Lipase

Overview
NameLipase
Smed IDSMED30002911
Length (bp)1471
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Lipase (SMED30002911) t-SNE clustered cells

Violin plots show distribution of expression levels for Lipase (SMED30002911) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002911

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tail regionSMED30002911SMESG000074187.1 SmedASXL_006360SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
gutSMED30002911SMESG000074187.1 dd_Smed_v4_122_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002911SMESG000074187.1 SMED_24410_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30002911SMESG000074187.1 SMED_24410_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30002911SMESG000074187.1 SMED_01065_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30002911SMESG000074187.1 SMED_01065_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Lipase vs. Ensembl Human
Match: LIPA (lipase A, lysosomal acid type [Source:HGNC Symbol;Acc:HGNC:6617])

HSP 1 Score: 328.946 bits (842), Expect = 2.599e-108
Identity = 175/397 (44.08%), Postives = 243/397 (61.21%), Query Frame = 2
Query:  269 VPCLLIVSIN----GGLLSPGIETDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTS-SPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYG-FVINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFLLKYN 1441
            V CL++ +++    GG L+     DPE  M+V+E+I Y+G+P E + V TEDGYIL + RIP+GR + S    KPVVFLQHGLL  S  WV N    SL FILAD GFDVW+GNSRGNT+SRKH   S     FW F++DEMA++DLPASIN+ L  +  +++ Y+GHSQGT IGF  FSQ  +L  ++  F AL PV  +    + +  +  L D  ++I       EFLP    +  +   VC   +    CGN+ FLL G+N  NLN +R+ +Y TH PAGTS +N+ H++Q+    KFQ FD+G    N   YNQ  PP Y +    +P A++ GG+DW+A   DVN  + ++  N+   + IPE+ H+DFIWG +A  R+Y  +I+ + KY 
Sbjct:    9 VVCLVLWTLHSEGSGGKLTA---VDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPD--HLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQI-TNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ 399          
BLAST of Lipase vs. Ensembl Human
Match: LIPF (lipase F, gastric type [Source:HGNC Symbol;Acc:HGNC:6622])

HSP 1 Score: 308.531 bits (789), Expect = 2.331e-100
Identity = 162/383 (42.30%), Postives = 244/383 (63.71%), Query Frame = 2
Query:  302 GLLSPGIETDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTSSPGI-KKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTT---GE--FLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGF-VINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFL 1429
            G L PG    PEVTM+++++I Y+GYP E ++V TEDGYIL + RIPYG+ +S    ++PVVFLQHGLL S+  W++N P  SLAFILAD G+DVWLGNSRGNT++R++  +SP S  FW F++DEMA++DLPA+I++ +  +   +L Y+GHSQGT IGF  FS    L  ++  F ALAPV         +KY   L +    + +++     G+  F P+      ++  VC  +M +L C N  F++ G++ +N N +R+ +Y++H PAGTS +N+ H+ Q+  S KFQ +D+G  V N++ Y+Q  PP Y +    +P+A++ GG D +A  +DV   + +L  N+   K IP YNH+DFIW  +A   +Y D++  +
Sbjct:   22 GKLHPG---SPEVTMNISQMITYWGYPNEEYEVVTEDGYILEVNRIPYGKKNSGNTGQRPVVFLQHGLLASATNWISNLPNNSLAFILADAGYDVWLGNSRGNTWARRNLYYSPDSVEFWAFSFDEMAKYDLPATIDFIVKKTGQKQLHYVGHSQGTTIGFIAFSTNPSLAKRIKTFYALAPVA-------TVKYTKSLINKLRFVPQSLFKFIFGDKIFYPHNFFDQFLATEVCSREMLNLLCSNALFIICGFDSKNFNTSRLDVYLSHNPAGTSVQNMFHWTQAVKSGKFQAYDWGSPVQNRMHYDQSQPPYYNVTAMNVPIAVWNGGKDLLADPQDVGLLLPKL-PNLIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMI 393          
BLAST of Lipase vs. Ensembl Human
Match: LIPF (lipase F, gastric type [Source:HGNC Symbol;Acc:HGNC:6622])

HSP 1 Score: 308.916 bits (790), Expect = 2.352e-100
Identity = 162/383 (42.30%), Postives = 244/383 (63.71%), Query Frame = 2
Query:  302 GLLSPGIETDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTSSPGI-KKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTT---GE--FLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGF-VINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFL 1429
            G L PG    PEVTM+++++I Y+GYP E ++V TEDGYIL + RIPYG+ +S    ++PVVFLQHGLL S+  W++N P  SLAFILAD G+DVWLGNSRGNT++R++  +SP S  FW F++DEMA++DLPA+I++ +  +   +L Y+GHSQGT IGF  FS    L  ++  F ALAPV         +KY   L +    + +++     G+  F P+      ++  VC  +M +L C N  F++ G++ +N N +R+ +Y++H PAGTS +N+ H+ Q+  S KFQ +D+G  V N++ Y+Q  PP Y +    +P+A++ GG D +A  +DV   + +L  N+   K IP YNH+DFIW  +A   +Y D++  +
Sbjct:   32 GKLHPG---SPEVTMNISQMITYWGYPNEEYEVVTEDGYILEVNRIPYGKKNSGNTGQRPVVFLQHGLLASATNWISNLPNNSLAFILADAGYDVWLGNSRGNTWARRNLYYSPDSVEFWAFSFDEMAKYDLPATIDFIVKKTGQKQLHYVGHSQGTTIGFIAFSTNPSLAKRIKTFYALAPVA-------TVKYTKSLINKLRFVPQSLFKFIFGDKIFYPHNFFDQFLATEVCSREMLNLLCSNALFIICGFDSKNFNTSRLDVYLSHNPAGTSVQNMFHWTQAVKSGKFQAYDWGSPVQNRMHYDQSQPPYYNVTAMNVPIAVWNGGKDLLADPQDVGLLLPKL-PNLIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMI 403          
BLAST of Lipase vs. Ensembl Human
Match: LIPK (lipase family member K [Source:HGNC Symbol;Acc:HGNC:23444])

HSP 1 Score: 304.679 bits (779), Expect = 7.270e-99
Identity = 161/390 (41.28%), Postives = 238/390 (61.03%), Query Frame = 2
Query:  278 LLIVSINGGLLSPGIETDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTSSPG--IKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFV-INKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFLLKY 1438
            +L++    G    G   +PE  M+++++I Y+GYP E + VTT+DGYIL + RIP+GR   PG    KP V+LQHGL+ S+  W+ N P  SLAF+LAD G+DVWLGNSRGNT+SRKH K SP S  +W F+ DEMA++DLPA+IN+ +  +   +L Y+GHSQGT I F  FS   +L  K+  F ALAPVV +   ++ +K +  L     V+        F P+      ++  VC  ++    C N  F L G++ +NLN +R+ +Y++H PAGTS +N+ H+AQ+  S + Q FD+G    N + ++Q+TPP Y +    +P A++ GG D +A  +DV   + ++  N+   K IP YNH+DF  G +A   IY D+I  + +Y
Sbjct:   11 MLLLGSMYGYDKKGNNANPEANMNISQIISYWGYPYEEYDVTTKDGYILGIYRIPHGR-GCPGRTAPKPAVYLQHGLIASASNWICNLPNNSLAFLLADSGYDVWLGNSRGNTWSRKHLKLSPKSPEYWAFSLDEMAKYDLPATINFIIEKTGQKRLYYVGHSQGTTIAFIAFSTNPELAKKIKIFFALAPVVTVKYTQSPMKKLTTLSR--RVVKVLFGDKMFHPHTLFDQFIATKVCNRKLFRRICSNFLFTLSGFDPQNLNMSRLDVYLSHNPAGTSVQNMLHWAQAVNSGQLQAFDWGNSDQNMMHFHQLTPPLYNITKMEVPTAIWNGGQDIVADPKDVENLLPQIA-NLIYYKLIPHYNHVDFYLGEDAPQEIYQDLIILMEEY 396          
BLAST of Lipase vs. Ensembl Human
Match: LIPM (lipase family member M [Source:HGNC Symbol;Acc:HGNC:23455])

HSP 1 Score: 301.982 bits (772), Expect = 1.611e-97
Identity = 154/379 (40.63%), Postives = 224/379 (59.10%), Query Frame = 2
Query:  314 PGIETDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTSSPGI-KKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTG-----EFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKL-KYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFL 1429
            P    DPE  M+++E+I++ GYP E ++V TEDGYIL++ RIP G         +PVV LQHGL+  +  W++N P  SL FILAD GFDVW+GNSRGN +SRKH   S     FW F++DEMA+FDLPA IN+ L  +  +K+ Y+G+SQGT +GF  FS   +L  K+  + ALAP+         +K+    G  F ++   +  G     EFL   + +  +  ++CG  +    C N+  LL G+N  N+N +R  +Y  H  AGTS +NI H++Q+  S + + FD+G     L K NQ TP +Y +    +P AM+ GG DW++  EDV   + E+  N+   K IPE+ H+DFIWG +A  R+Y ++I  +
Sbjct:   37 PTKAVDPEAFMNISEIIQHQGYPCEEYEVATEDGYILSVNRIPRGLVQPKKTGSRPVVLLQHGLVGGASNWISNLPNNSLGFILADAGFDVWMGNSRGNAWSRKHKTLSIDQDEFWAFSYDEMARFDLPAVINFILQKTGQEKIYYVGYSQGTTMGFIAFSTMPELAQKIKMYFALAPI-------ATVKHAKSPGTKFLLLPDMMIKGLFGKKEFLYQTRFLRQLVIYLCGQVILDQICSNIMLLLGGFNTNNMNMSRASVYAAHTLAGTSVQNILHWSQAVNSGELRAFDWGSETKNLEKCNQPTPVRYRVRDMTVPTAMWTGGQDWLSNPEDVKMLLSEV-TNLIYHKNIPEWAHVDFIWGLDAPHRMYNEIIHLM 407          
BLAST of Lipase vs. Ensembl Celegans
Match: lipl-1 (Lipase [Source:UniProtKB/TrEMBL;Acc:Q93789])

HSP 1 Score: 306.605 bits (784), Expect = 5.401e-100
Identity = 172/382 (45.03%), Postives = 226/382 (59.16%), Query Frame = 2
Query:  317 GIETDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRT--SSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFS-DLNSKVSAFVALAPVVYLGNLKTAIKYIAG-LGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVC-GDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAI------GELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFL 1429
            G + DPE+ M   ++I  +GYP   + VTTEDGYIL + RIPYG+T  + P  KKPVVF+QHGL  SS  WV N P +S AF+ AD G+DVWLGN RGNTYS KH    P    FWD++WDEM Q+DLPA I  AL V+  D L YIGHSQGT   F++ S+      +K+  F ALAPV  + ++K A+K+ A      F+       +GEFLPN  ++  +S+ VC G ++ +  C +V FL+ G     LN TR+PIYV H PAGTS++NI H+ Q        K+DYG   NK  Y Q   P Y   T   PV +++G +DW+A   DV   +        + QN KLI    +YNH+DFIWG  A   IY  +ID +
Sbjct:   20 GHDADPEMKMTTPQIIMRWGYPAMIYDVTTEDGYILELHRIPYGKTNVTWPNGKKPVVFMQHGLECSSSNWVVNLPTESAAFLFADAGYDVWLGNFRGNTYSMKHKNLKPSHSAFWDWSWDEMQQYDLPAMIEKALEVTGQDSLYYIGHSQGTLTMFSRLSEDKVGWGNKIKKFFALAPVGSVKHIKGALKFFADYFSLEFDGWFDVFGSGEFLPNNWIMKLVSESVCAGLKVEAGVCDDVMFLIAGPESNQLNATRVPIYVAHTPAGTSTQNIVHWIQMVRHGGTPKYDYGEKGNKKHYGQANVPAYDFTTVNRPVYLYWGDSDWLADPTDVTDFLLTHLNPSTVVQNNKLI----DYNHLDFIWGLRAPKDIYEPIIDIV 397          
BLAST of Lipase vs. Ensembl Celegans
Match: lipl-6 (LIPase Like [Source:UniProtKB/TrEMBL;Acc:E2S7J2])

HSP 1 Score: 307.76 bits (787), Expect = 4.227e-98
Identity = 151/375 (40.27%), Postives = 225/375 (60.00%), Query Frame = 2
Query:  317 GIETDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRT----SSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGEL--GQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVID 1423
             I  DPE  MDV E+I ++GYP+ETH+V T DGYILT+ RIP+G+     S+    KPVVFLQHGLL +S  W+ N P +S  +I AD+G+DVWLGN RGNTYS++HT+ +   + FW F+W+EMA++DLPA INYAL  +K   L Y+GHSQG    FAK S+  +++ K+  F A+APV  + ++K   + +  + + +N++ +    GEFL N      ++   C   + +  C N  F + G N    N +R+ IY+ H PAGTSS+NI H+AQ     +  +FD+G  +N   Y   +PP+Y +      + +FY   DW+A  +DV   +  +   + +K    + ++NH DF+WG  A   IY  +I+
Sbjct:  171 NITIDPEALMDVPEIITHWGYPVETHKVVTVDGYILTLHRIPHGKNETSKSASKTPKPVVFLQHGLLCTSSIWLLNLPRQSAGYIFADQGYDVWLGNMRGNTYSKEHTRMTSADRRFWKFSWEEMARYDLPAMINYALKTTKRQNLYYVGHSQGALTMFAKMSEDPEMSKKIRKFFAMAPVARMSHVKGLFQNLGQIYEQYNLVYQVFGDGEFLTNNIFTKLLTDIFCDQAVNNPLCENFIFAVSGPNSNQFNNSRIGIYLAHNPAGTSSRNILHFAQMVKKKRMSRFDHGKDLNLKIYGAPSPPEYDIRKINSSIYLFYSDFDWLANPKDVEGFLIPMLPSKTLKKATKLRDFNHNDFLWGMRARKEIYDKIIN 545          
BLAST of Lipase vs. Ensembl Celegans
Match: lipl-2 (Lipase [Source:UniProtKB/TrEMBL;Acc:Q20449])

HSP 1 Score: 293.893 bits (751), Expect = 6.387e-95
Identity = 160/402 (39.80%), Postives = 231/402 (57.46%), Query Frame = 2
Query:  266 RVPCLLIVSINGGLLSPGI----ETDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTSS--PGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSD--LNSKVSAFVALAPVVYLGNLKTAIKYIA-GLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCG-DQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKLKYNQITPPKYPLDT-HGLPVAMFYGGNDWMAVKEDVNRAI------GELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVI 1420
            ++ CL+  S    LL   I    + DPE+ M+ +++I+ +GY  E H VTTEDGYIL MQRIPYG+TS   P  K+PV+ LQHGLL  +  WV+N P +S AF+ AD GFDVWLGN RG TY RK+TK  P    FW F+WDEMAQ+D+PA +++ L ++  + L Y+GHSQGT I F   ++ +D     K+  + ALAP+  + N+K  + Y A      F+       + +FLP+  +    +K +CG  +  +  C N  FL+ G   +  N +R  IY +  PAGTS++NI H+ Q   + +   FD+G  INK KY Q TPP+Y      G  + +++  +DW+    D++  +        + +NV L     EYNH+DF WG NA  +IY   I
Sbjct:    6 QITCLICTSF---LLLQTINAHPDDDPELNMNTSQIIERWGYKAEVHTVTTEDGYILQMQRIPYGKTSVTWPNGKRPVILLQHGLLACASDWVDNLPTQSAAFVFADAGFDVWLGNVRGTTYGRKNTKLDPSETAFWQFSWDEMAQYDVPAMVDHVLAMTGQENLYYMGHSQGTLIMFTHLAKDTDGSFAKKIKRYFALAPIGAVKNIKGFLSYFAHKFSPEFDGWYELFGSKDFLPDNWITKMAAKDICGASEKEAELCDNELFLIGGPESDQWNASRTAIYSSQDPAGTSTQNIVHWMQMVRNGRVPAFDWGKKINKKKYGQDTPPEYDFGAIKGTKIHLYWSDDDWLGDPTDIHDFLLKELNPAVIAENVNL----KEYNHLDFTWGLNATFQIYDKAI 400          
BLAST of Lipase vs. Ensembl Celegans
Match: lipl-5 (Lipase [Source:UniProtKB/TrEMBL;Acc:O61866])

