CCHC-type domain-containing protein

Overview
NameCCHC-type domain-containing protein
Smed IDSMED30002921
Length (bp)999
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CCHC-type domain-containing protein (SMED30002921) t-SNE clustered cells

Violin plots show distribution of expression levels for CCHC-type domain-containing protein (SMED30002921) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CCHC-type domain-containing protein (SMED30002921) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CCHC-type domain-containing protein (SMED30002921) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002921

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30002921SMESG000004031.1 Contig30333newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30002921SMESG000004031.1 Contig30333uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30002921SMESG000004031.1 Contig44856newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30002921SMESG000004031.1 Contig44856uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CCHC-type domain-containing protein vs. TrEMBL
Match: A0A498NW22 (Uncharacterized protein OS=Labeo rohita OX=84645 GN=ROHU_014184 PE=4 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.456e-9
Identity = 50/191 (26.18%), Postives = 82/191 (42.93%), Query Frame = 1
Query:  409 FKSLDKANELESGFLYEQLVQKLPQNILREW---NKENLIGISQKTVENLKRFIEDNARLDQETCEILEKHYTSDFTEQRSHQGXXXXXXXXXXXXLTQEKKRGSENQLDHFTEKNKFM*VCQKCFQNHFLNQCEEFKNMEVAKRKKLVNNKRLCYNCLNPGYEVRECQKQKFYKVKDCDKKHSFWLNEVI 972
             K++   +EL  G    Q+V+KLP++I + W   N E +       ++++   +E  A    +  + +  +  S  +         S      K   T   +  ++        K  F   C KC + HFLNQC+ F+ + V +R   V  K+LC NC   G+    C +    KV  C KKH+ WL+  I
Sbjct:  367 LKAMKCEDELNGGRTLLQIVEKLPEDIKKRWLTVNYEIVKSGRLPKLDDVVSLVESEA---AKRADPIFGNLLSSISRNSPASSKLSTKSSLDKKRQTFATESTAKESTTSSASKPAFRFKCPKCAEGHFLNQCQAFRALSVPERLIFVQRKQLCLNCFMRGHRSAVCTRSWVCKVPGCGKKHNSWLHSAI 554          
BLAST of CCHC-type domain-containing protein vs. TrEMBL
Match: A0A1S3IZI0 (uncharacterized protein LOC106168462 OS=Lingula unguis OX=7574 GN=LOC106168462 PE=4 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 7.899e-9
Identity = 30/67 (44.78%), Postives = 40/67 (59.70%), Query Frame = 1
Query:  763 CQKCFQNHFLNQCEEFKNMEVAKRKKLVNNKRLCYNCLNPGYEVRECQKQKFYKVKDCDKKHSFWLN 963
            C KC  NHF+ QC  FK++++  R  L+ +K LC NCL PG+  REC       V  C KKHS +L+
Sbjct:   88 CIKCKGNHFVTQCHSFKSLKIKDRHTLIQSKGLCLNCLKPGHYSRECPSTIRCTVDGCGKKHSKFLH 154          
BLAST of CCHC-type domain-containing protein vs. TrEMBL
Match: A0A1S3IN25 (uncharacterized protein LOC106165593 OS=Lingula unguis OX=7574 GN=LOC106165593 PE=4 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 7.899e-9
Identity = 30/67 (44.78%), Postives = 40/67 (59.70%), Query Frame = 1
Query:  763 CQKCFQNHFLNQCEEFKNMEVAKRKKLVNNKRLCYNCLNPGYEVRECQKQKFYKVKDCDKKHSFWLN 963
            C KC  NHF+ QC  FK++++  R  L+ +K LC NCL PG+  REC       V  C KKHS +L+
Sbjct:   88 CIKCKGNHFVTQCHSFKSLKIKDRHTLIQSKGLCLNCLKPGHYSRECPSTIRCTVDGCGKKHSKFLH 154          
BLAST of CCHC-type domain-containing protein vs. TrEMBL
Match: A0A3N0XW24 (Uncharacterized protein OS=Anabarilius grahami OX=495550 GN=DPX16_10929 PE=4 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 1.142e-8
Identity = 32/82 (39.02%), Postives = 43/82 (52.44%), Query Frame = 1
Query:  763 CQKCFQNHFLNQCEEFKNMEVAKRKKLVNNKRLCYNCLNPGYEVRECQKQKFYKVKDCDKKHSFWLNEVI---NENKINKTN 999
            C KC   HFLNQC+ F+ + V +R   V  K+LC NC   G+    C +    KV  C K+H+ WL+  I   N +K   TN
Sbjct:  237 CPKCADGHFLNQCQAFRALSVQERLAFVQQKQLCLNCFMKGHRSTACTRSWVCKVPGCGKRHNSWLHSAIVASNNDKSQSTN 318          
BLAST of CCHC-type domain-containing protein vs. TrEMBL
Match: J9KBH1 (Integrase catalytic domain-containing protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=2)

