Cyclin-dependent kinase 12

Overview
NameCyclin-dependent kinase 12
Smed IDSMED30002908
Length (bp)2808
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cyclin-dependent kinase 12 (SMED30002908) t-SNE clustered cells

Violin plots show distribution of expression levels for Cyclin-dependent kinase 12 (SMED30002908) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cyclin-dependent kinase 12 (SMED30002908) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cyclin-dependent kinase 12 (SMED30002908) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002908

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30002908h1SMcG0011030 dd_Smed_v4_4866_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002908h1SMcG0011030 dd_Smed_v4_4866_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002908h1SMcG0011030 dd_Smed_v4_4866_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002908h1SMcG0011030 dd_Smed_v4_4866_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002908h1SMcG0011030 dd_Smed_v4_4866_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30002908h1SMcG0011030 dd_Smed_v6_4866_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002908h1SMcG0011030 dd_Smed_v6_4866_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Human
Match: CDK12 (cyclin dependent kinase 12 [Source:HGNC Symbol;Acc:HGNC:24224])

HSP 1 Score: 479.174 bits (1232), Expect = 3.113e-151
Identity = 224/351 (63.82%), Postives = 273/351 (77.78%), Query Frame = 3
Query: 1026 KKPGICAKRSATRNNVT--WGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRK 2069
            K+P IC  R   R      WG+R V  F  I  +GEGTYG V+KA+D  TGEL ALKKVRL+NEKEGFPITAIREIKIL QL+H ++VN+ EIVTD  +ALDFKKDKGAFYLVF+YMDHDL G+LES  V  +++ + S  KQL+EG++YCH +NFLHRDIKCSNIL+NN G+IKLADFGLARLY +++  RPYTNKVITLWYRPPELLLGEE Y+PAID+WS GCILGELFT + +F A+ E+ Q+E IS++CG P    WP V +LP F + KP+  Y+RRLRE +  +PS ALDLLD ML LDP KRCTA Q L+SD+L++V+  K+ PPD P  +DCHEL SKKRR+
Sbjct:  699 KRPKICCPRYGERRQTESDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLIHRSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEES-RPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQYRRRLREEFSFIPSAALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVELSKMAPPDLPHWQDCHELWSKKRRR 1048          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Human
Match: CDK12 (cyclin dependent kinase 12 [Source:HGNC Symbol;Acc:HGNC:24224])

HSP 1 Score: 479.559 bits (1233), Expect = 5.958e-149
Identity = 224/351 (63.82%), Postives = 273/351 (77.78%), Query Frame = 3
Query: 1026 KKPGICAKRSATRNNVT--WGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRK 2069
            K+P IC  R   R      WG+R V  F  I  +GEGTYG V+KA+D  TGEL ALKKVRL+NEKEGFPITAIREIKIL QL+H ++VN+ EIVTD  +ALDFKKDKGAFYLVF+YMDHDL G+LES  V  +++ + S  KQL+EG++YCH +NFLHRDIKCSNIL+NN G+IKLADFGLARLY +++  RPYTNKVITLWYRPPELLLGEE Y+PAID+WS GCILGELFT + +F A+ E+ Q+E IS++CG P    WP V +LP F + KP+  Y+RRLRE +  +PS ALDLLD ML LDP KRCTA Q L+SD+L++V+  K+ PPD P  +DCHEL SKKRR+
Sbjct:  700 KRPKICCPRYGERRQTESDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLIHRSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEES-RPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQYRRRLREEFSFIPSAALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVELSKMAPPDLPHWQDCHELWSKKRRR 1049          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Human
Match: CDK12 (cyclin dependent kinase 12 [Source:HGNC Symbol;Acc:HGNC:24224])

HSP 1 Score: 478.789 bits (1231), Expect = 1.076e-148
Identity = 224/351 (63.82%), Postives = 273/351 (77.78%), Query Frame = 3
Query: 1026 KKPGICAKRSATRNNVT--WGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRK 2069
            K+P IC  R   R      WG+R V  F  I  +GEGTYG V+KA+D  TGEL ALKKVRL+NEKEGFPITAIREIKIL QL+H ++VN+ EIVTD  +ALDFKKDKGAFYLVF+YMDHDL G+LES  V  +++ + S  KQL+EG++YCH +NFLHRDIKCSNIL+NN G+IKLADFGLARLY +++  RPYTNKVITLWYRPPELLLGEE Y+PAID+WS GCILGELFT + +F A+ E+ Q+E IS++CG P    WP V +LP F + KP+  Y+RRLRE +  +PS ALDLLD ML LDP KRCTA Q L+SD+L++V+  K+ PPD P  +DCHEL SKKRR+
Sbjct:  700 KRPKICCPRYGERRQTESDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLIHRSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEES-RPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQYRRRLREEFSFIPSAALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVELSKMAPPDLPHWQDCHELWSKKRRR 1049          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Human
Match: CDK13 (cyclin dependent kinase 13 [Source:HGNC Symbol;Acc:HGNC:1733])