HSP 1 Score: 280.411 bits (716), Expect = 9.307e-90
Identity = 158/382 (41.36%), Postives = 215/382 (56.28%), Query Frame = 2
Query:  317 GIETDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRT--SSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFS-DLNSKVSAFVALAPVVYLGNLKTAIKYIAG-LGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGD-QMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKLKYNQITPPKYPLDT-HGLPVAMFYGGNDWMAVKEDV--------NRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVI 1420
            G   DPE+ M   ++I+ +GYP   + V T+DGYIL M RIP+G+T  + P  K+PVVF+QHGLL +S  WV N P++S  F+ AD GFDVWLGN RGNTYS KH    P    FWD++WDEMA +DL A IN+ L V+  D + Y+GHSQGT   F+  S+       K+  F ALAP+  + ++K  + + A      F+        GEFLPN   +   +K +CG  ++ +  C NV FL+ G   +  N TR+P+Y TH PAGTS++NI H+ Q         +D+G   NK KY Q  PP+Y      G  + +++   DW+A   DV        N AI  + QN  L    P+YNH+DF WG  A   IY   I
Sbjct:   18 GSHGDPELHMTTPQIIERWGYPAMIYTVATDDGYILEMHRIPFGKTNVTWPNGKRPVVFMQHGLLCASSDWVVNLPDQSAGFLFADAGFDVWLGNMRGNTYSMKHKDLKPSHSAFWDWSWDEMATYDLNAMINHVLEVTGQDSVYYMGHSQGTLTMFSHLSKDDGSFAKKIKKFFALAPIGSVKHIKGFLSFFANYFSLEFDGWFDIFGAGEFLPNNWAMKLAAKDICGGLKVEADLCDNVLFLIAGPESDQWNQTRVPVYATHDPAGTSTQNIVHWMQMVHHGGVPAYDWGTKTNKKKYGQANPPEYDFTAIKGTKIYLYWSDADWLADTPDVPDYLLTRLNPAI--VAQNNHL----PDYNHLDFTWGLRAPDDIYRPAI 393          
BLAST of Lipase vs. Ensembl Celegans
Match: lipl-5 (Lipase [Source:UniProtKB/TrEMBL;Acc:O61866])

HSP 1 Score: 280.411 bits (716), Expect = 9.307e-90
Identity = 158/382 (41.36%), Postives = 215/382 (56.28%), Query Frame = 2
Query:  317 GIETDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRT--SSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFS-DLNSKVSAFVALAPVVYLGNLKTAIKYIAG-LGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGD-QMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKLKYNQITPPKYPLDT-HGLPVAMFYGGNDWMAVKEDV--------NRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVI 1420
            G   DPE+ M   ++I+ +GYP   + V T+DGYIL M RIP+G+T  + P  K+PVVF+QHGLL +S  WV N P++S  F+ AD GFDVWLGN RGNTYS KH    P    FWD++WDEMA +DL A IN+ L V+  D + Y+GHSQGT   F+  S+       K+  F ALAP+  + ++K  + + A      F+        GEFLPN   +   +K +CG  ++ +  C NV FL+ G   +  N TR+P+Y TH PAGTS++NI H+ Q         +D+G   NK KY Q  PP+Y      G  + +++   DW+A   DV        N AI  + QN  L    P+YNH+DF WG  A   IY   I
Sbjct:   18 GSHGDPELHMTTPQIIERWGYPAMIYTVATDDGYILEMHRIPFGKTNVTWPNGKRPVVFMQHGLLCASSDWVVNLPDQSAGFLFADAGFDVWLGNMRGNTYSMKHKDLKPSHSAFWDWSWDEMATYDLNAMINHVLEVTGQDSVYYMGHSQGTLTMFSHLSKDDGSFAKKIKKFFALAPIGSVKHIKGFLSFFANYFSLEFDGWFDIFGAGEFLPNNWAMKLAAKDICGGLKVEADLCDNVLFLIAGPESDQWNQTRVPVYATHDPAGTSTQNIVHWMQMVHHGGVPAYDWGTKTNKKKYGQANPPEYDFTAIKGTKIYLYWSDADWLADTPDVPDYLLTRLNPAI--VAQNNHL----PDYNHLDFTWGLRAPDDIYRPAI 393          
BLAST of Lipase vs. Ensembl Fly
Match: CG31871 (gene:FBgn0051871 transcript:FBtr0080104)

HSP 1 Score: 286.574 bits (732), Expect = 1.667e-90
Identity = 149/395 (37.72%), Postives = 232/395 (58.73%), Query Frame = 2
Query:  281 LIVSINGGLLSPGIETDPEVTMDVN----EVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTSSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAI-KYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQ-MGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNV-KLIKFIPEYNHIDFIWGANAYTRIYPDVIDFLLKYNN 1444
            +++S N  L   G     +V  D +    ++I+ YGYP ETH V T+DGYIL M RIP  + + P      V L HG+LD+S TWV  GP+  L ++L+D G+DVW+GNSRGN YS+ HT  +   + FWDFT+ EM ++DLPA+I+Y L+ +  +++ YIGHSQGT I +   S+      K+++  ALAP+ Y+ ++K+ + + +    D      R +   EF+PN + +   S+ VC D  M    C N+ FL+ GYN E LN T +P+ ++H P+G S K + H+ Q   S  F+KFD G++ N+L+YN++TPP Y L    +PVA++Y  ND +     V+R   EL   + K +  +  +NH+DF+W  +    +Y  ++  + +  N
Sbjct:   52 VLLSSNPNLAGGGRNLKSDVLEDASLITPKLIRKYGYPSETHTVVTKDGYILEMHRIP-KKGAQP------VLLMHGILDTSATWVLMGPKSGLGYMLSDLGYDVWMGNSRGNRYSKNHTSLNSDYQEFWDFTFHEMGKYDLPANIDYILSKTGYEQVHYIGHSQGTAIFWVLCSEQPAYTQKITSMHALAPIAYIHDMKSPLFRTLVLFLDFLTAATRMLRITEFMPNTKFLVDHSQVVCHDNAMTQDVCSNILFLVAGYNSEQLNKTMLPVMLSHTPSGASIKQLEHFGQLMKSGHFRKFDRGYLRNQLEYNRMTPPDYDLSRVKVPVALYYSVNDLLVSTTGVDRLARELPNVIDKYLVPMERFNHLDFLWAIDVKPLVYNRLVRNVRRVEN 439          
BLAST of Lipase vs. Ensembl Fly
Match: Lip3 (gene:FBgn0023495 transcript:FBtr0082771)

HSP 1 Score: 276.174 bits (705), Expect = 3.630e-88
Identity = 140/369 (37.94%), Postives = 207/369 (56.10%), Query Frame = 2
Query:  347 DVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTSSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAI-KYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVC-GDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIP--EYNHIDFIWGANAYTRIYPDVIDFLLKYN 1441
            D  E I+  GYP+E H+V T D YILTM RIPY   +     +PV FL HG+L SS  WV  GPE+SLA++LAD G+DVW+GN+RGNTYS+ H  +  + + FW+F+W+E+  +D+PA I+Y L  +   ++ Y+GHSQGT +     S+  + N K+ +   L P  Y+GN+K+ + +  A +    N I+    + EF+P+ +    +   +C      +  C N  FL+ GY+ E L+Y  +       PAG S     H+ Q + S KF+KFDY  + N  +Y    PP Y L     PV ++YG NDWM    DV +   EL  N+ L   +P  ++ H+DFIWG  A   +Y +V+  +  Y 
Sbjct:   27 DCGERIEDDGYPMERHEVVTSDNYILTMHRIPYSPKTGESSNRPVAFLMHGMLSSSSDWVLMGPERSLAYMLADAGYDVWMGNARGNTYSKAHKYWPTYWQIFWNFSWNEIGMYDVPAMIDYVLAKTGQQQVQYVGHSQGTTVYLVMVSERPEYNDKIKSAHLLGPAAYMGNMKSPLTRAFAPILGQPNAIVEVCGSMEFMPSNKFKQDLGIEMCQATSPYADMCANEIFLIGGYDTEQLDYELLEHIKATSPAGASVNQNLHFCQEYNSGKFRKFDYTALRNPYEYGSYFPPDYKLKNAKAPVLLYYGANDWMCDVSDVRKLRDEL-PNMALDYLVPFEKWAHLDFIWGTEARKYVYDEVLKQMQSYE 394          
BLAST of Lipase vs. Ensembl Fly
Match: Lip4 (gene:FBgn0032264 transcript:FBtr0080093)

HSP 1 Score: 276.559 bits (706), Expect = 7.065e-88
Identity = 144/382 (37.70%), Postives = 224/382 (58.64%), Query Frame = 2
Query:  308 LSPGIETDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTSSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKT-AIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGD-QMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNV-KLIKFIPEYNHIDFIWGANAYTRIYPDVIDFLLKYNN 1444
            + P I+ D    ++   +IK YGYP E H + T+DGYILT+ RI     + PG     V L HGLLDSS TWV  GP K L ++L D+G+DVW+ N RGNTYSRKH K+S     FWDFT+ EM + D+PA+++Y L  +   +L YIGHSQGT + +   S+  +   K+     LAPV +L + ++  + ++A    + +++++ +   EFLP  + ++  ++ +C +  +    C NV FL  G++   LN T +P+ V H PAG S+K + H+ Q + S  F+++D+G++ N   Y  I PP Y L+     VA++YG NDW+A  EDV     +L   V K +    E+NH+DFIWG +A   ++  +++ +  + N
Sbjct:   59 VDPNIQEDSH--LNTYSLIKKYGYPAENHTLETDDGYILTLHRI-----ARPGATP--VLLVHGLLDSSATWVMMGPNKGLGYLLYDQGYDVWMANVRGNTYSRKHVKYSTHHAKFWDFTFHEMGKHDIPATMDYILNSTGVSQLHYIGHSQGTVVFWIMASEKPEYMDKIILMQGLAPVAFLKHCRSPVVNFLAEWHLSVSLVLKLIGVHEFLPKNEFISMFNRIICDETTITKEICSNVIFLTTGFDKLQLNETMLPVIVGHSPAGASTKQMQHFGQLNRSGGFRQYDHGWLRNHWIYGTIDPPSYHLENVRAKVALYYGQNDWLAPPEDVEMLNRKLPNVVEKYLVDDKEFNHLDFIWGIDARELLWDRMLEIMRNHEN 431          
BLAST of Lipase vs. Ensembl Fly
Match: Lip4 (gene:FBgn0032264 transcript:FBtr0331672)

HSP 1 Score: 276.559 bits (706), Expect = 1.080e-87
Identity = 144/382 (37.70%), Postives = 224/382 (58.64%), Query Frame = 2
Query:  308 LSPGIETDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTSSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKT-AIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGD-QMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNV-KLIKFIPEYNHIDFIWGANAYTRIYPDVIDFLLKYNN 1444
            + P I+ D    ++   +IK YGYP E H + T+DGYILT+ RI     + PG     V L HGLLDSS TWV  GP K L ++L D+G+DVW+ N RGNTYSRKH K+S     FWDFT+ EM + D+PA+++Y L  +   +L YIGHSQGT + +   S+  +   K+     LAPV +L + ++  + ++A    + +++++ +   EFLP  + ++  ++ +C +  +    C NV FL  G++   LN T +P+ V H PAG S+K + H+ Q + S  F+++D+G++ N   Y  I PP Y L+     VA++YG NDW+A  EDV     +L   V K +    E+NH+DFIWG +A   ++  +++ +  + N
Sbjct:   73 VDPNIQEDSH--LNTYSLIKKYGYPAENHTLETDDGYILTLHRI-----ARPGATP--VLLVHGLLDSSATWVMMGPNKGLGYLLYDQGYDVWMANVRGNTYSRKHVKYSTHHAKFWDFTFHEMGKHDIPATMDYILNSTGVSQLHYIGHSQGTVVFWIMASEKPEYMDKIILMQGLAPVAFLKHCRSPVVNFLAEWHLSVSLVLKLIGVHEFLPKNEFISMFNRIICDETTITKEICSNVIFLTTGFDKLQLNETMLPVIVGHSPAGASTKQMQHFGQLNRSGGFRQYDHGWLRNHWIYGTIDPPSYHLENVRAKVALYYGQNDWLAPPEDVEMLNRKLPNVVEKYLVDDKEFNHLDFIWGIDARELLWDRMLEIMRNHEN 445          
BLAST of Lipase vs. Ensembl Fly
Match: CG8093 (gene:FBgn0033999 transcript:FBtr0339997)

HSP 1 Score: 274.633 bits (701), Expect = 1.305e-87
Identity = 148/394 (37.56%), Postives = 225/394 (57.11%), Query Frame = 2
Query:  278 LLIVSINGGLLSPGI------ETDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTSSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAG--LGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQ-MGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQN-VKLIKFIPE--YNHIDFIWGANAYTRIYPDVID 1423
            +L+V +    LS G+      +T    ++    +++ +GY +E H+V T DGYILTM RIPY + +     +PVVFL HGLL SS  WV  GP   LA++L++ G+DVW+GN+RGNTYS++H   SP  + FW+F W ++  +DLPA ++Y L  +   +L Y+GHSQGT   F   S      S++ +   LAPV ++ ++++ +  + G  LG   N  +    + EFLPN QL+N     +C D+ +    C N  FLL G+N   +N T +P  +   PAG S   I HY Q + S  F++FDYG   NK +Y+  TPP+Y ++   +P  ++Y  ND+ A   DV+R    +  + +K    +PE  +NHIDF+WG N    +Y  VI+
Sbjct:    1 MLVVQLIAVFLSLGLANALPADTGRASSVTTVTIVRGHGYEIEEHEVQTSDGYILTMHRIPYSKNTGYDGPRPVVFLMHGLLCSSSDWVLAGPHSGLAYLLSEAGYDVWMGNARGNTYSKRHASKSPLLQPFWNFEWHDIGIYDLPAMMDYVLYWTNVTQLTYVGHSQGTTSFFVLNSMIPRFKSRIRSAHLLAPVAWMEHMESPLATVGGPLLGQP-NAFVELFGSAEFLPNTQLMNLFGALLCSDEAISQFMCTNTLFLLGGWNSPYINETLLPDIMATTPAGCSVNQIFHYLQEYNSGYFRQFDYGSTRNKKEYSSKTPPEYDVEGIDVPTYLYYSDNDYFASLIDVDRLRYTMNPSALKSAYRMPEEKWNHIDFLWGLNIKEILYDRVIN 393          
BLAST of Lipase vs. Ensembl Zebrafish
Match: lipf (lipase, gastric [Source:ZFIN;Acc:ZDB-GENE-040426-2737])