HSP 1 Score: 54.299 bits (129), Expect = 1.764e-8
Identity = 45/194 (23.20%), Postives = 85/194 (43.81%), Query Frame = 1
Query:  400 IVLFKSLDKANELESGFLYEQLVQKLPQNILREWNKENLIGISQKTVENLKRFIEDNARLDQETCEILEKHYTSDFTEQRSHQGXXXXXXXXXXXXLTQEKKRG-----SENQLDHFTEKNKFM*VCQKCFQNHFLNQCEEFKNMEVAKRKKLVNNKRLCYNCLNPGYEVRECQKQKFYKVKDCDKKHSFWLNE 966
            I   K+LD+  +    +L   +  +L ++ L  W       + Q+  + L R++ D      + C  +E  Y   F+ +R            S + +  ++ RG     +  +L   T KN     C  C   H+L  C+ FK ++V  R  +V + +LC+NCL+P ++   C+ +  Y    C  +H+  L++
Sbjct:  195 IAALKALDQPVDKWDAWLITIISMRLDKDTLHGWQ------LHQRNTQ-LPRYV-DLEEFLADRCVAMETSY--QFSSERE---------GTSTNSVPHQRSRGYKINNNSAKLTLLTNKNDRDNKCTHCSGKHWLFFCDSFKELDVNSRLTVVRDAKLCFNCLSPYHQKDYCKSK--YSCHTCKGRHNTLLHQ 367          

HSP 2 Score: 33.8834 bits (76), Expect = 1.764e-8
Identity = 17/44 (38.64%), Postives = 23/44 (52.27%), Query Frame = 3
Query:  168 SANDGEKLMHLRQYLVGEPLRIIEHLGYDAAVYNTALERLEMRY 299
            S     K  +LR YL G  L +I+ +    A Y  A+ERL+ RY
Sbjct:  113 SFTSAHKFYYLRSYLTGAALDLIKAVPMTDANYYVAIERLKQRY 156          
BLAST of CCHC-type domain-containing protein vs. Ensembl Nematostella
Match: EDO33575 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRU1])

HSP 1 Score: 47.3654 bits (111), Expect = 9.233e-7
Identity = 19/38 (50.00%), Postives = 29/38 (76.32%), Query Frame = 3
Query:  186 KLMHLRQYLVGEPLRIIEHLGYDAAVYNTALERLEMRY 299
            K+M L+  ++G+PL++IE LGY  A Y TALE+L+ +Y
Sbjct:  274 KMMMLKSAVLGKPLKVIERLGYSPAQYKTALEKLDQKY 311          

HSP 2 Score: 22.7126 bits (47), Expect = 9.233e-7
Identity = 13/32 (40.62%), Postives = 16/32 (50.00%), Query Frame = 1
Query:   70 LRKLKKIVIKPFSGQLKDYELRRNEFDVMLTQ 165
             R LKK  +  FSG    Y   R +FDV + Q
Sbjct:  235 FRGLKKPQLAIFSGDKDLYHDLRAQFDVFVHQ 266          
BLAST of CCHC-type domain-containing protein vs. Planmine SMEST
Match: SMESG000046963.1 (SMESG000046963.1)

