
Sbjct:   58 LDPGTTLDQEEAAQHRDGKPPYSYASLITFAINGSPRKRMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDNNPK 157          
BLAST of forkhead box J1-like protein 4 vs. Ensembl Medaka
Match: foxj1 (forkhead box J1 [Source:NCBI gene;Acc:100301616])

HSP 1 Score: 114.005 bits (284), Expect = 4.132e-26
Identity = 86/244 (35.25%), Postives = 112/244 (45.90%), Query Frame = 2
Query:  173 VFNGKKLSVLAEKFQKNWLDKKGIDSKEMDDSLTNLNWLHNVPSILGPESPLNSPVHLLNQA---NHQLLPNLERPAXXXXXXXXXXXXXXXSKQXXXXXXXXXXXXXTHHLDSALKDGGLLDPLVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRRQFPLYNMPKITNGL 895
            V   + ++  A+    +W       S  +DDSLT+L WL +  SILG     N P H   Q      QL   L+ PA+ +  +           +   ++     P           DG         DY+ N   KPPFSYATLI                       NF YYR +D +WQNS+RHNLSLNKCF KVPR KDE GKGGFW+I+P+YA+ L S   K RR  P+   P + + L
Sbjct:   16 VLEEEVVTAAAQAEDSSW-----CGSDNLDDSLTSLQWLQDF-SILG----ANVPQHAHQQPHFFGQQL--GLDAPASPLAGDPASMGMPLTPGKPTAASYSRIQPGVVAR--GLTPDGA--------DYRNNARVKPPFSYATLIY----------------------NFCYYRHADPTWQNSIRHNLSLNKCFIKVPRQKDEPGKGGFWKIDPQYAEHLLSGSHKKRRMPPVQINPALQSRL 215          
BLAST of forkhead box J1-like protein 4 vs. Planmine SMEST
Match: SMESG000010030.1 (SMESG000010030.1)

HSP 1 Score: 998.808 bits (2581), Expect = 0.000e+0
Identity = 529/529 (100.00%), Postives = 529/529 (100.00%), Query Frame = 2
Query:   44 MLTQHDSTCLPKIHIKYSQPEQRLSKNYLTTSKLNSIQIYTTEVFNGKKLSVLAEKFQKNWLDKKGIDSKEMDDSLTNLNWLHNVPSILGPESPLNSPVHLLNQANHQLLPNLERPAXXXXXXXXXXXXXXXSKQXXXXXXXXXXXXXTHHLDSALKDGGLLDPLVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRRQFPLYNMPKITNGLPAASTLLSRTTNYSYMLCQSSVNTDNTWSNSMTTNNQNSFAFRDPQPILSENSLPFKSKRGWDNSGATYLPNLTNYNQGKLISSSAFSNFNNDVTSNEDYCQNRKHNSKTYHTQSYRNHNMTKLQSLDEFRTSETGQKVDTQMRTEITPNHSPTMYSLLNHLNSPPSHVSMXXXXXXXXXXXXXELTANTGSCATLHSHSDDPDEALRFGTSLGDDFMVGSDDYLNCDSIRSHDQLFDSVNSQFI 1630
            MLTQHDSTCLPKIHIKYSQPEQRLSKNYLTTSKLNSIQIYTTEVFNGKKLSVLAEKFQKNWLDKKGIDSKEMDDSLTNLNWLHNVPSILGPESPLNSPVHLLNQANHQLLPNLERPANNIIANNFVNNEINISKQSEFSNNFSSNPSFTHHLDSALKDGGLLDPLVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRRQFPLYNMPKITNGLPAASTLLSRTTNYSYMLCQSSVNTDNTWSNSMTTNNQNSFAFRDPQPILSENSLPFKSKRGWDNSGATYLPNLTNYNQGKLISSSAFSNFNNDVTSNEDYCQNRKHNSKTYHTQSYRNHNMTKLQSLDEFRTSETGQKVDTQMRTEITPNHSPTMYSLLNHLNSPPSHVSMDDIDSAASSSFDAELTANTGSCATLHSHSDDPDEALRFGTSLGDDFMVGSDDYLNCDSIRSHDQLFDSVNSQFI