HSP 1 Score: 316.62 bits (810), Expect = 7.675e-104
Identity = 159/371 (42.86%), Postives = 230/371 (61.99%), Query Frame = 2
Query:  317 GIETDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTSSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFL 1429
            G   DPEV M+++E+I+++GYP E  +V TEDGYIL++ RIP+G  +     KPVVFLQHGLL +   WV N P  SL F+LAD GFDVW+GNSRGNT+S KH    P  K +W F+ DEMA+ DLPA IN+   ++  +++ Y+GHSQGT I F  FS   +L SK+  F ALAPV  +G  K+ +  ++ + +   +I       +F P  +L+   +   C  +  S+ CGNV FLL G++ +NLN +R P+Y TH PAGTS +N+ H+AQ+  S+K   +DYG   N   YNQ TPP Y +    +P A++ GG D +A  +DV   + ++ + V   + I  + H+DFIWG +A   +Y  +I+ +
Sbjct:   25 GTGLDPEVNMNISEIIRHWGYPAEEFEVVTEDGYILSINRIPHGVKNKNEEVKPVVFLQHGLLAAGSNWVTNLPNNSLGFVLADAGFDVWIGNSRGNTWSCKHVSLDPRQKEYWKFSHDEMAKKDLPAVINFITKMTGQEQIFYVGHSQGTTIAFMAFSTMPELASKIKMFFALAPVATVGMTKSPMTKLSVIPEF--LIWDLFGQKDFFPQNELIKFFATEFCSRKPLSVLCGNVFFLLCGFDEKNLNMSRTPVYTTHCPAGTSVQNMIHWAQAVKSSKLMAYDYGRAGNMAHYNQSTPPLYNIQDMTVPTAVWSGGQDTLADPKDVALLLTQIPKLV-YKRDIKHWEHLDFIWGMDAPQEMYEKMIEIM 392          
BLAST of Lipase vs. Ensembl Zebrafish
Match: lipf (lipase, gastric [Source:ZFIN;Acc:ZDB-GENE-040426-2737])

HSP 1 Score: 316.62 bits (810), Expect = 7.675e-104
Identity = 159/371 (42.86%), Postives = 230/371 (61.99%), Query Frame = 2
Query:  317 GIETDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTSSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFL 1429
            G   DPEV M+++E+I+++GYP E  +V TEDGYIL++ RIP+G  +     KPVVFLQHGLL +   WV N P  SL F+LAD GFDVW+GNSRGNT+S KH    P  K +W F+ DEMA+ DLPA IN+   ++  +++ Y+GHSQGT I F  FS   +L SK+  F ALAPV  +G  K+ +  ++ + +   +I       +F P  +L+   +   C  +  S+ CGNV FLL G++ +NLN +R P+Y TH PAGTS +N+ H+AQ+  S+K   +DYG   N   YNQ TPP Y +    +P A++ GG D +A  +DV   + ++ + V   + I  + H+DFIWG +A   +Y  +I+ +
Sbjct:   25 GTGLDPEVNMNISEIIRHWGYPAEEFEVVTEDGYILSINRIPHGVKNKNEEVKPVVFLQHGLLAAGSNWVTNLPNNSLGFVLADAGFDVWIGNSRGNTWSCKHVSLDPRQKEYWKFSHDEMAKKDLPAVINFITKMTGQEQIFYVGHSQGTTIAFMAFSTMPELASKIKMFFALAPVATVGMTKSPMTKLSVIPEF--LIWDLFGQKDFFPQNELIKFFATEFCSRKPLSVLCGNVFFLLCGFDEKNLNMSRTPVYTTHCPAGTSVQNMIHWAQAVKSSKLMAYDYGRAGNMAHYNQSTPPLYNIQDMTVPTAVWSGGQDTLADPKDVALLLTQIPKLV-YKRDIKHWEHLDFIWGMDAPQEMYEKMIEIM 392          
BLAST of Lipase vs. Ensembl Xenopus
Match: lipa (lipase A, lysosomal acid, cholesterol esterase [Source:NCBI gene;Acc:548564])

HSP 1 Score: 323.168 bits (827), Expect = 1.956e-105
Identity = 163/390 (41.79%), Postives = 238/390 (61.03%), Query Frame = 2
Query:  269 VPCLLIVSINGGLLSPGIETDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTSSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFLLKY 1438
            VP  +   + G LL      DPE TM+++E+I+Y GYP E ++V TEDGYIL++ RIP+G   +    KPVVFLQHGLL     WV N    SL FILAD G+DVW+GNSRGNT+SRKH   SP  + FW F++DE+A+ DLPA +++    +  +++ Y+GHSQGT I F  FS    L  K+  +  LAPV  +   K+ +  +  L +   +I      GEFLP   L+  ++   C   +    CGN+ FLL G+N +NLN +R+ +Y +H PAGTS +N+ H+ Q   S + + FD+G   N + YNQ TPP Y +    +P A++ GGNDW+A ++DV   + ++  N+   K IP++ H+DFIWG +A  R+Y ++I  + K+
Sbjct:   67 VPSRIRHGVAGDLL---YSADPEATMNISELIRYRGYPSEEYEVLTEDGYILSVNRIPHGVKYASEGPKPVVFLQHGLLADGSNWVTNLENNSLGFILADAGYDVWIGNSRGNTWSRKHKSLSPDQEEFWAFSYDELAKKDLPAVVDFITKKTGQEQIFYVGHSQGTTIAFIAFSSLPQLAKKIKMYFGLAPVATVKFSKSPLAKLGVLPEF--LIEELFGKGEFLPQTYLITWLATHFCTHAIADELCGNIFFLLSGFNEKNLNMSRVNVYSSHCPAGTSVQNMLHWRQGVRSGELKAFDFGTKGNMIHYNQTTPPFYHVRDMTVPTALWTGGNDWLADRKDVALLLTQV-SNLVYHKEIPDWEHLDFIWGLDAPERMYNEIIAMMKKF 450          
BLAST of Lipase vs. Ensembl Xenopus
Match: lipa (lipase A, lysosomal acid, cholesterol esterase [Source:NCBI gene;Acc:548564])

HSP 1 Score: 309.301 bits (791), Expect = 3.487e-101
Identity = 155/370 (41.89%), Postives = 227/370 (61.35%), Query Frame = 2
Query:  332 PEVTMDV-NEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTSSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFLLKY 1438
            P+  M   +E+I+Y GYP E ++V TEDGYIL++ RIP+G   +    KPVVFLQHGLL     WV N    SL FILAD G+DVW+GNSRGNT+SRKH   SP  + FW F++DE+A+ DLPA +++    +  +++ Y+GHSQGT I F  FS    L  K+  +  LAPV  +   K+ +  +  L +   +I      GEFLP   L+  ++   C   +    CGN+ FLL G+N +NLN +R+ +Y +H PAGTS +N+ H+ Q   S + + FD+G   N + YNQ TPP Y +    +P A++ GGNDW+A ++DV   + ++  N+   K IP++ H+DFIWG +A  R+Y ++I  + K+
Sbjct:    2 PDCRMHCPSELIRYRGYPSEEYEVLTEDGYILSVNRIPHGVKYASEGPKPVVFLQHGLLADGSNWVTNLENNSLGFILADAGYDVWIGNSRGNTWSRKHKSLSPDQEEFWAFSYDELAKKDLPAVVDFITKKTGQEQIFYVGHSQGTTIAFIAFSSLPQLAKKIKMYFGLAPVATVKFSKSPLAKLGVLPEF--LIEELFGKGEFLPQTYLITWLATHFCTHAIADELCGNIFFLLSGFNEKNLNMSRVNVYSSHCPAGTSVQNMLHWRQGVRSGELKAFDFGTKGNMIHYNQTTPPFYHVRDMTVPTALWTGGNDWLADRKDVALLLTQV-SNLVYHKEIPDWEHLDFIWGLDAPERMYNEIIAMMKKF 368          
BLAST of Lipase vs. Ensembl Xenopus
Match: lipa (lipase A, lysosomal acid, cholesterol esterase [Source:NCBI gene;Acc:548564])

HSP 1 Score: 308.916 bits (790), Expect = 4.342e-101
Identity = 153/362 (42.27%), Postives = 224/362 (61.88%), Query Frame = 2
Query:  353 NEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTSSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFLLKY 1438
            +E+I+Y GYP E ++V TEDGYIL++ RIP+G   +    KPVVFLQHGLL     WV N    SL FILAD G+DVW+GNSRGNT+SRKH   SP  + FW F++DE+A+ DLPA +++    +  +++ Y+GHSQGT I F  FS    L  K+  +  LAPV  +   K+ +  +  L +   +I      GEFLP   L+  ++   C   +    CGN+ FLL G+N +NLN +R+ +Y +H PAGTS +N+ H+ Q   S + + FD+G   N + YNQ TPP Y +    +P A++ GGNDW+A ++DV   + ++  N+   K IP++ H+DFIWG +A  R+Y ++I  + K+
Sbjct:    2 DELIRYRGYPSEEYEVLTEDGYILSVNRIPHGVKYASEGPKPVVFLQHGLLADGSNWVTNLENNSLGFILADAGYDVWIGNSRGNTWSRKHKSLSPDQEEFWAFSYDELAKKDLPAVVDFITKKTGQEQIFYVGHSQGTTIAFIAFSSLPQLAKKIKMYFGLAPVATVKFSKSPLAKLGVLPEF--LIEELFGKGEFLPQTYLITWLATHFCTHAIADELCGNIFFLLSGFNEKNLNMSRVNVYSSHCPAGTSVQNMLHWRQGVRSGELKAFDFGTKGNMIHYNQTTPPFYHVRDMTVPTALWTGGNDWLADRKDVALLLTQV-SNLVYHKEIPDWEHLDFIWGLDAPERMYNEIIAMMKKF 360          
BLAST of Lipase vs. Ensembl Xenopus
Match: lipa (lipase A, lysosomal acid, cholesterol esterase [Source:NCBI gene;Acc:548564])

HSP 1 Score: 308.531 bits (789), Expect = 9.514e-101
Identity = 153/361 (42.38%), Postives = 223/361 (61.77%), Query Frame = 2
Query:  356 EVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTSSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFLLKY 1438
            E+I+Y GYP E ++V TEDGYIL++ RIP+G   +    KPVVFLQHGLL     WV N    SL FILAD G+DVW+GNSRGNT+SRKH   SP  + FW F++DE+A+ DLPA +++    +  +++ Y+GHSQGT I F  FS    L  K+  +  LAPV  +   K+ +  +  L +   +I      GEFLP   L+  ++   C   +    CGN+ FLL G+N +NLN +R+ +Y +H PAGTS +N+ H+ Q   S + + FD+G   N + YNQ TPP Y +    +P A++ GGNDW+A ++DV   + ++  N+   K IP++ H+DFIWG +A  R+Y ++I  + K+
Sbjct:   13 ELIRYRGYPSEEYEVLTEDGYILSVNRIPHGVKYASEGPKPVVFLQHGLLADGSNWVTNLENNSLGFILADAGYDVWIGNSRGNTWSRKHKSLSPDQEEFWAFSYDELAKKDLPAVVDFITKKTGQEQIFYVGHSQGTTIAFIAFSSLPQLAKKIKMYFGLAPVATVKFSKSPLAKLGVLPEF--LIEELFGKGEFLPQTYLITWLATHFCTHAIADELCGNIFFLLSGFNEKNLNMSRVNVYSSHCPAGTSVQNMLHWRQGVRSGELKAFDFGTKGNMIHYNQTTPPFYHVRDMTVPTALWTGGNDWLADRKDVALLLTQV-SNLVYHKEIPDWEHLDFIWGLDAPERMYNEIIAMMKKF 370          
BLAST of Lipase vs. Ensembl Xenopus
Match: lipa (lipase A, lysosomal acid, cholesterol esterase [Source:NCBI gene;Acc:548564])

HSP 1 Score: 308.531 bits (789), Expect = 1.522e-100
Identity = 153/367 (41.69%), Postives = 226/367 (61.58%), Query Frame = 2
Query:  338 VTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTSSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFLLKY 1438
            + +  +E+I+Y GYP E ++V TEDGYIL++ RIP+G   +    KPVVFLQHGLL     WV N    SL FILAD G+DVW+GNSRGNT+SRKH   SP  + FW F++DE+A+ DLPA +++    +  +++ Y+GHSQGT I F  FS    L  K+  +  LAPV  +   K+ +  +  L +   +I      GEFLP   L+  ++   C   +    CGN+ FLL G+N +NLN +R+ +Y +H PAGTS +N+ H+ Q   S + + FD+G   N + YNQ TPP Y +    +P A++ GGNDW+A ++DV   + ++  N+   K IP++ H+DFIWG +A  R+Y ++I  + K+
Sbjct:   28 LIISSSELIRYRGYPSEEYEVLTEDGYILSVNRIPHGVKYASEGPKPVVFLQHGLLADGSNWVTNLENNSLGFILADAGYDVWIGNSRGNTWSRKHKSLSPDQEEFWAFSYDELAKKDLPAVVDFITKKTGQEQIFYVGHSQGTTIAFIAFSSLPQLAKKIKMYFGLAPVATVKFSKSPLAKLGVLPEF--LIEELFGKGEFLPQTYLITWLATHFCTHAIADELCGNIFFLLSGFNEKNLNMSRVNVYSSHCPAGTSVQNMLHWRQGVRSGELKAFDFGTKGNMIHYNQTTPPFYHVRDMTVPTALWTGGNDWLADRKDVALLLTQV-SNLVYHKEIPDWEHLDFIWGLDAPERMYNEIIAMMKKF 391          
BLAST of Lipase vs. Ensembl Mouse
Match: Lipa (lysosomal acid lipase A [Source:MGI Symbol;Acc:MGI:96789])

HSP 1 Score: 316.235 bits (809), Expect = 1.634e-103
Identity = 169/376 (44.95%), Postives = 226/376 (60.11%), Query Frame = 2
Query:  326 TDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTSSPGI-KKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFV-INKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLI--KFIPEYNHIDFIWGANAYTRIYPDVIDFLLKYN 1441
             DPEV M+V E+I  +GYP E H V T DGYIL++ RIP GR +  G   +PVV+LQHGLL  S  WV N    SL F+LAD GFDVW+GNSRGNT+S KH   S     FW F++DEMA++DLPASINY L  +  +++ Y+GHSQG  IGF  FSQ  +L  K+  F+ LAPV+ L      +  +  L D   ++       +FLP   ++  +S  VC   +    C NV FLL G+N +NLN +R+ +Y TH PAGTS +N+ H+ Q     K Q FD+G    N   YNQ  PP Y +    LP A++ GG DW+A   D+N     L Q  KL+  K IPE++H+DFIWG +A  ++Y ++I  + KY 
Sbjct:   27 VDPEVNMNVTEIIMRWGYPGEEHSVLTGDGYILSIHRIPRGRKNHFGKGPRPVVYLQHGLLADSSNWVTNIDNSSLGFLLADAGFDVWMGNSRGNTWSLKHKTLSVSQDEFWAFSFDEMAKYDLPASINYILNKTGQEQIYYVGHSQGCTIGFIAFSQMPELAKKIKMFLVLAPVLSLNFASGPLLQLGRLPDP--LLKDMFGQKQFLPQSAMLKWLSIHVCTHVIMKELCANVFFLLCGFNEKNLNMSRVDVYTTHCPAGTSVQNMLHWGQVFKYRKLQAFDWGSSEKNYFHYNQSFPPSYNIKNMRLPTALWSGGRDWLA---DINDITILLTQIPKLVYHKNIPEWDHLDFIWGLDAPWKLYDEIISLMKKYQ 397          
BLAST of Lipase vs. Ensembl Mouse
Match: Lipa (lysosomal acid lipase A [Source:MGI Symbol;Acc:MGI:96789])