HSP 1 Score: 130.183 bits (326), Expect = 2.764e-48
Identity = 64/73 (87.67%), Postives = 66/73 (90.41%), Query Frame = 3
Query:  153 YVDSASANDGEKLMHLRQYLVGEPLRIIEHLGYDAAVYNTALERLEMRYVEDDRRYH*MLAEIKEFYPVGDGK 371
            YVDSASANDGEKLMHLRQYLVGEPLRIIE+LGY+AAVY TALERLEMRY  DDRR H MLAEIKEFY V DGK
Sbjct:  186 YVDSASANDGEKLMHLRQYLVGEPLRIIENLGYEAAVYKTALERLEMRYGGDDRRCHGMLAEIKEFYIVRDGK 258          

HSP 2 Score: 75.0998 bits (183), Expect = 2.764e-48
Identity = 37/43 (86.05%), Postives = 40/43 (93.02%), Query Frame = 1
Query:  370 SEFGMLLEKIIVLFKSLDKANELESGFLYEQLVQKLPQNILRE 498
            +EF MLLEKIIV FKSL+KANELESGF+YEQLVQKLPQ ILRE
Sbjct:  263 NEFRMLLEKIIVRFKSLNKANELESGFIYEQLVQKLPQKILRE 305          

HSP 3 Score: 26.9498 bits (58), Expect = 2.764e-48
Identity = 11/18 (61.11%), Postives = 14/18 (77.78%), Query Frame = 1
Query:  106 SGQLKDYELRRNEFDVML 159
            +GQLK+YE  RNEFD  +
Sbjct:  170 NGQLKNYERWRNEFDAYV 187          
BLAST of CCHC-type domain-containing protein vs. Planmine SMEST
Match: SMESG000042730.1 (SMESG000042730.1)

HSP 1 Score: 127.102 bits (318), Expect = 6.943e-36
Identity = 63/72 (87.50%), Postives = 65/72 (90.28%), Query Frame = 3
Query:  156 VDSASANDGEKLMHLRQYLVGEPLRIIEHLGYDAAVYNTALERLEMRYVEDDRRYH*MLAEIKEFYPVGDGK 371
            VDSAS NDGEKLMHLRQYLVG+PL+IIEHLGYDAAVYNTALERLEM Y  DDRRY  MLAEIKEFYPV DGK
Sbjct:   36 VDSASVNDGEKLMHLRQYLVGDPLQIIEHLGYDAAVYNTALERLEMMYGGDDRRYRRMLAEIKEFYPVRDGK 107          

HSP 2 Score: 60.077 bits (144), Expect = 6.036e-11
Identity = 51/135 (37.78%), Postives = 74/135 (54.81%), Query Frame = 1
Query:   52 MESFKCLRKLKKIVIKPFSGQLKDYELRRNEFDVMLTQQA-----PMMEKS*CI*GNTW--*ENLCE*LSI*DMMLQFITRLWKD*R*GT*KMIGDTIEC*QK*RSSIQSEMESEFGMLLEKIIVLFKSLDKANE 435
            MESFK L KL KIVIK F GQLKDY+L RNEFD  +   +      +M     + G+     E+L    ++ +  L+ +  ++        +M+ +  E     R   + +++ EFGMLLEKIIV FKSL++ NE
Sbjct:    1 MESFKFLGKLNKIVIKSFEGQLKDYKLWRNEFDACVDSASVNDGEKLMHLRQYLVGDPLQIIEHLGYDAAVYNTALERLEMMYGGDDRRYRRMLAEIKEF-YPVRDGKEGDLK-EFGMLLEKIIVRFKSLNEVNE 133          
BLAST of CCHC-type domain-containing protein vs. Planmine SMEST
Match: SMESG000060899.1 (SMESG000060899.1)