Sbjct:    1 MLTQHDSTCLPKIHIKYSQPEQRLSKNYLTTSKLNSIQIYTTEVFNGKKLSVLAEKFQKNWLDKKGIDSKEMDDSLTNLNWLHNVPSILGPESPLNSPVHLLNQANHQLLPNLERPANNIIANNFVNNEINISKQSEFSNNFSSNPSFTHHLDSALKDGGLLDPLVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRRQFPLYNMPKITNGLPAASTLLSRTTNYSYMLCQSSVNTDNTWSNSMTTNNQNSFAFRDPQPILSENSLPFKSKRGWDNSGATYLPNLTNYNQGKLISSSAFSNFNNDVTSNEDYCQNRKHNSKTYHTQSYRNHNMTKLQSLDEFRTSETGQKVDTQMRTEITPNHSPTMYSLLNHLNSPPSHVSMDDIDSAASSSFDAELTANTGSCATLHSHSDDPDEALRFGTSLGDDFMVGSDDYLNCDSIRSHDQLFDSVNSQFI 529          
BLAST of forkhead box J1-like protein 4 vs. Planmine SMEST
Match: SMESG000067319.1 (SMESG000067319.1)

HSP 1 Score: 194.126 bits (492), Expect = 3.913e-53
Identity = 83/124 (66.94%), Postives = 101/124 (81.45%), Query Frame = 2
Query:  497 LDSALKDGGLLDPLVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRRQFPLY 868
            L +AL++ GL DP++R++YK +W  KPP SY TLICM+M +L K KI L++IY WI +NF+YYR SDSSWQNSVRHNLSL KCFEKVPR KDERGKGGFWRINP + + L +N IKYRRQF +Y
Sbjct:  114 LQAALRNEGLFDPIIRYEYKNSWKNKPPLSYTTLICMAMLDLGKPKIALNEIYEWIRENFLYYRKSDSSWQNSVRHNLSLKKCFEKVPRKKDERGKGGFWRINPNFTENLGNNFIKYRRQFHVY 237          
BLAST of forkhead box J1-like protein 4 vs. Planmine SMEST
Match: SMESG000067319.1 (SMESG000067319.1)

HSP 1 Score: 194.512 bits (493), Expect = 4.329e-53
Identity = 83/124 (66.94%), Postives = 101/124 (81.45%), Query Frame = 2
Query:  497 LDSALKDGGLLDPLVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRRQFPLY 868
            L +AL++ GL DP++R++YK +W  KPP SY TLICM+M +L K KI L++IY WI +NF+YYR SDSSWQNSVRHNLSL KCFEKVPR KDERGKGGFWRINP + + L +N IKYRRQF +Y
Sbjct:  125 LQAALRNEGLFDPIIRYEYKNSWKNKPPLSYTTLICMAMLDLGKPKIALNEIYEWIRENFLYYRKSDSSWQNSVRHNLSLKKCFEKVPRKKDERGKGGFWRINPNFTENLGNNFIKYRRQFHVY 248          
BLAST of forkhead box J1-like protein 4 vs. Planmine SMEST
Match: SMESG000072183.1 (SMESG000072183.1)

HSP 1 Score: 163.696 bits (413), Expect = 1.140e-42
Identity = 116/291 (39.86%), Postives = 164/291 (56.36%), Query Frame = 2
Query:  176 FNGKKLSVLAEKFQKNWLDKKGIDSKEMDDSLTNLNWLHNVPSILGPESPLNSPVHLLNQANHQLLPNLERPAXXXXXXXXXXXXXXXSKQXXXXXXXXXXXXXTHHLDSALKDGGLLDPLVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIKYRRQFPLYNMPKITNGLPAASTLLSRTTNYSYMLCQSSVNTDNTWSNSMTTNNQNSFAFRD-PQPILS 1045
            F+     +LA  F KNW ++ G +S   DDSLTNLNWLHNV           +P+ +  Q +H    ++  P + +++N++     +       ++    + +FT  + SA  D    D   + DYK N + KP F++A LI  +M+EL K KITLSDIYGWI+DNF YYR SDSSWQNSVRHNLS+NK F+KVPR KDE GKGGFWR+NP     L+ NL K +     YN P   + +P  +  L   ++Y  M       + N+ SN +     N+F  ++  +PI+S