HSP 1 Score: 316.235 bits (809), Expect = 1.634e-103
Identity = 169/376 (44.95%), Postives = 226/376 (60.11%), Query Frame = 2
Query:  326 TDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTSSPGI-KKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFV-INKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLI--KFIPEYNHIDFIWGANAYTRIYPDVIDFLLKYN 1441
             DPEV M+V E+I  +GYP E H V T DGYIL++ RIP GR +  G   +PVV+LQHGLL  S  WV N    SL F+LAD GFDVW+GNSRGNT+S KH   S     FW F++DEMA++DLPASINY L  +  +++ Y+GHSQG  IGF  FSQ  +L  K+  F+ LAPV+ L      +  +  L D   ++       +FLP   ++  +S  VC   +    C NV FLL G+N +NLN +R+ +Y TH PAGTS +N+ H+ Q     K Q FD+G    N   YNQ  PP Y +    LP A++ GG DW+A   D+N     L Q  KL+  K IPE++H+DFIWG +A  ++Y ++I  + KY 
Sbjct:   27 VDPEVNMNVTEIIMRWGYPGEEHSVLTGDGYILSIHRIPRGRKNHFGKGPRPVVYLQHGLLADSSNWVTNIDNSSLGFLLADAGFDVWMGNSRGNTWSLKHKTLSVSQDEFWAFSFDEMAKYDLPASINYILNKTGQEQIYYVGHSQGCTIGFIAFSQMPELAKKIKMFLVLAPVLSLNFASGPLLQLGRLPDP--LLKDMFGQKQFLPQSAMLKWLSIHVCTHVIMKELCANVFFLLCGFNEKNLNMSRVDVYTTHCPAGTSVQNMLHWGQVFKYRKLQAFDWGSSEKNYFHYNQSFPPSYNIKNMRLPTALWSGGRDWLA---DINDITILLTQIPKLVYHKNIPEWDHLDFIWGLDAPWKLYDEIISLMKKYQ 397          
BLAST of Lipase vs. Ensembl Mouse
Match: Lipm (lipase, family member M [Source:MGI Symbol;Acc:MGI:1926003])

HSP 1 Score: 313.923 bits (803), Expect = 2.543e-102
Identity = 171/401 (42.64%), Postives = 240/401 (59.85%), Query Frame = 2
Query:  263 IRVPCLLIVSINGGLLSPGIETDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTS-SPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVI---MRTVTTG--EFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGF-VINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFLLKYNN 1444
            I V  LL  ++N G L P    DPE  M+V+E+IK+ GYP E ++V TEDGYIL++ RIP G+T       +PVV LQHGLL  +  W++N P  SL FILAD GFDVW+GNSRGNT+SRKH   S     FW F++DEMA+FDLPA IN+ L  +   K+ Y+G+SQGT +GF  FS   +L  K+  + ALAP+         +KY    G  F ++   M  V  G  EFL   +    +  ++CG  +    C N+  LL G+N  N+N +R  +YV H PAGTS +NI H++Q+  S + + FD+G    N+ K NQ TP +Y +    +P AM+ GG DW++  +DV   + E+  N+   K IPE+ H+DFIWG +A  R+Y ++I  + +  N
Sbjct:   21 ILVAYLLQRNVNSGHL-PTKAADPEAFMNVSEIIKHKGYPSEEYEVATEDGYILSVNRIPRGQTRLKKEGSRPVVLLQHGLLGDASNWISNLPNNSLGFILADAGFDVWMGNSRGNTWSRKHKTLSIDQDEFWAFSYDEMARFDLPAVINFILQKTGQKKVYYVGYSQGTTMGFIAFSTMPELAHKIKMYFALAPI-------ATVKYARSPGTKFLLLPDMMIKVLFGRQEFLYQTRFFRQLFIYLCGQMILDQICSNIILLLGGFNTNNMNMSRANVYVAHTPAGTSVQNILHWSQAVNSGELRAFDWGSETKNQEKCNQPTPIRYKVRDMMVPTAMWTGGQDWLSNPDDVKTLLSEV-TNLIYHKNIPEWAHVDFIWGLDAPQRVYNEIIHLMKQEPN 412          
BLAST of Lipase vs. Ensembl Mouse
Match: Lipf (lipase, gastric [Source:MGI Symbol;Acc:MGI:1914967])

HSP 1 Score: 301.212 bits (770), Expect = 1.016e-97
Identity = 156/370 (42.16%), Postives = 238/370 (64.32%), Query Frame = 2
Query:  329 DPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTSSPGI-KKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGE-FLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVI-NKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFL 1429
            +PE  M+V+++I Y+GYP E ++V TEDGYIL + RIPYG+ +S  I K+PV +LQHGL+ S+  W+ N P  SLAFILAD G+DVWLGNSRGNT+SRK+  +SP S  FW F++DEMA++DLPA+I++ +  +  +K+ Y+GHSQGT IGF  FS    L  K+  F ALAPV  +   ++  K I+ +      +++ +   + F+P+  L   +   VC  ++  L C N  F+  G++ +NLN +R  +Y+ H PAGTS++++ H+AQ   S K Q +++G  + N L YNQ TPP Y +    +P+A++ GG+D +A  +DV   + +L  N+   K I  YNH+DFIW  +A   +Y +++  +
Sbjct:   27 NPEANMNVSQMITYWGYPSEEYEVVTEDGYILGVYRIPYGKKNSENIGKRPVAYLQHGLIASATNWITNLPNNSLAFILADAGYDVWLGNSRGNTWSRKNVYYSPDSVEFWAFSFDEMAKYDLPATIDFIVQKTGQEKIHYVGHSQGTTIGFIAFSTNPALAKKIKRFYALAPVATVKYTESPFKKISLIP---KFLLKVIFGNKMFMPHNYLDQFLGTEVCSRELLDLLCSNALFIFCGFDKKNLNVSRFDVYLGHNPAGTSTQDLFHWAQLAKSGKLQAYNWGSPLQNMLHYNQKTPPYYDVSAMTVPIAVWNGGHDILADPQDVAMLLPKL-PNLLYHKEILPYNHLDFIWAMDAPQEVYNEIVTMM 392          
BLAST of Lipase vs. Ensembl Mouse
Match: Lipk (lipase, family member K [Source:MGI Symbol;Acc:MGI:2679259])

HSP 1 Score: 296.975 bits (759), Expect = 5.009e-96
Identity = 158/387 (40.83%), Postives = 228/387 (58.91%), Query Frame = 2
Query:  275 CLLIVSINGGLLSPGIETDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGR-TSSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFV-INKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFL 1429
            C+L+     G     I T+PE  M+++E+I Y+GYP E H V TEDGYIL   RIP+G+  S     K VV+LQHGL+ S+  W+ N P  SLAF+LAD G+DVWLGNSRGNT+SR H + SP S  +W F+WDEMA++DLPA++N  L  S   +L Y+GHSQGT I F  FS   +L  K+  F ALAPV  +   ++ +K +  L      +        F  +      ++  VC  ++    C N  F L G++ +NLN +R+ +Y++  PAGTS +N+ H+AQ+  S + Q FD+G    N + +NQ+TPP Y +    +P AM+ GG D +A  +D    + ++  N+   K IP YNH+DF  G +A   +Y D+I  +
Sbjct:   10 CVLLSGPIDGYKQESI-TNPEANMNISELISYWGYPYEKHDVITEDGYILGTYRIPHGKGCSRKTAPKAVVYLQHGLIASANNWICNLPNNSLAFLLADSGYDVWLGNSRGNTWSRNHLRLSPKSPQYWAFSWDEMAKYDLPATVNLILEKSGQKQLFYVGHSQGTTIAFIAFSTNPELAKKIRLFFALAPVATVKYTRSPMKKLTTLSR--KAVKVLFGDKMFSTHTWFEQFIATKVCNRKLFHQLCSNFLFSLSGFDPQNLNMSRLDVYLSQSPAGTSVQNMLHWAQAVNSGQLQAFDWGNPDQNMMHFNQLTPPVYNISKMRVPTAMWSGGQDVVADAKDTKNLLPKIA-NLIYYKEIPHYNHMDFYLGQDAPQEVYGDLIRMI 392          
BLAST of Lipase vs. UniProt/SwissProt
Match: sp|P38571|LICH_HUMAN (Lysosomal acid lipase/cholesteryl ester hydrolase OS=Homo sapiens OX=9606 GN=LIPA PE=1 SV=2)

HSP 1 Score: 328.946 bits (842), Expect = 1.248e-107
Identity = 175/397 (44.08%), Postives = 243/397 (61.21%), Query Frame = 2
Query:  269 VPCLLIVSIN----GGLLSPGIETDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTS-SPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYG-FVINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFLLKYN 1441
            V CL++ +++    GG L+     DPE  M+V+E+I Y+G+P E + V TEDGYIL + RIP+GR + S    KPVVFLQHGLL  S  WV N    SL FILAD GFDVW+GNSRGNT+SRKH   S     FW F++DEMA++DLPASIN+ L  +  +++ Y+GHSQGT IGF  FSQ  +L  ++  F AL PV  +    + +  +  L D  ++I       EFLP    +  +   VC   +    CGN+ FLL G+N  NLN +R+ +Y TH PAGTS +N+ H++Q+    KFQ FD+G    N   YNQ  PP Y +    +P A++ GG+DW+A   DVN  + ++  N+   + IPE+ H+DFIWG +A  R+Y  +I+ + KY 
Sbjct:    9 VVCLVLWTLHSEGSGGKLTA---VDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPD--HLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQI-TNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ 399          
BLAST of Lipase vs. UniProt/SwissProt
Match: sp|Q4R4S5|LICH_MACFA (Lysosomal acid lipase/cholesteryl ester hydrolase OS=Macaca fascicularis OX=9541 GN=LIPA PE=2 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 2.997e-107
Identity = 175/396 (44.19%), Postives = 244/396 (61.62%), Query Frame = 2
Query:  269 VPCLLIVSIN----GGLLSPGIETDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTS-SPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYG-FVINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFLLKY 1438
            V CL++ +++    GG L+     +PE  M+V+E+I Y+G+P E + V TEDGYIL + RIP+GR + S    KPVVFLQHGLL  S  WV N    SL FILAD GFDVW+GNSRGNT+SRKH   S     FW F++DEMA++DLPASIN+ L  +  +++ Y+GHSQGT IGF  FSQ  +L  ++  F ALAPVV +    + +  +  L D   +I       EFLP    +  +   VC   +    CGN+ FLL G+N  NLN +R+ +Y TH PAGTS +N+ H++Q+    KFQ FD+G    N   YNQ  PP Y +    +P A++ GG+DW+A   D+N  + ++  N+   + IPE+ H+DFIWG +A  R+Y  +I+ + KY
Sbjct:    9 VVCLVLWTLHSEASGGKLTA---VNPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALAPVVSVDFCTSPMAKLGRLPDL--LIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDINILLTQI-TNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMKKY 398          
BLAST of Lipase vs. UniProt/SwissProt
Match: sp|P80035|LIPG_CANLF (Gastric triacylglycerol lipase OS=Canis lupus familiaris OX=9615 GN=LIPF PE=1 SV=2)

HSP 1 Score: 317.775 bits (813), Expect = 2.601e-103
Identity = 166/383 (43.34%), Postives = 243/383 (63.45%), Query Frame = 2
Query:  302 GLLSPGIETDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTSSPGI-KKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVI---MRTVTTGE--FLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGF-VINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFL 1429
            GL      T+PEVTM+++++I Y+GYP E ++V TEDGYIL + RIPYGR +S  I ++PV FLQHGLL S+  W++N P  SLAFILAD G+DVWLGNSRGNT++R++  +SP S  FW F++DEMA++DLPA+I++ L  +  DKL Y+GHSQGT IGF  FS    L  ++  F ALAPV         +KY   L +   ++   +  +  G   F P+      ++  VC  +   L C N  F++ G++  NLN +R+ +Y++H PAGTS +N+ H++Q+  S KFQ FD+G  V N + Y+Q  PP Y L    +P+A++ GGND +A   DV+  + +L  N+   + IP YNH+DFIW  +A   +Y +++  +
Sbjct:   19 GLFGKLHPTNPEVTMNISQMITYWGYPAEEYEVVTEDGYILGIDRIPYGRKNSENIGRRPVAFLQHGLLASATNWISNLPNNSLAFILADAGYDVWLGNSRGNTWARRNLYYSPDSVEFWAFSFDEMAKYDLPATIDFILKKTGQDKLHYVGHSQGTTIGFIAFSTNPKLAKRIKTFYALAPVA-------TVKYTETLLNKLMLVPSFLFKLIFGNKIFYPHHFFDQFLATEVCSRETVDLLCSNALFIICGFDTMNLNMSRLDVYLSHNPAGTSVQNVLHWSQAVKSGKFQAFDWGSPVQNMMHYHQSMPPYYNLTDMHVPIAVWNGGNDLLADPHDVDLLLSKL-PNLIYHRKIPPYNHLDFIWAMDAPQAVYNEIVSMM 393          
BLAST of Lipase vs. UniProt/SwissProt
Match: sp|Q9Z0M5|LICH_MOUSE (Lysosomal acid lipase/cholesteryl ester hydrolase OS=Mus musculus OX=10090 GN=Lipa PE=1 SV=2)

HSP 1 Score: 316.235 bits (809), Expect = 1.143e-102
Identity = 169/376 (44.95%), Postives = 226/376 (60.11%), Query Frame = 2
Query:  326 TDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTSSPGI-KKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFV-INKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLI--KFIPEYNHIDFIWGANAYTRIYPDVIDFLLKYN 1441
             DPEV M+V E+I  +GYP E H V T DGYIL++ RIP GR +  G   +PVV+LQHGLL  S  WV N    SL F+LAD GFDVW+GNSRGNT+S KH   S     FW F++DEMA++DLPASINY L  +  +++ Y+GHSQG  IGF  FSQ  +L  K+  F+ LAPV+ L      +  +  L D   ++       +FLP   ++  +S  VC   +    C NV FLL G+N +NLN +R+ +Y TH PAGTS +N+ H+ Q     K Q FD+G    N   YNQ  PP Y +    LP A++ GG DW+A   D+N     L Q  KL+  K IPE++H+DFIWG +A  ++Y ++I  + KY 
Sbjct:   27 VDPEVNMNVTEIIMRWGYPGEEHSVLTGDGYILSIHRIPRGRKNHFGKGPRPVVYLQHGLLADSSNWVTNIDNSSLGFLLADAGFDVWMGNSRGNTWSLKHKTLSVSQDEFWAFSFDEMAKYDLPASINYILNKTGQEQIYYVGHSQGCTIGFIAFSQMPELAKKIKMFLVLAPVLSLNFASGPLLQLGRLPDP--LLKDMFGQKQFLPQSAMLKWLSIHVCTHVIMKELCANVFFLLCGFNEKNLNMSRVDVYTTHCPAGTSVQNMLHWGQVFKYRKLQAFDWGSSEKNYFHYNQSFPPSYNIKNMRLPTALWSGGRDWLA---DINDITILLTQIPKLVYHKNIPEWDHLDFIWGLDAPWKLYDEIISLMKKYQ 397          
BLAST of Lipase vs. UniProt/SwissProt
Match: sp|Q8K2A6|LIPM_MOUSE (Lipase member M OS=Mus musculus OX=10090 GN=Lipm PE=2 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 1.779e-101
Identity = 171/401 (42.64%), Postives = 240/401 (59.85%), Query Frame = 2
Query:  263 IRVPCLLIVSINGGLLSPGIETDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTS-SPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVI---MRTVTTG--EFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGF-VINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFLLKYNN 1444
            I V  LL  ++N G L P    DPE  M+V+E+IK+ GYP E ++V TEDGYIL++ RIP G+T       +PVV LQHGLL  +  W++N P  SL FILAD GFDVW+GNSRGNT+SRKH   S     FW F++DEMA+FDLPA IN+ L  +   K+ Y+G+SQGT +GF  FS   +L  K+  + ALAP+         +KY    G  F ++   M  V  G  EFL   +    +  ++CG  +    C N+  LL G+N  N+N +R  +YV H PAGTS +NI H++Q+  S + + FD+G    N+ K NQ TP +Y +    +P AM+ GG DW++  +DV   + E+  N+   K IPE+ H+DFIWG +A  R+Y ++I  + +  N
Sbjct:   21 ILVAYLLQRNVNSGHL-PTKAADPEAFMNVSEIIKHKGYPSEEYEVATEDGYILSVNRIPRGQTRLKKEGSRPVVLLQHGLLGDASNWISNLPNNSLGFILADAGFDVWMGNSRGNTWSRKHKTLSIDQDEFWAFSYDEMARFDLPAVINFILQKTGQKKVYYVGYSQGTTMGFIAFSTMPELAHKIKMYFALAPI-------ATVKYARSPGTKFLLLPDMMIKVLFGRQEFLYQTRFFRQLFIYLCGQMILDQICSNIILLLGGFNTNNMNMSRANVYVAHTPAGTSVQNILHWSQAVNSGELRAFDWGSETKNQEKCNQPTPIRYKVRDMMVPTAMWTGGQDWLSNPDDVKTLLSEV-TNLIYHKNIPEWAHVDFIWGLDAPQRVYNEIIHLMKQEPN 412          
BLAST of Lipase vs. TrEMBL
Match: A0A4V3SDI7 (Lipase OS=Opisthorchis felineus OX=147828 GN=CRM22_008291 PE=3 SV=1)