HSP 1 Score: 472.626 bits (1215), Expect = 1.224e-146
Identity = 219/351 (62.39%), Postives = 273/351 (77.78%), Query Frame = 3
Query: 1026 KKPGICAKR--SATRNNVTWGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSVITDE-QVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRK 2069
            ++P IC  R       ++ WG+R V  F  I  +GEGTYG V+KA D  TGE+ ALKKVRL+NEKEGFPITAIREIKIL QL H +I+N+ EIVTD ++ALDFKKDKGAFYLVF+YMDHDL G+LES  V  +E  + S  +QL+EG+ YCH +NFLHRDIKCSNIL+NNRG+IKLADFGLARLY + ++ RPYTNKVITLWYRPPELLLGEE Y+PAID+WS GCILGELFT + +F A++E+ Q+E IS++CG P    WP V +LP F + KP+  Y+R+LRE +  +P+ ALDL D+ML LDP KRCTA QAL+ ++LR+V+  K+ PPD P  +DCHEL SKKRR+
Sbjct:  678 RRPKICGPRYGETKEKDIDWGKRCVDKFDIIGIIGEGTYGQVYKARDKDTGEMVALKKVRLDNEKEGFPITAIREIKILRQLTHQSIINMKEIVTDKEDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFNENHIKSFMRQLMEGLDYCHKKNFLHRDIKCSNILLNNRGQIKLADFGLARLY-SSEESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANQELAQLELISRICGSPCPAVWPDVIKLPYFNTMKPKKQYRRKLREEFVFIPAAALDLFDYMLALDPSKRCTAEQALQCEFLRDVEPSKMPPPDLPLWQDCHELWSKKRRR 1027          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Human
Match: CDK13 (cyclin dependent kinase 13 [Source:HGNC Symbol;Acc:HGNC:1733])

HSP 1 Score: 473.396 bits (1217), Expect = 1.898e-146
Identity = 219/351 (62.39%), Postives = 273/351 (77.78%), Query Frame = 3
Query: 1026 KKPGICAKR--SATRNNVTWGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSVITDE-QVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRK 2069
            ++P IC  R       ++ WG+R V  F  I  +GEGTYG V+KA D  TGE+ ALKKVRL+NEKEGFPITAIREIKIL QL H +I+N+ EIVTD ++ALDFKKDKGAFYLVF+YMDHDL G+LES  V  +E  + S  +QL+EG+ YCH +NFLHRDIKCSNIL+NNRG+IKLADFGLARLY + ++ RPYTNKVITLWYRPPELLLGEE Y+PAID+WS GCILGELFT + +F A++E+ Q+E IS++CG P    WP V +LP F + KP+  Y+R+LRE +  +P+ ALDL D+ML LDP KRCTA QAL+ ++LR+V+  K+ PPD P  +DCHEL SKKRR+
Sbjct:  678 RRPKICGPRYGETKEKDIDWGKRCVDKFDIIGIIGEGTYGQVYKARDKDTGEMVALKKVRLDNEKEGFPITAIREIKILRQLTHQSIINMKEIVTDKEDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFNENHIKSFMRQLMEGLDYCHKKNFLHRDIKCSNILLNNRGQIKLADFGLARLY-SSEESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANQELAQLELISRICGSPCPAVWPDVIKLPYFNTMKPKKQYRRKLREEFVFIPAAALDLFDYMLALDPSKRCTAEQALQCEFLRDVEPSKMPPPDLPLWQDCHELWSKKRRR 1027          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Celegans
Match: cdk-12 (Cyclin-dependent kinase 12 [Source:UniProtKB/Swiss-Prot;Acc:P46551])