HSP 1 Score: 91.6633 bits (226), Expect = 5.816e-35
Identity = 62/213 (29.11%), Postives = 114/213 (53.52%), Query Frame = 1
Query:  385 LLEKIIVLFKSLDKANELESGFLYEQLVQKLPQNILREW--NKENLIGISQKTVENLKRFIEDNARLDQETCEI------LEKHYTSDFTEQRSHQGXXXXXXXXX-------XXXLTQEKKRGS--ENQLDHFTEKNKFM*VCQKCFQNHFLNQCEEFKNMEVAKRKKLVNNKRLCYNCLNPGYEVRECQKQKFYKVKDCDKKHSFWLNEVI 972
            L+  ++V  + + + NEL SGF++E+L+QKL +++L EW  N +N    S K V+ L+ ++    +L ++  EI         +Y   F     ++G    +            + + + K RGS  +NQ     ++      C  C + H+LNQC  F+ M V +R + V   +LC+NCL+ G+ V+EC K+K  + ++C++KH++WL+ ++
Sbjct:  325 LIGTLVVRLEDMGRDNELGSGFIFEKLLQKLSRSVLDEWLTNYDNSKNGSDKAVKILQGWLGSKLQLTKQAMEIKGTMEFCRTNYEERFVYNNEYRGQPVMSHVTVNQNTKNKSNKIEKFKYRGSCIKNQGISNRQEELKNQKCPMCEEKHYLNQCLVFRKMNVEERTRKVRELKLCFNCLSKGHFVKECLKKKLCRFENCERKHNYWLHRIL 537          

HSP 2 Score: 68.9366 bits (167), Expect = 5.816e-35
Identity = 33/72 (45.83%), Postives = 49/72 (68.06%), Query Frame = 3
Query:  156 VDSASANDGEKLMHLRQYLVGEPLRIIEHLGYDAAVYNTALERLEMRYVEDDRRYH*MLAEIKEFYPVGDGK 371
            V+ A  +  EKL +LR+YLVGEPL++I+ LGY A  Y+ ALE LE  Y  ++R Y  +L E++ F P+ +G+
Sbjct:  244 VNKALGSKEEKLQNLREYLVGEPLKLIDTLGYSAGAYDAALEHLESNYGGEERLYRSLLQELERFRPIREGQ 315          

HSP 3 Score: 26.5646 bits (57), Expect = 5.816e-35
Identity = 12/35 (34.29%), Postives = 21/35 (60.00%), Query Frame = 1
Query:   49 SMESFKCLRKLKKIVIKPFSGQLKDYELRRNEFDV 153
            S E    L KLK++ I  F+GQ++++   +  F+V
Sbjct:  208 SEEYTPTLDKLKRLTIPVFNGQIREFPAWKAAFEV 242          
BLAST of CCHC-type domain-containing protein vs. Planmine SMEST
Match: SMESG000053778.1 (SMESG000053778.1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.648e-33
Identity = 69/220 (31.36%), Postives = 122/220 (55.45%), Query Frame = 1
Query:  373 EFGMLLEKIIVLFKSLD---KANELESGFLYEQLVQKLPQNILREW--NKENLIGISQKTVENLKRFIEDNARLDQETCEI------LEKHYTSDFTEQRSHQGXXXXX------XXXXXXXLTQEKKRGS--ENQ-LDHFTEKNKFM*VCQKCFQNHFLNQCEEFKNMEVAKRKKLVNNKRLCYNCLNPGYEVRECQKQKFYKVKDCDKKHSFWLNEVI 972
            +F  LL  I  LF +L+   + NEL +GF++E+L+QKL +++L EW  N +N    S K V+ L+ ++    +  ++T EI       + +Y       + ++G    +        +  + + + K RGS  +NQ L H  E+ K    C  C + H+LNQC  F+ M V +R + V   +LC+NCL  G+ ++EC K+K Y+ ++C+ KH++WL++++
Sbjct:  124 DFENLLSLIGTLFVNLEDMGRDNELGTGFIFEKLLQKLSRSVLDEWLTNYDNSKNGSDKAVKILQGWLGSKLQRTKQTMEIKGTMEFRKANYEERSVNNKEYRGQPVMSHVNQNTKSNKSNKIEKFKYRGSCIKNQDLSHRQEELKNQ-KCPMCEEKHYLNQCLVFRKMNVEERTRKVMELKLCFNCLAKGHFMKECLKEKLYRFENCEGKHNYWLHQIL 342          