HSP 1 Score: 384.415 bits (986), Expect = 7.762e-127
Identity = 182/374 (48.66%), Postives = 252/374 (67.38%), Query Frame = 2
Query:  317 GIETDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTSSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFLLKY 1438
             +  DPE+  +  ++I+ YG+ +E H V T DGYIL + R+   R  +  + K VVFLQHGLLDS+ TW+NN   +SLAFILAD GFDVWLGNSRG+TYSRKH K+      FW+F+WD+MAQFDLPAS+ + L V+ ++ LGY+GHSQG +I  A+F++  +L S +S FVALAPV YLG++ + I+YIA        +      GEFLP+ +L++ ++ F+CG       C NV +LL GY+ +N N TR+P+Y+ H PAGTS+KN+ HY Q   +++FQ FDYG V N   Y Q TPPKY L    +P A+F GGNDW+AV++DV+R I ++   V      PEYNH+DF+WG +A   +YP+V+  L +Y
Sbjct:   36 SLSKDPEILENATQIIRNYGFHVEEHYVKTADGYILCLIRM---RNPNIELNKKVVFLQHGLLDSAHTWINNLRNQSLAFILADAGFDVWLGNSRGSTYSRKHEKYDTHHIEFWEFSWDQMAQFDLPASVYHVLQVTGSNTLGYVGHSQGAQIALAQFNRDPELQSHISLFVALAPVAYLGHIASPIRYIAPFARTVERVWDLFGHGEFLPSTRLLHFLAYFLCGRGHIPFVCTNVVYLLAGYDAKNTNLTRLPVYIAHTPAGTSAKNMVHYCQGITTDQFQAFDYGKVKNLEIYGQKTPPKYDLSKFTVPTAVFTGGNDWLAVEKDVDRLIEQIKPAVVSHINFPEYNHLDFVWGMDAAMVLYPEVLKLLKQY 406          
BLAST of Lipase vs. TrEMBL
Match: C3V6K8 (Lipase OS=Clonorchis sinensis OX=79923 PE=2 SV=1)

HSP 1 Score: 380.178 bits (975), Expect = 4.315e-125
Identity = 182/370 (49.19%), Postives = 249/370 (67.30%), Query Frame = 2
Query:  329 DPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTSSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFLLKY 1438
            DPE+  +  ++I+ YG+ +E H V T DGYIL + R+   R  +  + K VVFLQHGLLDS+ TW+NN   +SLAFILAD GFDVWLGNSRG+TYSRKH K+      FW+F+WD+MAQFDLPAS+ + L VS ++ +GY+GHSQG +I  A+F++  +L S +S FVALAPV YLGN+ + I+YIA        +      GEFL + +L++ ++ F+CG       C NV +LL GY+  N N TR+P+Y+ H PAGTS+KN+ HY Q   +++FQ FDYG V N   Y Q TPPKY L    +P A+F GGNDW+AV++DV+R I ++   V      PEYNH+DF+WG +A   +YP+V+  L +Y
Sbjct:   40 DPEILENATQIIRNYGFHVEEHYVKTADGYILCLIRM---RNPNIELNKKVVFLQHGLLDSAHTWINNLRNQSLAFILADAGFDVWLGNSRGSTYSRKHEKYDTHHIEFWEFSWDQMAQFDLPASLYHVLQVSGSNTVGYVGHSQGAQIALAQFNRDPELQSHISLFVALAPVAYLGNIASPIRYIAPFARTVERVWDLFGHGEFLSSTRLLHFLAYFLCGRGHIPFVCTNVVYLLAGYDARNTNLTRLPVYIAHTPAGTSAKNMVHYCQGISTDQFQAFDYGKVKNLEIYGQKTPPKYDLSKFTVPTAVFSGGNDWLAVEKDVDRLIDQIKPAVISHINFPEYNHLDFVWGMDAAIVLYPEVLRLLNQY 406          
BLAST of Lipase vs. TrEMBL
Match: A0A5J4P2H5 (Lipase OS=Paragonimus westermani OX=34504 GN=DEA37_0006749 PE=3 SV=1)

HSP 1 Score: 378.252 bits (970), Expect = 3.200e-124
Identity = 179/373 (47.99%), Postives = 248/373 (66.49%), Query Frame = 2
Query:  320 IETDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTSSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFLLKY 1438
            +  DPE+ ++  ++I  YGY +E H VTT+DGYIL + R+   R       + VV+LQHGLLDS+ TW+NN   +SLAFILAD GFDVWLGNSRG+TYSR H   +P    FW+F+WD+MAQFDLP+SI Y L V+ A K+GY+GHSQG +I  A+F +   L S++S F+A APV +LG+LK+ I+++A L      ++     GEFLP+ +L+  ++ F+C        C NV +L+ GY+ EN N TR+P+YV H PAGTS++NI HY QS  S++FQ+FDYG   N   Y Q TPP+Y L    +P  +F GG+DW+AVK+DV R +  + + V      P YNH+DF+WG +    +YP V+D+L KY
Sbjct:   49 LHIDPEIKLNATQIIMSYGYHVEEHFVTTDDGYILCLFRMRNPRFLDRNDLR-VVYLQHGLLDSAHTWINNLRNESLAFILADAGFDVWLGNSRGSTYSRNHIYLTPEQLKFWEFSWDQMAQFDLPSSIYYVLNVTGAQKIGYVGHSQGCQIALAQFDRDPQLQSRISVFIAFAPVAFLGHLKSPIRFVAPLAQTLEEVLELFNKGEFLPSNKLMQFLAYFLCRRGHVPFVCTNVIYLIAGYDYENTNTTRLPVYVAHTPAGTSTQNIVHYCQSITSDRFQQFDYGIKKNLQIYGQPTPPEYDLSNITVPTVVFSGGHDWLAVKKDVLRLMDRIEKAVVSYTHFPYYNHLDFVWGMDTGYVLYPAVLDWLSKY 420          
BLAST of Lipase vs. TrEMBL
Match: C3ZXQ3 (Lipase OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_131171 PE=3 SV=1)

HSP 1 Score: 363.229 bits (931), Expect = 2.817e-118
Identity = 188/399 (47.12%), Postives = 254/399 (63.66%), Query Frame = 2
Query:  263 IRVPCLLIVSINGGLLSPGIE------TDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGR-TSSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFV-INKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFLLK 1435
            + V  +  V +     SP I+       DPEV M+  ++I   GYP E + V T+DG++L +QRIPYGR  +S   ++P +FLQHGLL +S  W+ N   +SLAFILAD GFDVWLGN RGNTYSRKH K++P    FWDF+WDEMA++DLPA + +AL  +    L Y+GHSQGT I FA  SQ  +   KV  F ALAPVV LG++ + IKY+A   D  + + R     EFLPN   ++ ++ F+C D+     C N+ FLL G++   LN TR+P+Y +H PAGTS+KN+ H+AQ   SNKFQ +DYG    NK +YNQ T P YP++    PVA+F+GGNDW+A   DV  AI  L +NV     I  ++H+DFIWG +A T++Y  +I  + K
Sbjct:    9 LHVLVIFSVILTASCFSPPIKRLWSLGEDPEVHMNATQLITSKGYPCEDYTVKTDDGFLLGVQRIPYGRNATSHKDQRPAIFLQHGLLSASTDWILNLANESLAFILADAGFDVWLGNMRGNTYSRKHVKYTPDDDEFWDFSWDEMAKYDLPAMVTFALNKTGQSSLYYVGHSQGTAIAFAHLSQDQEFAKKVKTFFALAPVVTLGHITSPIKYLAQFDDIISAMFRIFGVDEFLPNSWWLDWLASFLC-DKSTEKYCENMLFLLVGFDPVQLNETRLPVYFSHTPAGTSTKNMVHFAQMVNSNKFQAYDYGNPDDNKQQYNQPTAPVYPIENMTTPVALFWGGNDWLADPTDVQAAIPHL-KNVVYNSEIKNFDHMDFIWGKDA-TKLYDQIIKIIRK 404          
BLAST of Lipase vs. TrEMBL
Match: A0A3Q0KCA5 (Lipase OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 362.844 bits (930), Expect = 2.879e-118
Identity = 168/368 (45.65%), Postives = 239/368 (64.95%), Query Frame = 2
Query:  326 TDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTSSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFL 1429
             DPEV  ++ E+I   GY  E H VTTEDG+IL + RI      + G +K VVFLQHGLLDS+ TWVNN PE+SL FILAD  +DVWLGNSRG+TYS  H    P  K FW+F+WDEM ++DLPA++ Y L  + A+KL YIGHSQG +I  A F +   + S +  F+ALAP  YLG++K+ I+YIA        ++     GEFLP+ +++  ++ F+C        C N+ +LL GY+ +N N +R+PIYV H PAGTS +N+ HY Q  ++++FQK+DYG + N   YNQ  PP Y +    LP+ ++YGG DW+A   D+++ I ++   ++   + P+YNH+DF+WG NA   +YP +++ L
Sbjct:   42 VDPEVYQNITEIISSKGYKFEEHYVTTEDGFILCIIRILPKCNEASGRQK-VVFLQHGLLDSAHTWVNNLPEESLGFILADNCYDVWLGNSRGSTYSSNHQYLRPDDKEFWEFSWDEMGKYDLPATLMYVLNHTDAEKLSYIGHSQGCQIALACFDEHPIIQSFIDLFIALAPAAYLGSIKSPIRYIAPFVKTVEPVVEWFGNGEFLPSGKIMQFLALFLCKPHRIPFVCSNIMYLLAGYDSKNTNVSRLPIYVAHTPAGTSVQNMVHYCQGIVTDRFQKYDYGLIKNLQIYNQSYPPLYNISHLKLPIIIYYGGQDWLASYRDIHKLIKQINYTIRSTHYFPDYNHLDFVWGLNAAKLLYPLILEQL 408          
BLAST of Lipase vs. Ensembl Cavefish
Match: lipf (lysosomal acid lipase/cholesteryl ester hydrolase-like [Source:NCBI gene;Acc:103040858])

HSP 1 Score: 321.627 bits (823), Expect = 8.180e-106
Identity = 161/369 (43.63%), Postives = 229/369 (62.06%), Query Frame = 2
Query:  329 DPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYG--RTSSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFL 1429
            DPEV M+++E+I+Y+GYP E ++V TEDGYIL++ RIPYG     S    +PVVFLQHGLL +   WV N P  SL F+LAD GFDVWLGNSRGNT+SRKH   SP    +W+F+ DEMA  DLPA IN+    +  +K+ Y+GHSQGT I F  FS    L SK+  F ALAPV  +    + +  ++ L +A  +I       +F P  +L+   +   C  +  S+ CGN+ FLL G++  NLN TR P+Y TH PAGTS +N+AH++Q+  + K   +DYG   N   YNQ TPP+Y +    +P A++ GG+D +A  +DV   + ++  N+   + I  + H+DFIWG +A   ++ ++I  +
Sbjct:   27 DPEVNMNISEIIRYWGYPAEEYEVVTEDGYILSINRIPYGVKNKDSQAAPRPVVFLQHGLLAAGSNWVTNLPNTSLGFVLADAGFDVWLGNSRGNTWSRKHVSLSPDQNEYWEFSHDEMANKDLPAVINFITKTTAEEKIFYVGHSQGTTIAFMAFSTMPLLASKIKMFFALAPVATVAFTSSPMGKLSVLPEA--LIWDLFGRKDFFPQNELIKFFATEFCTKKPISVLCGNIFFLLCGFDERNLNMTRTPVYTTHCPAGTSVQNMAHWSQAVKTGKLMAYDYGKAGNMAHYNQSTPPQYHVQDMTVPTAVWSGGHDTLADPQDVAVLLTQI-PNLMYHRHIEHWEHLDFIWGLDAPQEMFGEMIKLM 392          
BLAST of Lipase vs. Ensembl Cavefish
Match: lipf (lysosomal acid lipase/cholesteryl ester hydrolase-like [Source:NCBI gene;Acc:103023710])

HSP 1 Score: 292.352 bits (747), Expect = 1.787e-94
Identity = 148/371 (39.89%), Postives = 220/371 (59.30%), Query Frame = 2
Query:  323 ETDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYG--RTSSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFL 1429
              DPE+ M+++E+I+Y+GYP E ++V TEDGYIL++ RIP+G     S    KPVVFLQHGLL ++  WV N P  SL ++LAD GFDVWLGNSRGNT+SRKH   S     +W F+ DE+A+ DLPA IN+    +  +K+ Y+GHSQGT I F  FS   +L SK+  F  LAPV  +    + I  +  L +   +I        F P   L+   +   C     +  C N+ F + G+  +NLN TR+P+Y++H PAGTS +N+ H++Q+  S K   +D+G   N + Y ++TP +Y +    +P A++ GG D +A   DV   + ++   V+  + I  + H+DFIWG +A   +Y ++I  +
Sbjct:   25 RVDPEIHMNISEIIRYWGYPAEEYEVVTEDGYILSINRIPHGIKNQDSRADPKPVVFLQHGLLAAASNWVTNLPNTSLGYLLADAGFDVWLGNSRGNTWSRKHVSLSRDQNEYWRFSRDELAKKDLPAVINFITRTTGQEKIFYVGHSQGTTIAFMAFSTMPELASKIKMFFGLAPVATIAFTTSPITKLRILPE--KLIWGLFGKKYFFPQSSLIKFFATKFCSKNPFNAFCRNIFFRIHGFERKNLNMTRVPVYISHTPAGTSVRNMVHWSQALKSGKLMAYDFGKAGNLVHYKKLTPYQYNVKDMTVPTALWSGGRDILADPLDVAMLLPQISNLVQHRR-IEHWGHMDFIWGLDAPQTLYNEIIKMM 392          
BLAST of Lipase vs. Ensembl Sea Lamprey
Match: lipf (lipase, gastric [Source:ZFIN;Acc:ZDB-GENE-040426-2737])