Sbjct:   55 FSQMSCQILANTFHKNWSEQCGNESG-FDDSLTNLNWLHNV-----------NPMKINEQMSHV---HVGYPRDRLVSNSYQPRNYHTFNHQNQASTQQDSSAFTFPMISA--DQFSFD---KPDYKNNPNLKPTFTFAVLISWAMKELGKPKITLSDIYGWISDNFAYYRYSDSSWQNSVRHNLSMNKYFQKVPRRKDEPGKGGFWRMNPDNIKELDHNLSKIK-----YN-PSSHSIIPIKTEKLPIISSYRQMTSYPPTVSTNSNSNHI-----NTFTIQEHSRPIIS 314          
BLAST of forkhead box J1-like protein 4 vs. Planmine SMEST
Match: SMESG000072873.1 (SMESG000072873.1)

HSP 1 Score: 130.954 bits (328), Expect = 4.819e-31
Identity = 87/231 (37.66%), Postives = 120/231 (51.95%), Query Frame = 2
Query:  197 VLAEKFQKNWLDK------KGIDSKEMDDSLTNLNWLHNVPSILGPESPLNSPVHLLNQANHQLLPNLERPAXXXXXXXXXXXXXXXSKQXXXXXXXXXXXXXTHHLDSALKDGGLLDPLVRHD---------------YKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRL 826
            VLA KF++NWL+K           KE+DDSLTNLNWL N+                LN+   Q LP                           S   +S+ S   ++D  L+     DP VR D               YKT+ +G+PPFS+ +LICM+++++ +S+IT + I  WI  NF YY++ D+SWQNSVR+ LS++KCF+KVPR KDE  KGGFWR++  Y   L
Sbjct:    8 VLARKFRQNWLNKFSDIRYSSFIDKEIDDSLTNLNWLPNMN---------------LNKLTSQALP--------------------------ISPISASSMSCGKYVD--LRQPYASDPSVRSDIICSWDQIDDSTRIFYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDYQKYL 195          
The following BLAST results are available for this feature:
BLAST of forkhead box J1-like protein 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FOXJ13.619e-4245.02forkhead box J1 [Source:HGNC Symbol;Acc:HGNC:3816][more]
FOXJ31.683e-2956.19forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178... [more]
FOXJ32.396e-2856.19forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178... [more]
FOXJ32.908e-2856.19forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178... [more]
FOXJ32.908e-2856.19forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178... [more]
back to top
BLAST of forkhead box J1-like protein 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fkh-21.082e-2148.24ForKHead transcription factor family [Source:UniP... [more]
pha-41.584e-2144.14Defective pharyngeal development protein 4 [Sourc... [more]
pha-41.614e-2144.14Defective pharyngeal development protein 4 [Sourc... [more]
pha-43.370e-2144.14Defective pharyngeal development protein 4 [Sourc... [more]
unc-1303.972e-1943.75pep chromosome:WBcel235:II:11281986:11283953:1 gen... [more]
back to top
BLAST of forkhead box J1-like protein 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fd96Ca4.581e-2347.00gene:FBgn0004897 transcript:FBtr0339246[more]
fd96Ca4.581e-2347.00gene:FBgn0004897 transcript:FBtr0084770[more]