HSP 2 Score: 64.6994 bits (156), Expect = 1.648e-33
Identity = 33/72 (45.83%), Postives = 47/72 (65.28%), Query Frame = 3
Query:  156 VDSASANDGEKLMHLRQYLVGEPLRIIEHLGYDAAVYNTALERLEMRYVEDDRRYH*MLAEIKEFYPVGDGK 371
            V+ A  +  EKL HLR+YLVGE L++I+ LGY A  Y  ALERLE  Y E ++ Y  +L E++ F P+ + +
Sbjct:   51 VNKALGSKEEKLQHLREYLVGESLKLIDTLGYSAGAYGAALERLESNYGE-EKLYRNLLQELERFRPIRESQ 121          

HSP 3 Score: 25.409 bits (54), Expect = 1.648e-33
Identity = 14/46 (30.43%), Postives = 27/46 (58.70%), Query Frame = 1
Query:   25 KNVEMENHSMES---FKCLRKLKKIVIKPFSGQLKDYELRRNEFDV 153
            K + +E+  M+S      L KLK++ I  F+GQ++++   +  F+V
Sbjct:    4 KRLGIESSKMKSEEYTPILDKLKRLKIPVFNGQIREFPAWKAAFEV 49          
BLAST of CCHC-type domain-containing protein vs. Planmine SMEST
Match: SMESG000053778.1 (SMESG000053778.1)

HSP 1 Score: 91.6633 bits (226), Expect = 2.123e-33
Identity = 69/220 (31.36%), Postives = 122/220 (55.45%), Query Frame = 1
Query:  373 EFGMLLEKIIVLFKSLD---KANELESGFLYEQLVQKLPQNILREW--NKENLIGISQKTVENLKRFIEDNARLDQETCEI------LEKHYTSDFTEQRSHQGXXXXX------XXXXXXXLTQEKKRGS--ENQ-LDHFTEKNKFM*VCQKCFQNHFLNQCEEFKNMEVAKRKKLVNNKRLCYNCLNPGYEVRECQKQKFYKVKDCDKKHSFWLNEVI 972
            +F  LL  I  LF +L+   + NEL +GF++E+L+QKL +++L EW  N +N    S K V+ L+ ++    +  ++T EI       + +Y       + ++G    +        +  + + + K RGS  +NQ L H  E+ K    C  C + H+LNQC  F+ M V +R + V   +LC+NCL  G+ ++EC K+K Y+ ++C+ KH++WL++++
Sbjct:  112 DFENLLSLIGTLFVNLEDMGRDNELGTGFIFEKLLQKLSRSVLDEWLTNYDNSKNGSDKAVKILQGWLGSKLQRTKQTMEIKGTMEFRKANYEERSVNNKEYRGQPVMSHVNQNTKSNKSNKIEKFKYRGSCIKNQDLSHRQEELKNQ-KCPMCEEKHYLNQCLVFRKMNVEERTRKVMELKLCFNCLAKGHFMKECLKEKLYRFENCEGKHNYWLHQIL 330          

HSP 2 Score: 64.6994 bits (156), Expect = 2.123e-33
Identity = 33/72 (45.83%), Postives = 47/72 (65.28%), Query Frame = 3
Query:  156 VDSASANDGEKLMHLRQYLVGEPLRIIEHLGYDAAVYNTALERLEMRYVEDDRRYH*MLAEIKEFYPVGDGK 371
            V+ A  +  EKL HLR+YLVGE L++I+ LGY A  Y  ALERLE  Y E ++ Y  +L E++ F P+ + +
Sbjct:   39 VNKALGSKEEKLQHLREYLVGESLKLIDTLGYSAGAYGAALERLESNYGE-EKLYRNLLQELERFRPIRESQ 109          