HSP 1 Score: 301.982 bits (772), Expect = 1.215e-98
Identity = 159/415 (38.31%), Postives = 245/415 (59.04%), Query Frame = 2
Query:  221 LSYV*IREINTVAYIRVPCLLI-VSINGGLLSPG----IETDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYG-RTSSPGIK-KPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTV-TTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFV-INKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFLLKY 1438
            L +V IR +  +  + V  LL  V    G + P     + +DPE+ M+++E+I   GYP   ++V T DG+IL++ RIP G + ++ G   +P V LQHGLL     WV+N    SL FILAD G+DVW+GNSRGNT+S  H   +P  + FW +++DEMA  DLPA +++ L  +K ++L Y+GHSQGT    A FS    L  K+  F+ LA VV   N+  +   +A L D  + ++  +    EFLP   ++  +S  VC   +    C NV F++ G+N +N+N +R+P+Y +H PAGTS +N+ H+ Q+  S +FQ +DYG + +N   YNQ TPP Y +    +P A++ GG DW+A   D    + ++  N+   K + ++ H+DFIWG +A  R++PD++  + KY
Sbjct:    1 LCFVLIRNMVLIVALHVTLLLFGVGFVSGRMLPDQHNDLRSDPEIYMNISELISSKGYPNVEYKVETADGFILSVNRIPRGLKDNTAGTAVRPAVLLQHGLLAGGSNWVSNFAHDSLGFILADAGYDVWIGNSRGNTWSHHHRTLTPDQEEFWAWSYDEMASLDLPAVVDFILNETKQERLFYVGHSQGTTTALAAFSSNPKLAKKIKLFIGLAAVV---NVHHSTSPMAKLADVPDWLIEAIFGKKEFLPQNDILKWLSAEVCDKAIIKDLCENVFFVICGFNEKNMNVSRVPVYTSHCPAGTSIQNMLHWRQAARSGRFQAYDYGSLWLNMKHYNQATPPAYNISAMTVPTALWSGGQDWLADPTDTAALLAKI-PNLVQHKVLKDWEHLDFIWGMDAPKRLFPDMLKLMEKY 411          
BLAST of Lipase vs. Ensembl Sea Lamprey
Match: lipf (lipase, gastric [Source:ZFIN;Acc:ZDB-GENE-040426-2737])

HSP 1 Score: 197.208 bits (500), Expect = 5.498e-60
Identity = 110/290 (37.93%), Postives = 168/290 (57.93%), Query Frame = 2
Query:  275 CLLIVSINGGLLSP--GIETDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTSSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQ 1138
            C ++VS+   LL     + +DPE+ M+++E+I   GYP   ++V T DG+IL++ RIP G   S    +P V LQHGLL     WV+N    SL FILAD G+DVW+GNSRGNT S  H   +P  + FW ++       DLPA +++ L  ++ ++L Y GHSQ T I  A FS    L  K+  F+ LA VV   N+  +   +A L D  + +M+      FLP+  ++  +S  +   ++    C +V F++ G+N +N+N +R+P+Y +H PAGTS +N+ H+ Q
Sbjct:    2 CNILVSVILCLLQVHNDLRSDPEMYMNISELISSKGYPNVEYKVETADGFILSVNRIPRGLKHSTAAVRPAVLLQHGLLAGGSNWVSNFAHDSLGFILADAGYDVWIGNSRGNT-SHHHRALTPDQEEFWAWS-----SLDLPAVVDFILNETE-ERLFYAGHSQRTTIALAAFSSNPKLAKKIKLFIGLAAVV---NVHHSTSPMAKLADVPDWLMK------FLPHNDILKWLSAEISDKEIIEDLCEHVFFVICGFNEKNMNVSRVPVYASHCPAGTSIQNMLHWRQ 275          
BLAST of Lipase vs. Ensembl Yeast
Match: TGL1 (Steryl ester hydrolase; one of three gene products (Yeh1p, Yeh2p, Tgl1p) responsible for steryl ester hydrolase activity and involved in sterol homeostasis; localized to lipid particle membranes [Source:SGD;Acc:S000001623])

HSP 1 Score: 167.933 bits (424), Expect = 1.727e-46
Identity = 127/378 (33.60%), Postives = 184/378 (48.68%), Query Frame = 2
Query:  350 VNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTSSPGIKKPVVFLQHGLLDSSFTWVNN-GPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAI-KYIAGLGDAF-------NVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKLKYNQITPP----KYPLDTH-GLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFLLKYN 1441
            ++E+   +   +E H V TED YILT+ RIP    S       VV+L HGLL  S  W  N    K+L F+L D G+DVW+GN+RGN YS  H    P S  FWDF+ DE A FD+P SI + L ++K DK+  IG SQG+   FA FS    LN KVS F+A+AP +    L   I   +A     F        +++ +    +   +  L N     +C D         + F  + +N+  L   ++  Y   + + TS K+I H+ Q   S KFQ F+     N L  N +T P     +P  T+  +P+ + YGG D +    D++     L  N      +  Y H+D IWG +A T +   V+ F+  +N
Sbjct:   66 IHEMCAIFDISVEDHLVRTEDNYILTLHRIP--PISKNRFNNKVVYLHHGLLMCSDVWCCNIERHKNLPFVLHDLGYDVWMGNNRGNKYSTAHLNKPPKSNKFWDFSIDEFAFFDIPNSIEFILDITKVDKVICIGFSQGSAQMFAAFSLSEKLNRKVSHFIAIAPAMTPKGLHNRIVDTLAKSSPGFMYLFFGRKIVLPSAVIWQRTLHPTLFN-----LCID-----IANKILFNWKSFNI--LPRQKIASYAK-LYSTTSVKSIVHWFQILRSQKFQMFEES--DNML--NSLTRPYQIANFPTRTNIKIPILLIYGGIDSLV---DIDVMKKNLPFNSVFDVKVDNYEHLDLIWGKDADTLVIAKVLRFIEFFN 421          
BLAST of Lipase vs. Ensembl Yeast
Match: YEH1 (Steryl ester hydrolase; one of three gene products (Yeh1p, Yeh2p, Tgl1p) responsible for steryl ester hydrolase activity and involved in sterol homeostasis; localized to lipid particle membranes; YEH1 has a paralog, YEH2, that arose from the whole genome duplication [Source:SGD;Acc:S000003935])

HSP 1 Score: 108.997 bits (271), Expect = 7.166e-26
Identity = 105/392 (26.79%), Postives = 166/392 (42.35%), Query Frame = 2
Query:  287 VSINGGLLSPGIETDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTM-QRIP-YGRTSSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFA------KF------SQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAM---SKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKLKYNQITPPKYPLDTHGLP-VAMFYGGNDWMAVKEDVNRAIGELGQNVKL-IKFIPEYNHIDFIWGANAYTRI 1405
            V  +  L +  +  D  +  D+N     Y   +E  ++ TEDG+++ +   IP Y  T S   K+P + + HGLL SS ++ +NG  KSLA+ L   G+D+WLGN+R       +    P     WD+   EM ++DL   I+  L  ++ +KL  I HSQGT  GF       KF      S+ S   SK++ ++ALAP VY G L     ++        ++ + +    F         M        G+ + S  C  +   L  +N    +      +    P   S K      Q  LS    K  + F  +K+  + +   K+  D    P + +F    D +   E +      +  NV   I +I EY HID +W  +   RI
Sbjct:  157 VQCDNPLQNLILSEDLTLVADLNYYFNQYNIQIEEFRLETEDGFVIDLWHLIPKYRTTDSDKKKRPPILMLHGLLQSSGSFASNG-RKSLAYFLYQSGYDIWLGNNRCGFRPEWNEAKVPTLASRWDWDLREMVKYDLTLLIDTVLAKTQFEKLTLISHSQGTTQGFMGLVNEDKFFPPGSGSKESFFTSKIANYIALAPAVYPGPLLNEKLFV-------KLMTKEIENPWFFGETSFFEIMMIVRNLCVGESLFSFVCYTIFNYLFDWNDTLWDTALRDRHFLFSPVHVSVK----LMQWWLSPDPNKVSFKFGSHKMFPDNV---KWFSDASKAPNIYLFVPKQDRLVDGERLINHFVNVESNVNYKIWYIDEYAHIDVLWAHDVIERI 533          
BLAST of Lipase vs. Ensembl Yeast
Match: YEH2 (Steryl ester hydrolase; catalyzes steryl ester hydrolysis at the plasma membrane; involved in sterol metabolism; YEH2 has a paralog, YEH1, that arose from the whole genome duplication [Source:SGD;Acc:S000004010])

HSP 1 Score: 104.76 bits (260), Expect = 1.526e-24
Identity = 119/427 (27.87%), Postives = 182/427 (42.62%), Query Frame = 2
Query:  317 GIETDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTM----QRIPYGRTSSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSR------------GNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKF--------SQFSDLNSKVSAFVALAPVVYLGNL---KTAIKYIA-GLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYN-------VENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYG-----------FVI--------NKLKYNQITPPKYPLDTHGLP-VAMFYGGNDWMAVKED-VNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFL 1429
             +  D ++  D+    K YG  +E  +V T+DG+I+ +     R+  G      +K+  + L HGLL S   + ++G  KSLA+ L + GFDVWLGN+R            GN +S+K           WD+   +M Q+DL A INY L  +   KL  + HSQGT  GF           S F  L  K+  FVALAP VY G L   K  ++ +A G+   +    R+     F+P   L+  M K + G ++ S     +   L  +N       + + N+   P+++        S  +  +  S L NK   F  G           F I        N L  N++       ++   P + MF    D +   E  +N  I      V  I +I EY+H+D +W  +   RI   +I+ L
Sbjct:  139 ALAEDTKLVPDLKYYYKEYGIDIEEFEVETDDGFIIDLWHFKSRLNDGVEE---VKREPILLLHGLLQSCGAFASSG-RKSLAYFLYESGFDVWLGNNRCGLNAKWNMKKLGNDHSKK-----------WDWDMHQMVQYDLKALINYVLDSTGYAKLSLVAHSQGTTQGFMGLVNGEKLYASDFK-LVDKLENFVALAPAVYPGPLLDEKAFVRLMAKGIDSPWYFGRRS-----FIP---LMMTMRKLMVGTKIFSFLSYIMFNYLFDWNDVLWDRVLRDRNFLFSPVHI--------SVKLMQWWLSPLPNKLS-FKKGAEKIFPDKKTWFPIAKNDDDSGNNLDNNKLHLNPKRQNSEEFPHIIMFIPKQDRLVDGERLINHFINHEANAVYKIWYIDEYSHLDVLWAHDVIDRIGKPMIENL 532          
BLAST of Lipase vs. Ensembl Nematostella
Match: EDO35549 (Lipase [Source:UniProtKB/TrEMBL;Acc:A7SL62])

HSP 1 Score: 332.028 bits (850), Expect = 5.668e-110
Identity = 168/366 (45.90%), Postives = 233/366 (63.66%), Query Frame = 2
Query:  332 PEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRT-SSPGIK-KPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFV-INKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVI 1420
            PEV M+V ++I+Y GYP+E + VTTEDGYIL++QRIPYGR     G+K KPVVFLQHGLL S+  WV N   +S  FILAD+ FDVWLGN RGNTY ++H K    S  FWDF++DEMA++DLPA I++    +    L Y GHSQGT IGF  F+    +  KV AF ALAPV  + ++  A+KY+A L      + + +   +FLP   ++  ++  VC      + C +  FL+ G +   LN TR+PIY++H PAGTS KN+ H+AQ     KFQ +DYG    NK KYNQ TPP+Y +    +P A+++GG+D +A   DV   + +L   +   K++P ++H+DFIW  +A + +Y DVI
Sbjct:   45 PEVHMNVTQLIQYNGYPVEDYDVTTEDGYILSVQRIPYGREGKCKGVKDKPVVFLQHGLLCSATNWVTNLYNESFGFILADQCFDVWLGNVRGNTYGKRHVKLPVDSDAFWDFSFDEMAKYDLPAMIDFVTKTTGQASLYYAGHSQGTMIGFIAFAHNPAVIQKVKAFYALAPVSTVSHMGGALKYLAYLSPEIEFLFKVLGVRDFLPTDDVMRVLADLVCRPDYIRVVCSDFLFLIAGMDRSQLNETRLPIYISHTPAGTSVKNVVHFAQIFREKKFQMYDYGSAEKNKHKYNQDTPPQYNVSAVKVPSALYWGGHDVLADPTDVKDLLAKLPHQM-YNKYLPTWDHLDFIWALDAASLVYDDVI 409          
BLAST of Lipase vs. Ensembl Nematostella
Match: EDO29518 (Lipase [Source:UniProtKB/TrEMBL;Acc:A7T3E6])

HSP 1 Score: 328.946 bits (842), Expect = 4.457e-109
Identity = 167/366 (45.63%), Postives = 230/366 (62.84%), Query Frame = 2
Query:  332 PEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRT-SSPGIK-KPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFV-INKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVI 1420
            PE  M   ++I+Y GYP+E + VTTEDGYIL++QRIPYGR     G+K KPVVFLQHGLL S+  WV N   +S  FILAD+ FDVWLGN RGNTY ++H K    S  FWDF++DEMA++DLPA I++    +    L Y GHSQGT IGF  F+    +  KV AF ALAPV  + ++  A+KY+A L      + + +   +FLP   L+  ++  VC      + C +  FL+ G +   LN TR+PIY++H PAGTS KN+ H+AQ     KFQ +DYG    NK KYNQ TPP+Y +    +P A+++GG+D +A   DV   + +L   +   K++P ++H+DFIW  +A + +Y DVI
Sbjct:   17 PETNMIFTQLIQYNGYPVEDYDVTTEDGYILSVQRIPYGREGKCKGVKDKPVVFLQHGLLCSATNWVTNLYNESFGFILADQCFDVWLGNVRGNTYGKRHVKLPVDSDAFWDFSFDEMAKYDLPAMIDFVTKTTGQASLYYAGHSQGTMIGFIAFAHNPAVIQKVKAFYALAPVSTVSHMGGALKYLAYLSPEIEFLFKVLGVRDFLPTDDLMRVLADLVCRPDYIRVVCSDFLFLIAGMDRSQLNETRLPIYISHTPAGTSVKNVVHFAQIFREKKFQMYDYGSAEKNKHKYNQDTPPQYNVSAVKVPSALYWGGHDVLADPTDVKDLLAKLPHQM-YNKYLPTWDHLDFIWALDAASLVYDDVI 381          
BLAST of Lipase vs. Ensembl Nematostella
Match: EDO41646 (Lipase [Source:UniProtKB/TrEMBL;Acc:A7S3Q1])

HSP 1 Score: 323.168 bits (827), Expect = 4.687e-107
Identity = 161/374 (43.05%), Postives = 234/374 (62.57%), Query Frame = 2
Query:  323 ETDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTSSPG--IKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLI-KFIPEYNHIDFIWGANAYTRIYPDVIDFLLK 1435
              DPE+ M+V+++I+Y+GYP+E + V T+DGYI+++QRIP+G+         KPV+F+QHGLL SS  WV N P +SLAFILAD  FDVWLGN RGN Y  +H   S  S  FWDF+WDE +++DL A I+ AL VS    L Y GHSQGT + FA+ S   DL SK+ A  AL PV  +G++++ IKY+A        + +     +FLPN +++  ++   C        C +V F+L G++   LN TR+P+Y++H PAGTS KN+ HYAQ + S KF+ +DYG   N  +Y Q TPP+Y +    +P  +++GGNDW+A  +DV+  +  L     +  K +  + H+DFIWG +A   +Y D++  + K
Sbjct:    3 REDPEINMNVSQMIQYHGYPVENYDVITKDGYIISIQRIPFGQNGKCKDVPNKPVIFVQHGLLCSSTNWVANLPNESLAFILADNCFDVWLGNVRGNIYGMRHVNVSIHSDAFWDFSWDEFSKYDLTAMIDKALKVSNVSSLYYAGHSQGTMMMFAESSCNKDLASKIKAHFALGPVTTIGHIESPIKYLANFVPEVEDLFKIFGIHDFLPNNEIMRILAVLFCEPLGIRDVCSDVIFILDGFDQSQLNMTRLPVYISHTPAGTSVKNMIHYAQMYKSKKFEMYDYG-KDNIKRYGQNTPPQYNISAITVPTMLYWGGNDWLADPDDVSLLMKALPPKTLIDNKELKAWQHLDFIWGLDAAELVYDDIVTRIKK 375          
BLAST of Lipase vs. Ensembl Nematostella
Match: EDO40744 (Lipase [Source:UniProtKB/TrEMBL;Acc:A7S6G4])