FoxK3.087e-2246.49gene:FBgn0036134 transcript:FBtr0332653[more]
FoxK3.175e-2246.49gene:FBgn0036134 transcript:FBtr0300783[more]
FoxK3.175e-2246.49gene:FBgn0036134 transcript:FBtr0300784[more]
back to top
BLAST of forkhead box J1-like protein 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxj1b2.902e-4445.69forkhead box J1b [Source:NCBI gene;Acc:494105][more]
foxj1b2.902e-4445.69forkhead box J1b [Source:NCBI gene;Acc:494105][more]
foxj1a1.137e-4057.14forkhead box J1a [Source:NCBI gene;Acc:767737][more]
foxj1a1.137e-4057.14forkhead box J1a [Source:NCBI gene;Acc:767737][more]
foxj32.247e-2856.19forkhead box J3 [Source:ZFIN;Acc:ZDB-GENE-101005-1... [more]
back to top
BLAST of forkhead box J1-like protein 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxj15.991e-4264.10forkhead box J1 [Source:NCBI gene;Acc:496834][more]
prss21.417e-3962.62serine protease 2 [Source:Xenbase;Acc:XB-GENE-6065... [more]
ndel13.024e-2754.29nudE neurodevelopment protein 1 like 1 [Source:Xen... [more]
ndel13.062e-2754.29nudE neurodevelopment protein 1 like 1 [Source:Xen... [more]
ndel13.217e-2754.29nudE neurodevelopment protein 1 like 1 [Source:Xen... [more]
back to top
BLAST of forkhead box J1-like protein 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Foxj17.422e-4345.02forkhead box J1 [Source:MGI Symbol;Acc:MGI:1347474... [more]
Foxj33.096e-2856.19forkhead box J3 [Source:MGI Symbol;Acc:MGI:2443432... [more]
Foxj33.670e-2856.19forkhead box J3 [Source:MGI Symbol;Acc:MGI:2443432... [more]
Foxj31.168e-2656.38forkhead box J3 [Source:MGI Symbol;Acc:MGI:2443432... [more]
Foxj31.168e-2656.38forkhead box J3 [Source:MGI Symbol;Acc:MGI:2443432... [more]
back to top
BLAST of forkhead box J1-like protein 4 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|F1R8Z9|FXJ1B_DANRE2.191e-4345.69Forkhead box protein J1-B OS=Danio rerio OX=7955 G... [more]
sp|Q61660|FOXJ1_MOUSE5.192e-4245.02Forkhead box protein J1 OS=Mus musculus OX=10090 G... [more]
sp|Q708W2|FXJ1A_XENLA7.811e-4264.10Forkhead box protein J1-A OS=Xenopus laevis OX=835... [more]
sp|Q708W1|FXJ1B_XENLA8.110e-4264.10Forkhead box protein J1-B OS=Xenopus laevis OX=835... [more]
sp|Q63247|FOXJ1_RAT9.865e-4245.50Forkhead box protein J1 OS=Rattus norvegicus OX=10... [more]
back to top
BLAST of forkhead box J1-like protein 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|203445090.000e+0100.00tr|K7XGV5|K7XGV5_SCHMD Forkhead box J1-like protei... [more]