HSP 3 Score: 25.0238 bits (53), Expect = 2.123e-33
Identity = 12/35 (34.29%), Postives = 21/35 (60.00%), Query Frame = 1
Query:   49 SMESFKCLRKLKKIVIKPFSGQLKDYELRRNEFDV 153
            S E    L KLK++ I  F+GQ++++   +  F+V
Sbjct:    3 SEEYTPILDKLKRLKIPVFNGQIREFPAWKAAFEV 37          
The following BLAST results are available for this feature:
BLAST of CCHC-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CCHC-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CCHC-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A498NW221.456e-926.18Uncharacterized protein OS=Labeo rohita OX=84645 G... [more]
A0A1S3IZI07.899e-944.78uncharacterized protein LOC106168462 OS=Lingula un... [more]
A0A1S3IN257.899e-944.78uncharacterized protein LOC106165593 OS=Lingula un... [more]
A0A3N0XW241.142e-839.02Uncharacterized protein OS=Anabarilius grahami OX=... [more]
J9KBH11.764e-823.20Integrase catalytic domain-containing protein OS=A... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO335759.233e-750.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CCHC-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046963.12.764e-4887.67SMESG000046963.1[more]
SMESG000042730.16.943e-3687.50SMESG000042730.1[more]
SMESG000060899.15.816e-3529.11SMESG000060899.1[more]
SMESG000053778.11.648e-3331.36SMESG000053778.1[more]
SMESG000053778.12.123e-3331.36SMESG000053778.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002921 ID=SMED30002921|Name=CCHC-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=999bp
GTAGTAACAAAGATTATAAATCGCAAAAACGTTGAAATGGAAAATCATAG
CATGGAATCCTTTAAATGTCTACGCAAACTAAAAAAAATTGTAATAAAGC
CATTTTCAGGTCAATTGAAGGATTATGAACTGCGGAGAAATGAATTTGAC
GTTATGTTGACTCAGCAAGCGCCAATGATGGAGAAAAGTTAATGCATTTA
AGGCAATACCTGGTAGGAGAACCTCTGCGAATAATTGAGCATTTAGGATA
TGATGCTGCAGTTTATAACACGGCTCTGGAAAGACTAGAGATGAGGTACG
TAGAAGATGATAGGAGATACCATTGAATGCTAGCAGAAATAAAGGAGTTC
TATCCAGTCGGAGATGGAAAGCGAATTTGGAATGCTGCTAGAAAAGATTA
TTGTTCTATTTAAGTCGTTGGATAAAGCCAATGAATTGGAGAGTGGTTTT
CTTTATGAACAATTAGTTCAAAAGCTTCCACAGAATATCCTACGAGAATG
GAATAAAGAAAATTTAATAGGGATATCACAGAAAACCGTCGAAAATTTAA
AAAGATTTATTGAAGACAATGCGAGACTAGATCAGGAAACTTGTGAGATT
TTAGAAAAACATTATACATCGGATTTTACTGAACAAAGAAGTCACCAAGG
GTTCAGTAGCAATAACTTCAAAGATTCAAAGTCATTTTTGACTCAGGAGA
AGAAAAGGGGTTCCGAGAATCAGCTGGACCATTTCACAGAAAAAAATAAA
TTCATGTGAGTTTGTCAAAAATGTTTCCAAAACCATTTCTTAAATCAATG
CGAAGAATTTAAGAACATGGAAGTAGCTAAAAGAAAGAAGCTAGTAAATA
ATAAAAGATTGTGTTATAATTGCTTAAATCCTGGATATGAAGTAAGGGAA
TGTCAGAAGCAGAAATTCTATAAGGTGAAAGATTGTGATAAAAAGCACAG
CTTTTGGTTAAATGAGGTTATTAATGAGAACAAAATTAATAAAACAAAT
back to top

protein sequence of SMED30002921-orf-1

>SMED30002921-orf-1 ID=SMED30002921-orf-1|Name=SMED30002921-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=132bp
MESEFGMLLEKIIVLFKSLDKANELESGFLYEQLVQKLPQNILREWNKEN
LIGISQKTVENLKRFIEDNARLDQETCEILEKHYTSDFTEQRSHQGFSSN
NFKDSKSFLTQEKKRGSENQLDHFTEKNKFM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004190aspartic-type endopeptidase activity
GO:0008270zinc ion binding
GO:0003676nucleic acid binding
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0015074DNA integration
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 10..32