HSP 1 Score: 289.271 bits (739), Expect = 3.489e-93
Identity = 157/375 (41.87%), Postives = 220/375 (58.67%), Query Frame = 2
Query:  329 DPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTS--SPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKF-VCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELG---QNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFLLK 1435
            DP++  + +++I+  GYP+E H VTT DG+IL +QRIP+GR        +KPVVFLQHGLL  S  WV N P  SL +ILAD+GFDVWLGN RGN YS  H K++  S  FWD+TW +MAQ+DLPA I+Y    +   ++ Y+GHSQGT IGF  FS   +L  K+  F ALAPV  + ++   IK  A        I +   + EF+P+ +L   MS   VC        C      L G++  NLN +R+P+ ++H  +GTS KN+ H+ Q   S K QK++YG+  N +KY QI PP Y +    +P  +F G +D +A   DV    GEL    QN+   + IP +NH DF++G +A   +Y  ++  + K
Sbjct:   31 DPDIDRNASQLIRNRGYPVEEHYVTTSDGFILNLQRIPHGRNELREGSGRKPVVFLQHGLLMDSTNWVLNSPHDSLGYILADKGFDVWLGNIRGNEYSAAHVKWNKDSSKFWDWTWQQMAQYDLPAMIDYVTLATSQSQVFYVGHSQGTLIGFTGFSANQELAKKIKMFFALAPVYTVAHVSEFIKASAYALFPVTHIFQNHVSEEFVPS-KLTKMMSDAGVCSRAKSEELCYKTGETLFGFDSSNLNMSRVPVIMSHWGSGTSFKNMVHFGQMVTSGKCQKYNYGYFYNWMKYGQIDPPHYRVKDMDVPTVLFSGSHDTLADPLDV----GELKPRIQNLVHSEEIPGWNHADFLFGMDAERLLYRKIVKMMFK 400          
BLAST of Lipase vs. Ensembl Nematostella
Match: EDO38398 (Lipase [Source:UniProtKB/TrEMBL;Acc:A7SCY7])

HSP 1 Score: 279.256 bits (713), Expect = 1.321e-89
Identity = 152/385 (39.48%), Postives = 230/385 (59.74%), Query Frame = 2
Query:  275 CLLIVSING---GLLSPGIE-----TDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRT--SSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKF-VCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAY 1396
            CLL+V +      LL+ G        DP+V  +V+++I   G+P+E H V T+DGYIL++QRIP+GR    SPG  +PVVFLQHGLL  S  +V +    SL +ILAD G+DVWLGN RGN YSR H K++   + FWDF+++E  ++D+PA I +AL+VS   +L YIGHSQGT +GF  FS   ++  KV  F+ALAP+ +L +  T ++  A        ++  +   +F P   L+  ++K   CG +  +  C +++ L+ G++  N N +R+P++ TH P+GTS KNI H+ Q     +  +FDYG   N  +Y +  PP Y +    +P A+  G +D ++   DV     ++  +V   + IPE+NHIDF+ G +AY
Sbjct:    6 CLLVVLLGNQLCCLLAKGTRPKWGPVDPDVNRNVSQLIHNRGFPVEEHDVITKDGYILSVQRIPHGRKGRESPG-PRPVVFLQHGLLADSSCFVQSWEYDSLGYILADNGYDVWLGNIRGNRYSRSHVKYNHKQREFWDFSFEEFGEYDIPAMIEHALSVSGQSQLYYIGHSQGTLVGFISFSTHPEIAKKVKRFIALAPIFHLNHTATIVRDAAFTLGPIQELLFPLGPTQFFPGY-LIKLLTKLGFCGGKYKAKLCYDISELIFGFDDGNANMSRVPVFFTHFPSGTSFKNIIHFGQIVYYGRTARFDYGKRRNMKRYGKPKPPVYDVTKMDVPTALILGTHDNLSTVPDVAPIRAQI-PHVTFYEVIPEWNHIDFVAGIDAY 387          
BLAST of Lipase vs. Ensembl Medaka
Match: lipf (lysosomal acid lipase/cholesteryl ester hydrolase-like [Source:NCBI gene;Acc:101156001])

HSP 1 Score: 333.183 bits (853), Expect = 3.257e-110
Identity = 165/372 (44.35%), Postives = 235/372 (63.17%), Query Frame = 2
Query:  329 DPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYG--RTSSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFLLKY 1438
            DPEV M+++E+I+ +GYP E H+V TEDGYIL++ RIP G  RT+ P   KP V LQHGLL +   WV N P  SL F+LAD G+DVW+GNSRGNT+S++H   +P  + FW F++DEMA  DLPA IN+ L V+  D++ YIGHSQGT I F  FS   +L SKV  F  LAPV  +    + +  ++ L DA  +I       +FLP    +  M++ +CG ++ S  CGN+ F+L G++ +NLN TR P+Y TH PAGTS +N+ H+AQ+    K   FD+G   N   YNQ TPP+Y +    +P A+F GG D +A  +DV   + ++  N+   + I  + H+DFIWG +A  +++P ++  L K+
Sbjct:   37 DPEVNMNISEIIRRWGYPAEEHEVVTEDGYILSVNRIPSGLKRTAGP---KPAVLLQHGLLAAGSNWVTNPPSSSLGFVLADAGYDVWIGNSRGNTWSKRHRTLTPDQEDFWKFSYDEMALKDLPAVINHVLNVTAQDQIFYIGHSQGTTIAFMAFSALPELASKVKLFFGLAPVATVAFTNSPMTKLSVLPDA--LIWDLFGKRDFLPQSDYIKWMAEHICGKRLLSELCGNIFFVLCGFDEKNLNMTRTPVYTTHCPAGTSVQNMVHWAQAVHGGKLMGFDFGPAGNMKHYNQSTPPEYHVKDMKVPTALFSGGQDTLADPKDVAVLLTQVS-NLVYHQHIQHWEHLDFIWGLDAPEQMFPSILKLLQKH 402          
BLAST of Lipase vs. Ensembl Medaka
Match: lipf (lysosomal acid lipase/cholesteryl ester hydrolase-like [Source:NCBI gene;Acc:101156001])

HSP 1 Score: 321.627 bits (823), Expect = 7.237e-106
Identity = 162/371 (43.67%), Postives = 231/371 (62.26%), Query Frame = 2
Query:  332 PEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYG--RTSSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFLLKY 1438
            P V +  +E+I+ +GYP E H+V TEDGYIL++ RIP G  RT+ P   KP V LQHGLL +   WV N P  SL F+LAD G+DVW+GNSRGNT+S++H   +P  + FW F++DEMA  DLPA IN+ L V+  D++ YIGHSQGT I F  FS   +L SKV  F  LAPV  +    + +  ++ L DA  +I       +FLP    +  M++ +CG ++ S  CGN+ F+L G++ +NLN TR P+Y TH PAGTS +N+ H+AQ+    K   FD+G   N   YNQ TPP+Y +    +P A+F GG D +A  +DV   + ++  N+   + I  + H+DFIWG +A  +++P ++  L K+
Sbjct:   27 PCVCVVQSEIIRRWGYPAEEHEVVTEDGYILSVNRIPSGLKRTAGP---KPAVLLQHGLLAAGSNWVTNPPSSSLGFVLADAGYDVWIGNSRGNTWSKRHRTLTPDQEDFWKFSYDEMALKDLPAVINHVLNVTAQDQIFYIGHSQGTTIAFMAFSALPELASKVKLFFGLAPVATVAFTNSPMTKLSVLPDA--LIWDLFGKRDFLPQSDYIKWMAEHICGKRLLSELCGNIFFVLCGFDEKNLNMTRTPVYTTHCPAGTSVQNMVHWAQAVHGGKLMGFDFGPAGNMKHYNQSTPPEYHVKDMKVPTALFSGGQDTLADPKDVAVLLTQVS-NLVYHQHIQHWEHLDFIWGLDAPEQMFPSILKLLQKH 391          
BLAST of Lipase vs. Ensembl Medaka
Match: lipf (lysosomal acid lipase/cholesteryl ester hydrolase-like [Source:NCBI gene;Acc:101156001])

HSP 1 Score: 319.316 bits (817), Expect = 2.323e-105
Identity = 160/363 (44.08%), Postives = 227/363 (62.53%), Query Frame = 2
Query:  356 EVIKYYGYPLETHQVTTEDGYILTMQRIPYG--RTSSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFLLKY 1438
            E+I+ +GYP E H+V TEDGYIL++ RIP G  RT+ P   KP V LQHGLL +   WV N P  SL F+LAD G+DVW+GNSRGNT+S++H   +P  + FW F++DEMA  DLPA IN+ L V+  D++ YIGHSQGT I F  FS   +L SKV  F  LAPV  +    + +  ++ L DA  +I       +FLP    +  M++ +CG ++ S  CGN+ F+L G++ +NLN TR P+Y TH PAGTS +N+ H+AQ+    K   FD+G   N   YNQ TPP+Y +    +P A+F GG D +A  +DV   + ++  N+   + I  + H+DFIWG +A  +++P ++  L K+
Sbjct:   10 EIIRRWGYPAEEHEVVTEDGYILSVNRIPSGLKRTAGP---KPAVLLQHGLLAAGSNWVTNPPSSSLGFVLADAGYDVWIGNSRGNTWSKRHRTLTPDQEDFWKFSYDEMALKDLPAVINHVLNVTAQDQIFYIGHSQGTTIAFMAFSALPELASKVKLFFGLAPVATVAFTNSPMTKLSVLPDA--LIWDLFGKRDFLPQSDYIKWMAEHICGKRLLSELCGNIFFVLCGFDEKNLNMTRTPVYTTHCPAGTSVQNMVHWAQAVHGGKLMGFDFGPAGNMKHYNQSTPPEYHVKDMKVPTALFSGGQDTLADPKDVAVLLTQVS-NLVYHQHIQHWEHLDFIWGLDAPEQMFPSILKLLQKH 366          
BLAST of Lipase vs. Planmine SMEST
Match: SMESG000074187.1 (SMESG000074187.1)

HSP 1 Score: 803.127 bits (2073), Expect = 0.000e+0
Identity = 386/400 (96.50%), Postives = 392/400 (98.00%), Query Frame = 2
Query:  245 INTVAYIRVPCLLIVSINGGLLSPGIETDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTSSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFLLKYNN 1444
            +N +    VPCLLIVSINGGLLSPGIETDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTSSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSL CGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTS+KNIAHYAQSHLSNKFQKFDYGF +NKLKYNQITPP+YPLDTHGLPVAMFYGGNDWMAVKEDV RAIGELGQNVKLIKFIPEYNHIDFIWGANAYT+IYPDVIDFLLKYNN
Sbjct:    1 MNNILLSIVPCLLIVSINGGLLSPGIETDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTSSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLGCGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSTKNIAHYAQSHLSNKFQKFDYGFFMNKLKYNQITPPQYPLDTHGLPVAMFYGGNDWMAVKEDVTRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTKIYPDVIDFLLKYNN 400          
BLAST of Lipase vs. Planmine SMEST
Match: SMESG000074186.1 (SMESG000074186.1)

HSP 1 Score: 509.99 bits (1312), Expect = 8.504e-180
Identity = 237/380 (62.37%), Postives = 292/380 (76.84%), Query Frame = 2
Query:  299 GGLLSPGIETDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTSSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFLLKY 1438
            G L  P    D E+ M+V E+I YY YP E H VTTEDGYIL++QRIP+G  ++    +PVVFLQHGL+DSSFTWV NGP+KSL F+LAD+GFDVWL N+RGN YS  H K++   + FWDFTWD+M ++DLPASINY LTV+KA KLGYIGHSQGTEI FAKFS+ SDLNSKV  FVALAPVVYLG+LKTAIKY+AGL    N++    T GEFLPN +L+  MS FVCGDQ  S+ CGN+ FLL G    N+N+TR+PIY++H+PA TS KNI HYAQSHL+N+FQ +DYGF  N ++Y Q  PPKY L+T+GLP+A  + G DW++  EDV+RA+ ELG NVK  KFIPEYNH+D IWG  A  +++PDV++FL KY
Sbjct:   17 GQLQPPPASQDSEIKMNVTEIILYYNYPCENHLVTTEDGYILSLQRIPFGLKNNSLQSRPVVFLQHGLVDSSFTWVANGPDKSLGFVLADKGFDVWLSNTRGNVYSNSHIKYTTSDRNFWDFTWDDMVKYDLPASINYVLTVTKAQKLGYIGHSQGTEIAFAKFSENSDLNSKVFGFVALAPVVYLGHLKTAIKYLAGLAGGLNLLANIFTNGEFLPNNELLTTMSTFVCGDQTISILCGNLMFLLYGPGTANMNFTRIPIYLSHVPARTSWKNIVHYAQSHLTNEFQMYDYGFFENLVRYKQAFPPKYRLNTNGLPIAAIWAGADWLSDPEDVSRALNELGDNVKFKKFIPEYNHVDVIWGTTADVKVFPDVVNFLYKY 396          
BLAST of Lipase vs. Planmine SMEST
Match: SMESG000007797.1 (SMESG000007797.1)

HSP 1 Score: 473.396 bits (1217), Expect = 2.565e-165
Identity = 222/379 (58.58%), Postives = 284/379 (74.93%), Query Frame = 2
Query:  308 LSPGIETDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTSSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFLLKYNN 1444
            LS   ETDPE+ M+V EVI  Y YP E H VTTEDGYIL+MQRIP+G   S   K+PVVFLQHGLLDSSFTWVNN P+KSLAFILAD GFDVWL NSRGN YS KH K+   S  FWDF+WDEMAQ+DL ASI Y L+V+K+DK+ YIGHSQGTEI FAK SQ S LNSK+++ VALAPV +LG++++ IKY A +    +++++    GEFLP+ + +  +  +VCGD+  +L CG+  FLL GY+  NLNYTR+PIY+ H PA TS+KN+ HYAQ++ SN+F+ +DYG   N   Y++I PPKY L+THG+P+A+F+GGNDW+A  +DV+ AI   G ++KL +FI  YNH+DF+WG NA   IYPD+I F+  Y N
Sbjct:   22 LSHKYETDPEIYMNVTEVINLYKYPCENHLVTTEDGYILSMQRIPFGIKMSSSSKRPVVFLQHGLLDSSFTWVNNAPDKSLAFILADNGFDVWLANSRGNVYSNKHIKYPTDSNKFWDFSWDEMAQYDLSASIEYVLSVTKSDKISYIGHSQGTEIMFAKLSQNSSLNSKINSVVALAPVAFLGHVQSGIKYFARIAGGLDILLKIFGHGEFLPSSRFMKDLISYVCGDKAPAL-CGDFLFLLTGYDTSNLNYTRLPIYLAHTPAETSAKNMVHYAQAYESNEFKMYDYGIFGNLYYYHEIHPPKYQLNTHGVPLAVFWGGNDWLADYDDVSAAIKIFGNDIKLNRFISYYNHLDFVWGVNAAQLIYPDIIKFINSYRN 399          
BLAST of Lipase vs. Planmine SMEST
Match: SMESG000007797.1 (SMESG000007797.1)