gnl|BL_ORD_ID|160062581.210e-5251.56tr|A0A0R3WK74|A0A0R3WK74_HYDTA Fork-head domain-co... [more]
gnl|BL_ORD_ID|171826702.190e-5250.00tr|A0A4Z2DWG2|A0A4Z2DWG2_SCHJA Forkhead box protei... [more]
gnl|BL_ORD_ID|246577341.938e-5152.49tr|A0A5K3FUB3|A0A5K3FUB3_9CEST Uncharacterized pro... [more]
gnl|BL_ORD_ID|225446952.424e-5149.14tr|A0A5J4P2H4|A0A5J4P2H4_9TREM Fork-head domain-co... [more]
back to top
BLAST of forkhead box J1-like protein 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000049290.12.059e-4265.52forkhead box J1 [Source:NCBI gene;Acc:103028087][more]
foxj32.560e-2854.05forkhead box J3 [Source:NCBI gene;Acc:103033658][more]
foxj33.223e-2854.05forkhead box J3 [Source:NCBI gene;Acc:103033658][more]
foxj35.673e-2553.47forkhead box J3 [Source:NCBI gene;Acc:103033658][more]
foxk11.777e-2450.53forkhead box K1 [Source:NCBI gene;Acc:103029597][more]
back to top
BLAST of forkhead box J1-like protein 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxj1b4.444e-4266.67forkhead box J1b [Source:NCBI gene;Acc:494105][more]
foxj1b5.674e-4067.01forkhead box J1b [Source:NCBI gene;Acc:494105][more]
foxk16.626e-2749.04forkhead box K1 [Source:ZFIN;Acc:ZDB-GENE-030131-6... [more]
foxj33.567e-2552.13forkhead box J3 [Source:ZFIN;Acc:ZDB-GENE-101005-1... [more]
foxk13.880e-2547.12forkhead box K1 [Source:ZFIN;Acc:ZDB-GENE-030131-6... [more]
back to top
BLAST of forkhead box J1-like protein 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
FKH21.481e-2252.17Forkhead family transcription factor; rate-limitin... [more]
HCM15.040e-2249.47Forkhead transcription factor; drives S-phase acti... [more]
FKH19.287e-2153.25Forkhead family transcription factor; rate-limitin... [more]
FHL12.565e-1240.45Regulator of ribosomal protein (RP) transcription;... [more]
back to top
BLAST of forkhead box J1-like protein 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO448763.281e-4167.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO369511.482e-2853.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426547.060e-2853.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468282.434e-2452.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO363062.335e-2349.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of forkhead box J1-like protein 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxj12.018e-4145.21forkhead box J1 [Source:NCBI gene;Acc:100301616][more]
foxj12.403e-4145.21forkhead box J1 [Source:NCBI gene;Acc:100301616][more]
foxj1b1.773e-3962.62forkhead box protein J1-B [Source:NCBI gene;Acc:10... [more]