HSP 1 Score: 395.971 bits (1016), Expect = 5.563e-125
Identity = 189/367 (51.50%), Postives = 264/367 (71.93%), Query Frame = 3
Query: 1020 LMKKPGICAKRSATRNNVT----WGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSVI--TDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHY-CTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRKLMRQEKELKA 2099
            +  +P I  +R    N  +    W + +++ +  +D++GEGTYG V+KA +  TGE  ALK+VRLENEKEGFPITAIREIKIL QL H NIV L +IV D  +  + K+ +  FYLVF+Y+DHDL G+LESK ++    +Q+ S+FKQLLEG+ Y H+  FLHRDIKCSNILVNN+GE+K+AD GLARL+  + + R YTN+VITLWYRPPELLLG+E Y PAID+WS GC+LGELFT + +F  + E  Q+E ISKVCG PNV++WP++T L  + +++ +  Y+RR+RE +   +P  A+DLLD ML L+PEKR +A +AL   W+R+++   ++P   P+ +DCHE+ SKK++K  R  ++ + 
Sbjct:  280 IATRPVITTRRGHATNRPSDSDSWYKTNLTHYTMLDQIGEGTYGQVYKAVNNLTGEQVALKRVRLENEKEGFPITAIREIKILRQLHHKNIVRLMDIVIDDISMDELKRTRANFYLVFEYVDHDLIGLLESKELVDFNKDQICSLFKQLLEGLAYIHNTGFLHRDIKCSNILVNNKGELKIADLGLARLW--EKESRLYTNRVITLWYRPPELLLGDERYGPAIDVWSTGCMLGELFTRKPLFNGNNEFGQLELISKVCGSPNVDNWPELTELVGWNTFRMKRTYQRRIREEFEHIMPREAVDLLDKMLTLNPEKRISAKEALNHPWIRSLEHTTVQPLKLPQHQDCHEMWSKKQKKSARLGRQAEG 644          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Celegans
Match: cdk-12 (Cyclin-dependent kinase 12 [Source:UniProtKB/Swiss-Prot;Acc:P46551])

HSP 1 Score: 395.971 bits (1016), Expect = 6.360e-125
Identity = 189/367 (51.50%), Postives = 264/367 (71.93%), Query Frame = 3
Query: 1020 LMKKPGICAKRSATRNNVT----WGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSVI--TDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHY-CTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRKLMRQEKELKA 2099
            +  +P I  +R    N  +    W + +++ +  +D++GEGTYG V+KA +  TGE  ALK+VRLENEKEGFPITAIREIKIL QL H NIV L +IV D  +  + K+ +  FYLVF+Y+DHDL G+LESK ++    +Q+ S+FKQLLEG+ Y H+  FLHRDIKCSNILVNN+GE+K+AD GLARL+  + + R YTN+VITLWYRPPELLLG+E Y PAID+WS GC+LGELFT + +F  + E  Q+E ISKVCG PNV++WP++T L  + +++ +  Y+RR+RE +   +P  A+DLLD ML L+PEKR +A +AL   W+R+++   ++P   P+ +DCHE+ SKK++K  R  ++ + 
Sbjct:  280 IATRPVITTRRGHATNRPSDSDSWYKTNLTHYTMLDQIGEGTYGQVYKAVNNLTGEQVALKRVRLENEKEGFPITAIREIKILRQLHHKNIVRLMDIVIDDISMDELKRTRANFYLVFEYVDHDLIGLLESKELVDFNKDQICSLFKQLLEGLAYIHNTGFLHRDIKCSNILVNNKGELKIADLGLARLW--EKESRLYTNRVITLWYRPPELLLGDERYGPAIDVWSTGCMLGELFTRKPLFNGNNEFGQLELISKVCGSPNVDNWPELTELVGWNTFRMKRTYQRRIREEFEHIMPREAVDLLDKMLTLNPEKRISAKEALNHPWIRSLEHTTVQPLKLPQHQDCHEMWSKKQKKSARLGRQAEG 644          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Celegans
Match: cdk-12 (Cyclin-dependent kinase 12 [Source:UniProtKB/Swiss-Prot;Acc:P46551])