HSP 1 Score: 472.626 bits (1215), Expect = 3.602e-165
Identity = 222/379 (58.58%), Postives = 284/379 (74.93%), Query Frame = 2
Query:  308 LSPGIETDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTSSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFLLKYNN 1444
            LS   ETDPE+ M+V EVI  Y YP E H VTTEDGYIL+MQRIP+G   S   K+PVVFLQHGLLDSSFTWVNN P+KSLAFILAD GFDVWL NSRGN YS KH K+   S  FWDF+WDEMAQ+DL ASI Y L+V+K+DK+ YIGHSQGTEI FAK SQ S LNSK+++ VALAPV +LG++++ IKY A +    +++++    GEFLP+ + +  +  +VCGD+  +L CG+  FLL GY+  NLNYTR+PIY+ H PA TS+KN+ HYAQ++ SN+F+ +DYG   N   Y++I PPKY L+THG+P+A+F+GGNDW+A  +DV+ AI   G ++KL +FI  YNH+DF+WG NA   IYPD+I F+  Y N
Sbjct:   18 LSHKYETDPEIYMNVTEVINLYKYPCENHLVTTEDGYILSMQRIPFGIKMSSSSKRPVVFLQHGLLDSSFTWVNNAPDKSLAFILADNGFDVWLANSRGNVYSNKHIKYPTDSNKFWDFSWDEMAQYDLSASIEYVLSVTKSDKISYIGHSQGTEIMFAKLSQNSSLNSKINSVVALAPVAFLGHVQSGIKYFARIAGGLDILLKIFGHGEFLPSSRFMKDLISYVCGDKAPAL-CGDFLFLLTGYDTSNLNYTRLPIYLAHTPAETSAKNMVHYAQAYESNEFKMYDYGIFGNLYYYHEIHPPKYQLNTHGVPLAVFWGGNDWLADYDDVSAAIKIFGNDIKLNRFISYYNHLDFVWGVNAAQLIYPDIIKFINSYRN 395          
BLAST of Lipase vs. Planmine SMEST
Match: SMESG000074185.1 (SMESG000074185.1)

HSP 1 Score: 463.766 bits (1192), Expect = 1.458e-161
Identity = 209/374 (55.88%), Postives = 284/374 (75.94%), Query Frame = 2
Query:  323 ETDPEVTMDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTSSPGIKKPVVFLQHGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPFSKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFSQFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEFLPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTHIPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKLKYNQITPPKYPLDTHGLPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANAYTRIYPDVIDFLLKYNN 1444
            + DPE+ M+   +I+ YGYP+ETH+V TEDGY LT+ RIPYGRT+     + VV+LQHGLLDSSFTW+ N PEKSL FILAD GFDVWLGNSRGN YSR H K+S  S  +WDF+WDEMA+FDLPAS+++ L V+KA K+ YIGHSQGT I FAKFSQ+S+LN ++S+ VA APV YLGN+++ I+Y+A +    ++  +    GEFLP       ++ +VCG +  SL C N+ FLL G +  N+NYTR+P+Y++H PAGTSS+N+AH+AQ + SN+F+K+D+G + N   Y+QI+PP Y L+T+G+P+AMF+GGND++AV +DV+RAI E   +V+  KFIP YNH+DFIWG +A   +Y D IDF+LK+++
Sbjct:   28 KRDPEIFMNTTAIIRLYGYPVETHKVLTEDGYFLTLHRIPYGRTNMSAENRRVVYLQHGLLDSSFTWLCNLPEKSLGFILADYGFDVWLGNSRGNVYSRGHLKYSTTSNDYWDFSWDEMAEFDLPASLDHVLRVTKAKKISYIGHSQGTAIAFAKFSQYSNLNERISSIVAYAPVAYLGNIRSGIRYLAYVSGGIDLFYKLFRHGEFLPTTIFTKLLANYVCGMKSASLICSNMIFLLSGPDTSNMNYTRLPVYLSHNPAGTSSRNMAHFAQCYKSNEFKKYDHGLLGNLYHYHQISPPTYNLNTNGIPLAMFWGGNDYLAVPQDVSRAIHEFDHDVEFRKFIPSYNHMDFIWGLSAPEVVYKDTIDFILKHSS 401          
The following BLAST results are available for this feature:
BLAST of Lipase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LIPA2.599e-10844.08lipase A, lysosomal acid type [Source:HGNC Symbol;... [more]
LIPF2.331e-10042.30lipase F, gastric type [Source:HGNC Symbol;Acc:HGN... [more]
LIPF2.352e-10042.30lipase F, gastric type [Source:HGNC Symbol;Acc:HGN... [more]
LIPK7.270e-9941.28lipase family member K [Source:HGNC Symbol;Acc:HGN... [more]
LIPM1.611e-9740.63lipase family member M [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Lipase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lipl-15.401e-10045.03Lipase [Source:UniProtKB/TrEMBL;Acc:Q93789][more]
lipl-64.227e-9840.27LIPase Like [Source:UniProtKB/TrEMBL;Acc:E2S7J2][more]
lipl-26.387e-9539.80Lipase [Source:UniProtKB/TrEMBL;Acc:Q20449][more]
lipl-59.307e-9041.36Lipase [Source:UniProtKB/TrEMBL;Acc:O61866][more]
lipl-59.307e-9041.36Lipase [Source:UniProtKB/TrEMBL;Acc:O61866][more]
back to top
BLAST of Lipase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG318711.667e-9037.72gene:FBgn0051871 transcript:FBtr0080104[more]
Lip33.630e-8837.94gene:FBgn0023495 transcript:FBtr0082771[more]
Lip47.065e-8837.70gene:FBgn0032264 transcript:FBtr0080093[more]
Lip41.080e-8737.70gene:FBgn0032264 transcript:FBtr0331672[more]
CG80931.305e-8737.56gene:FBgn0033999 transcript:FBtr0339997[more]
back to top
BLAST of Lipase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lipf7.675e-10442.86lipase, gastric [Source:ZFIN;Acc:ZDB-GENE-040426-2... [more]
lipf7.675e-10442.86lipase, gastric [Source:ZFIN;Acc:ZDB-GENE-040426-2... [more]
back to top
BLAST of Lipase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lipa1.956e-10541.79lipase A, lysosomal acid, cholesterol esterase [So... [more]
lipa3.487e-10141.89lipase A, lysosomal acid, cholesterol esterase [So... [more]
lipa4.342e-10142.27lipase A, lysosomal acid, cholesterol esterase [So... [more]
lipa9.514e-10142.38lipase A, lysosomal acid, cholesterol esterase [So... [more]
lipa1.522e-10041.69lipase A, lysosomal acid, cholesterol esterase [So... [more]
back to top
BLAST of Lipase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lipa1.634e-10344.95lysosomal acid lipase A [Source:MGI Symbol;Acc:MGI... [more]
Lipa1.634e-10344.95lysosomal acid lipase A [Source:MGI Symbol;Acc:MGI... [more]
Lipm2.543e-10242.64lipase, family member M [Source:MGI Symbol;Acc:MGI... [more]
Lipf1.016e-9742.16lipase, gastric [Source:MGI Symbol;Acc:MGI:1914967... [more]
Lipk5.009e-9640.83lipase, family member K [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Lipase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P38571|LICH_HUMAN1.248e-10744.08Lysosomal acid lipase/cholesteryl ester hydrolase ... [more]
sp|Q4R4S5|LICH_MACFA2.997e-10744.19Lysosomal acid lipase/cholesteryl ester hydrolase ... [more]
sp|P80035|LIPG_CANLF2.601e-10343.34Gastric triacylglycerol lipase OS=Canis lupus fami... [more]
sp|Q9Z0M5|LICH_MOUSE1.143e-10244.95Lysosomal acid lipase/cholesteryl ester hydrolase ... [more]
sp|Q8K2A6|LIPM_MOUSE1.779e-10142.64Lipase member M OS=Mus musculus OX=10090 GN=Lipm P... [more]
back to top
BLAST of Lipase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4V3SDI77.762e-12748.66Lipase OS=Opisthorchis felineus OX=147828 GN=CRM22... [more]
C3V6K84.315e-12549.19Lipase OS=Clonorchis sinensis OX=79923 PE=2 SV=1[more]
A0A5J4P2H53.200e-12447.99Lipase OS=Paragonimus westermani OX=34504 GN=DEA37... [more]
C3ZXQ32.817e-11847.12Lipase OS=Branchiostoma floridae OX=7739 GN=BRAFLD... [more]
A0A3Q0KCA52.879e-11845.65Lipase OS=Schistosoma mansoni OX=6183 PE=3 SV=1[more]
back to top
BLAST of Lipase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lipf8.180e-10643.63lysosomal acid lipase/cholesteryl ester hydrolase-... [more]
lipf1.787e-9439.89lysosomal acid lipase/cholesteryl ester hydrolase-... [more]
back to top
BLAST of Lipase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lipf1.215e-9838.31lipase, gastric [Source:ZFIN;Acc:ZDB-GENE-040426-2... [more]
lipf5.498e-6037.93lipase, gastric [Source:ZFIN;Acc:ZDB-GENE-040426-2... [more]
back to top
BLAST of Lipase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
TGL11.727e-4633.60Steryl ester hydrolase; one of three gene products... [more]
YEH17.166e-2626.79Steryl ester hydrolase; one of three gene products... [more]
YEH21.526e-2427.87Steryl ester hydrolase; catalyzes steryl ester hyd... [more]
back to top
BLAST of Lipase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO355495.668e-11045.90Lipase [Source:UniProtKB/TrEMBL;Acc:A7SL62][more]
EDO295184.457e-10945.63Lipase [Source:UniProtKB/TrEMBL;Acc:A7T3E6][more]
EDO416464.687e-10743.05Lipase [Source:UniProtKB/TrEMBL;Acc:A7S3Q1][more]
EDO407443.489e-9341.87Lipase [Source:UniProtKB/TrEMBL;Acc:A7S6G4][more]
EDO383981.321e-8939.48Lipase [Source:UniProtKB/TrEMBL;Acc:A7SCY7][more]
back to top
BLAST of Lipase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
lipf3.257e-11044.35lysosomal acid lipase/cholesteryl ester hydrolase-... [more]
lipf7.237e-10643.67lysosomal acid lipase/cholesteryl ester hydrolase-... [more]
lipf2.323e-10544.08lysosomal acid lipase/cholesteryl ester hydrolase-... [more]
back to top
BLAST of Lipase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074187.10.000e+096.50SMESG000074187.1[more]
SMESG000074186.18.504e-18062.37SMESG000074186.1[more]
SMESG000007797.12.565e-16558.58SMESG000007797.1[more]
SMESG000007797.13.602e-16558.58SMESG000007797.1[more]
SMESG000074185.11.458e-16155.88SMESG000074185.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002911 ID=SMED30002911|Name=Lipase|organism=Schmidtea mediterranea sexual|type=transcript|length=1471bp
ATTAATAAAACAAACTAATACAAGATTACTTTCAATATTCTTAAATGGTT
AAGATAAAATGAAAATATTCATTATAAACTGAAACTATAAAAACTGTGTA
ATATTTATTATATTTTACTTGAAGTTACTACTTGTTTTAAAAAAAATGTT
TTTTAATCAGAAGGTCAAATGGAAGATATTTCCAGACCAAACATGTGATG
CCGCATATTTCAATTATCGGTTGTCATATGTTTGAATACGTGAAATAAAT
ACAGTTGCCTATATAAGAGTTCCTTGCCTATTGATTGTTTCAATTAATGG
CGGGCTACTTTCTCCTGGCATTGAAACGGATCCCGAGGTGACCATGGATG
TCAATGAAGTTATCAAATATTACGGATATCCGTTAGAGACTCACCAAGTA
ACTACAGAGGATGGATATATTCTTACCATGCAACGAATTCCGTATGGTCG
CACGAGTTCACCGGGAATAAAAAAACCGGTCGTATTTTTGCAACATGGAT
TGCTTGATTCTTCATTCACCTGGGTCAACAATGGTCCTGAAAAGAGTTTG
GCATTTATTTTGGCGGATCGTGGATTCGACGTGTGGCTAGGAAACAGTAG
AGGAAACACCTATTCACGAAAACACACAAAATTTTCACCGTTTTCGAAAT
TTTTCTGGGATTTCACTTGGGATGAAATGGCTCAATTTGATTTACCAGCT
TCGATCAATTATGCCCTCACCGTGTCGAAAGCCGATAAATTGGGATATAT
TGGACACTCACAAGGAACTGAAATCGGATTTGCTAAATTTTCACAGTTTT
CAGATCTTAATTCAAAGGTTTCTGCGTTTGTTGCTCTGGCTCCTGTAGTA
TATCTTGGAAACCTAAAAACTGCAATTAAATACATTGCTGGCCTTGGGGA
TGCTTTCAATGTAATTATGAGAACTGTGACAACGGGTGAATTTCTTCCGA
ACATTCAGTTGGTAAATGCAATGTCTAAATTCGTCTGTGGTGATCAAATG
GGATCCTTGGCTTGTGGAAACGTGGCATTTTTACTTCAAGGTTACAATGT
TGAAAACTTAAATTATACAAGGATGCCGATTTACGTGACACACATCCCAG
CTGGAACATCGTCAAAGAATATTGCTCATTATGCTCAAAGTCATTTGAGT
AATAAATTTCAAAAATTTGATTACGGATTTGTTATTAATAAATTGAAATA
CAATCAAATTACCCCTCCCAAATATCCTTTGGATACTCACGGGTTACCAG
TTGCAATGTTCTACGGTGGAAACGACTGGATGGCCGTCAAAGAGGATGTG
AACAGAGCGATTGGTGAACTGGGACAAAATGTAAAACTGATCAAATTTAT
TCCAGAATACAATCACATAGATTTCATCTGGGGGGCCAATGCTTACACCA
GGATCTATCCTGATGTGATTGACTTCCTATTGAAATATAATAATTAATTA
ACAATTCAAGCAATTTTTTAT
back to top

protein sequence of SMED30002911-orf-1

>SMED30002911-orf-1 ID=SMED30002911-orf-1|Name=SMED30002911-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=368bp
MDVNEVIKYYGYPLETHQVTTEDGYILTMQRIPYGRTSSPGIKKPVVFLQ
HGLLDSSFTWVNNGPEKSLAFILADRGFDVWLGNSRGNTYSRKHTKFSPF
SKFFWDFTWDEMAQFDLPASINYALTVSKADKLGYIGHSQGTEIGFAKFS
QFSDLNSKVSAFVALAPVVYLGNLKTAIKYIAGLGDAFNVIMRTVTTGEF
LPNIQLVNAMSKFVCGDQMGSLACGNVAFLLQGYNVENLNYTRMPIYVTH
IPAGTSSKNIAHYAQSHLSNKFQKFDYGFVINKLKYNQITPPKYPLDTHG
LPVAMFYGGNDWMAVKEDVNRAIGELGQNVKLIKFIPEYNHIDFIWGANA
YTRIYPDVIDFLLKYNN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000421tail
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR025483Lipase_euk
IPR006693AB_hydrolase_lipase
IPR029058AB_hydrolase
Vocabulary: molecular function
TermDefinition
GO:0016788hydrolase activity, acting on ester bonds
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0006629lipid metabolic process
GO:0016042lipid catabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR025483Lipase, eukaryoticPIRSFPIRSF000862Steryl_ester_lipcoord: 1..367
e-value: 1.7E-132
score: 439.7
IPR006693Partial AB-hydrolase lipase domainPFAMPF04083Abhydro_lipasecoord: 3..64
e-value: 1.2E-25
score: 88.9
IPR029058Alpha/Beta hydrolase foldGENE3DG3DSA:3.40.50.1820coord: 1..363
e-value: 9.2E-137
score: 457.9
IPR029058Alpha/Beta hydrolase foldSUPERFAMILYSSF53474alpha/beta-Hydrolasescoord: 1..362
NoneNo IPR availablePANTHERPTHR11005:SF100LIPASEcoord: 4..363
NoneNo IPR availablePANTHERPTHR11005LYSOSOMAL ACID LIPASE-RELATEDcoord: 4..363