ENSORLT00000031716.11.947e-2755.00forkhead box protein J3 [Source:NCBI gene;Acc:1011... [more]
foxj14.132e-2635.25forkhead box J1 [Source:NCBI gene;Acc:100301616][more]
back to top
BLAST of forkhead box J1-like protein 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000010030.10.000e+0100.00SMESG000010030.1[more]
SMESG000067319.13.913e-5366.94SMESG000067319.1[more]
SMESG000067319.14.329e-5366.94SMESG000067319.1[more]
SMESG000072183.11.140e-4239.86SMESG000072183.1[more]
SMESG000072873.14.819e-3137.66SMESG000072873.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30002934
GenBankAFX62231.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002934 ID=SMED30002934|Name=forkhead box J1-like protein 4|organism=Schmidtea mediterranea sexual|type=transcript|length=4282bp
ACGTTTTATATAAAATTGAATGCATTTGTACAATCCCTCATAAATGCTCA
CCCAGCATGATAGTACATGTCTACCAAAAATTCATATAAAGTATTCACAA
CCTGAACAACGGCTTTCCAAGAATTATCTAACGACTTCAAAATTGAATTC
CATTCAGATTTATACGACAGAAGTTTTCAATGGAAAAAAACTTTCAGTCC
TTGCTGAAAAATTTCAGAAAAATTGGTTAGATAAAAAAGGAATCGACTCA
AAAGAAATGGACGATTCACTTACTAATCTCAATTGGTTACATAATGTACC
AAGTATTTTGGGACCAGAATCTCCTTTGAATTCACCAGTCCATTTGCTCA
ATCAGGCTAATCATCAATTATTGCCGAATCTCGAACGACCAGCTAATAAT
ATCATTGCTAATAATTTTGTAAATAATGAGATAAATATTTCCAAGCAATC
GGAGTTTTCCAATAACTTTTCCTCCAATCCTTCCTTCACTCATCATCTCG
ACAGTGCTCTGAAAGATGGTGGACTATTAGATCCTTTAGTACGGCATGAT
TACAAGACCAATTGGTCTGGCAAACCGCCTTTTTCTTATGCAACACTGAT
TTGTATGTCAATGAGAGAATTGAACAAATCAAAAATCACTCTGTCGGATA
TTTACGGATGGATCACAGATAATTTCATCTACTATCGATTGTCAGATTCG
AGTTGGCAGAATTCCGTCAGGCATAATTTATCTTTGAACAAATGTTTCGA
AAAAGTGCCAAGAAGCAAAGATGAACGCGGTAAAGGGGGATTTTGGAGAA
TTAATCCAAAATATGCTGACAGATTGGAATCAAACCTCATAAAATATCGA
CGGCAATTTCCTTTGTATAACATGCCTAAAATAACAAATGGTTTACCGGC
CGCCTCGACTTTGTTATCAAGAACAACAAATTATAGTTACATGCTCTGTC
AGTCATCCGTAAATACTGATAATACTTGGTCAAATTCAATGACAACTAAC
AATCAAAACTCCTTTGCATTTCGTGATCCTCAACCGATTTTGAGCGAGAA
TTCGTTGCCTTTTAAAAGTAAAAGAGGATGGGATAATTCTGGTGCAACTT
ATCTGCCGAATCTGACCAATTATAACCAAGGAAAATTGATCTCTTCTAGT
GCCTTTTCCAACTTCAATAACGATGTGACAAGCAACGAAGATTATTGTCA
AAATCGAAAACACAATTCTAAAACATATCACACTCAATCGTATCGAAATC
ACAACATGACAAAGTTGCAAAGTCTTGATGAGTTTCGAACATCAGAAACC
GGTCAAAAGGTCGACACGCAAATGAGAACGGAAATCACTCCGAATCATTC
TCCGACAATGTATTCATTGTTGAATCATTTGAACTCACCTCCGTCCCATG
TGTCTATGGACGATATAGATTCTGCAGCCTCATCATCATTTGATGCAGAA
TTAACTGCCAATACTGGATCCTGTGCCACCCTCCATTCTCATTCCGATGA
TCCCGATGAAGCTCTTCGGTTTGGCACAAGTCTTGGAGATGATTTCATGG
TGGGTTCCGATGATTACTTAAATTGCGATTCGATTCGTAGTCATGATCAG
TTATTCGATTCGGTTAATAGTCAATTTATTTAAACAAACATTTGTTTATC
CATATCATTTTCTACAAAACCGCCTAGATGAATCTATTGAAACATATCTC
ACTGAATTTAAATCTAAATTAATAATCGGCTGTGAACATTTTATCGTGAA
TATTTTTTTCTTATTATATTGTTTTAATTGATTGTAAATTTTATTCGAAT
TTTTCGTTTCAATCGAGTAAGAAAAAATATTGTTTTTCTTTCCAATTTCT
TGAATATTCCATAATGAATCAAAAAAAAAGATTTGTAGAGCTTTGAGTGC
CTTTTTATTTTTTTGTTTTGATGTGACACACTTGTGACATTTATTTTGAA
CCGGTTATTTCCTACTTGTTTTTCGTTTCTCTTTTTATTGTTTCTTTTTT
TCGTTGTTTTCTCTTAATTTCTTTTTCTCAAATAATATTTTTGGTTTGTT
GAAACATTCTCACACTGTAGTTTGTCGTGATATTTATGATTTTAAAAATT
TCTCAAGTCCATTTATCTATCATTAAACCGTCCTTTTGGGTTGAAAATTT
TTAAGTCCAGTAAAACAATTCTAAATCCGTCCGAAAGAACAACAAAGACT
CGAATTAAGTTTATTGTCCATTACAAATATCATTTTGTGGTCCAAGTTTT
TGTGAATTTTTTAATATTTGTTTTAATTAATGTTTTGTTTTGATTTCTAC
TTGCGGTGCTTGTCTATATTTCGAACAGTCATTTTAATAATTCGAAAGAT
TTTATTTTATTTTTTTAATTGTGGTTTCTAGCCCAAAAATTTTCTAGATT
TATTGTCTGAAGCCAATAGACAATAAAGTAAATGGTTAATAATTTTTAAT
TTTCAACATATTCTTTAAGTCAGTCAAAATGCTCAAAGCTCCTTAAATGC
AAACGATCCATCAATTTTACGAAACTATAAATTAACTCCGCAATATTAAA
ACTTAAGTGTTTGATCAACAGCTTATTACCATGGTGAATTCTGAGTTAAA
CAACAAATTGTAGTCTCATTTAGGATTTGATGACAAAGCCGTTCGAAGAT
AGGAGATGCGTATGCGTAATGAATGGAAGTGACCGTTTATCGGTGAAAAC
CTGAAAGAAAAAAAGATGATAAGCAAAAAGATAACAACAAACAAATTCCT
AATCAAGTCGATGTAGAATTTGCTCAAAACAATAGTAACAATAATTTCAA
AAAAGATACTCAAAGCAATAATAATAAACAACCTGCTGTATATAATAATA
GCAATGGCAACAGTAACGTAGATGTAGCCAGTGACGCTGATGGAGAGATG
ATGGAATAAGTCTATGAAAATCCAAATGCTCTTATGTCAAAAGCGCCACA
GGCTGCAAAACTACCTGAGGACTTTATATTTGATTATAAATGCCTTACTT
GTTTAAATCAAATGTATCCTGCAGCTCATCAAATTTTTTTAAATGGGTTT
AAAACTGCTTTAGAACAAGGCGACCTTGGAGGTCTATATGTGGCACCAGA
GGGATATGAAGCATTTACTCGTGAACAATTTACTCGTCGCAAAAAATTAG
GAAAATGTCCGACGTGCAATCAGGTTCTAGTGGGGTGGAAAGCAGCGCGC
CTGTTGAACATTTTCAGGGAACTTTCGATAGAATCGGTGAAAGGTATAGT
ATGTTACTTTAAAAAACTCCGGAATTATGTCTTAAGGCAGTTCTGACAAC
GATAAATGGTATAATTTCCCTTGGGAGTGGCCTTCTCCTCATGTCGGAAA
TCATCCATAATTTAAGCTTCTTGGTAATTTAAATCAACACTATTGGCCAG
TCTCTTGCAAACTCCGATTCTTTAATATTCAACTAACCTTGAGAGTTGTG
ATGATGAGAATCATAATTATAATAATTATAGTGTAATTGAAAATTATCAT
ATTGCTAATAAATCAGCAGACGACAGTTAGGTCATAATCGATTTAGGTAC
ATCCCGGACATGAACAAACCGTATTTTCGTGGCTACACTGATTACGATTT
CAGTGCAACCAGATTCCGTGTCCAGCAAGTTATCGATTTCTTCGGTTTTC
TTCTGAAGGATTCTCGTAATTTTCGGATTCAATTTTTTCTCGAATGTCGA
TTTATCGTTCCTTTGGATAATTTTTATTTTCAATTCTAACAAAGCACTAT
AGCTAGATTTGTGGTCTAATAAATATTCTTTTACGTTCGTTTTGTTTATT
ATACATTTAATTAATTTAAGAAAAATTACAAGAATTATTCTTCATGTAAA
ATATAAATAAGTCAAATAATCAGGGCATTAAATAAGTATCAAAAATATCT
TGAGTTTTTACTATTCGAATCCTTTGATATCAATGTGGAGACATTCTTTC
TGTAGCTATCCCAAAATAAAGTAAATTGTGTTCTGTCTGTTTATTCTAAA
GCAGTTTATTTGAGACCATCGTTTTTTGCAGTATTTGAGATCTAATGTAT
TCTCTTTTTTTTAAAAAAAGTTATTGTTAATTCTCTTTGATCCTGATCTT
TCATTTCTATTTTCTTAACTAATCTTTTCATTTTTATTCTTCCAATTGCA
ATTTTAGTTATATTAAATCCTTTCCCATGACCAGCCACGCACTTCATAGA
GGGTCTGTCGATAGGAATGGTAGGAAAGAGTTCTGAACGGCTTGAGTGAC
TGCCACACCGCGGCTTTTTCGCTTCTCACTGG
back to top

protein sequence of SMED30002934-orf-1

>SMED30002934-orf-1 ID=SMED30002934-orf-1|Name=SMED30002934-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=121bp
MSKAPQAAKLPEDFIFDYKCLTCLNQMYPAAHQIFLNGFKTALEQGDLGG
LYVAPEGYEAFTREQFTRRKKLGKCPTCNQVLVGWKAARLLNIFRELSIE
SVKGIVCYFKKLRNYVLRQF*
back to top

protein sequence of SMED30002934-orf-2

>SMED30002934-orf-2 ID=SMED30002934-orf-2|Name=SMED30002934-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=530bp
MLTQHDSTCLPKIHIKYSQPEQRLSKNYLTTSKLNSIQIYTTEVFNGKKL
SVLAEKFQKNWLDKKGIDSKEMDDSLTNLNWLHNVPSILGPESPLNSPVH
LLNQANHQLLPNLERPANNIIANNFVNNEINISKQSEFSNNFSSNPSFTH
HLDSALKDGGLLDPLVRHDYKTNWSGKPPFSYATLICMSMRELNKSKITL
SDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGF
WRINPKYADRLESNLIKYRRQFPLYNMPKITNGLPAASTLLSRTTNYSYM
LCQSSVNTDNTWSNSMTTNNQNSFAFRDPQPILSENSLPFKSKRGWDNSG
ATYLPNLTNYNQGKLISSSAFSNFNNDVTSNEDYCQNRKHNSKTYHTQSY
RNHNMTKLQSLDEFRTSETGQKVDTQMRTEITPNHSPTMYSLLNHLNSPP
SHVSMDDIDSAASSSFDAELTANTGSCATLHSHSDDPDEALRFGTSLGDD
FMVGSDDYLNCDSIRSHDQLFDSVNSQFI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR036390WH_DNA-bd_sf
IPR001766Fork_head_dom
IPR011991WHTH_DNA-bd_dom
IPR030456TF_fork_head_CS_2
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0043565sequence-specific DNA binding
GO:0003677DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006351transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001766Fork head domainPRINTSPR00053FORKHEADcoord: 177..190
score: 53.91
coord: 221..238
score: 75.62
coord: 198..215
score: 50.79
IPR001766Fork head domainSMARTSM00339forkneu4coord: 175..265
e-value: 1.7E-39
score: 147.2
IPR001766Fork head domainPFAMPF00250Forkheadcoord: 177..261
e-value: 4.4E-34
score: 116.6
IPR001766Fork head domainPROSITEPS50039FORK_HEAD_3coord: 177..271
score: 31.764
IPR001766Fork head domainCDDcd00059FHcoord: 177..254
e-value: 1.01725E-37
score: 131.522
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 166..272
e-value: 2.0E-37
score: 129.3
NoneNo IPR availablePANTHERPTHR45881:SF2coord: 69..415
NoneNo IPR availablePANTHERPTHR45881FAMILY NOT NAMEDcoord: 69..415
IPR030456Fork head domain conserved site 2PROSITEPS00658FORK_HEAD_2coord: 221..227
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 177..271