HSP 1 Score: 395.586 bits (1015), Expect = 6.826e-125
Identity = 189/367 (51.50%), Postives = 264/367 (71.93%), Query Frame = 3
Query: 1020 LMKKPGICAKRSATRNNVT----WGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSVI--TDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHY-CTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRKLMRQEKELKA 2099
            +  +P I  +R    N  +    W + +++ +  +D++GEGTYG V+KA +  TGE  ALK+VRLENEKEGFPITAIREIKIL QL H NIV L +IV D  +  + K+ +  FYLVF+Y+DHDL G+LESK ++    +Q+ S+FKQLLEG+ Y H+  FLHRDIKCSNILVNN+GE+K+AD GLARL+  + + R YTN+VITLWYRPPELLLG+E Y PAID+WS GC+LGELFT + +F  + E  Q+E ISKVCG PNV++WP++T L  + +++ +  Y+RR+RE +   +P  A+DLLD ML L+PEKR +A +AL   W+R+++   ++P   P+ +DCHE+ SKK++K  R  ++ + 
Sbjct:  280 IATRPVITTRRGHATNRPSDSDSWYKTNLTHYTMLDQIGEGTYGQVYKAVNNLTGEQVALKRVRLENEKEGFPITAIREIKILRQLHHKNIVRLMDIVIDDISMDELKRTRANFYLVFEYVDHDLIGLLESKELVDFNKDQICSLFKQLLEGLAYIHNTGFLHRDIKCSNILVNNKGELKIADLGLARLW--EKESRLYTNRVITLWYRPPELLLGDERYGPAIDVWSTGCMLGELFTRKPLFNGNNEFGQLELISKVCGSPNVDNWPELTELVGWNTFRMKRTYQRRIREEFEHIMPREAVDLLDKMLTLNPEKRISAKEALNHPWIRSLEHTTVQPLKLPQHQDCHEMWSKKQKKSARLGRQAEG 644          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Celegans
Match: cdk-9 (Probable cyclin-dependent kinase 9 [Source:UniProtKB/Swiss-Prot;Acc:Q9TVL3])

HSP 1 Score: 244.202 bits (622), Expect = 1.319e-71
Identity = 126/334 (37.72%), Postives = 189/334 (56.59%), Query Frame = 3
Query: 1086 RSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKK---RP-YTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYK-------PRHNYK-----------------------RRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWL 1982
            R VS +  ++K+G+GT+G VFKA    TG + ALKK+ +ENEKEGFPITA+RE+K+L QL H NI +L E+ +         KD+  FYLV     HDL G+L +  + ++   + ++ K L+ G+   H    LHRD+K +N+L++  G +KLADFGLAR ++  +     RP YTN+V+TLWYRPPELLLG+  Y   ID+W  GCI+ E++T Q +     E +Q++ IS +CG  N + WP    +PL+ +         P+  Y+                       + +++H       AL LL+ +L +DP+KR T+ +A    W 
Sbjct:   80 RDVSTYEKLNKIGQGTFGEVFKARCKNTGRMVALKKILMENEKEGFPITALREVKMLEQLKHPNITDLIEVCSAKSTGTTGSKDRATFYLVMALCAHDLAGLLSNPKIRMSLVHIKTMMKHLMSGLNKLHRSKILHRDMKAANVLISKDGILKLADFGLARPFVQRENGAGPRPLYTNRVVTLWYRPPELLLGDRQYGTKIDVWGAGCIMAEMWTRQPIMQGDTEQKQLQLISGLCGSINKDVWPNCVNMPLWSAMSSEPNSALPQGKYRILPNKMKNLMKFDAPDSKTDPFGKNVKQHDSATDDDALHLLEILLAIDPDKRPTSDEAEDDIWF 413          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Celegans
Match: cdk-9 (Probable cyclin-dependent kinase 9 [Source:UniProtKB/Swiss-Prot;Acc:Q9TVL3])

HSP 1 Score: 244.973 bits (624), Expect = 1.667e-71
Identity = 126/334 (37.72%), Postives = 189/334 (56.59%), Query Frame = 3
Query: 1086 RSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKK---RP-YTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYK-------PRHNYK-----------------------RRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWL 1982
            R VS +  ++K+G+GT+G VFKA    TG + ALKK+ +ENEKEGFPITA+RE+K+L QL H NI +L E+ +         KD+  FYLV     HDL G+L +  + ++   + ++ K L+ G+   H    LHRD+K +N+L++  G +KLADFGLAR ++  +     RP YTN+V+TLWYRPPELLLG+  Y   ID+W  GCI+ E++T Q +     E +Q++ IS +CG  N + WP    +PL+ +         P+  Y+                       + +++H       AL LL+ +L +DP+KR T+ +A    W 
Sbjct:   80 RDVSTYEKLNKIGQGTFGEVFKARCKNTGRMVALKKILMENEKEGFPITALREVKMLEQLKHPNITDLIEVCSAKSTGTTGSKDRATFYLVMALCAHDLAGLLSNPKIRMSLVHIKTMMKHLMSGLNKLHRSKILHRDMKAANVLISKDGILKLADFGLARPFVQRENGAGPRPLYTNRVVTLWYRPPELLLGDRQYGTKIDVWGAGCIMAEMWTRQPIMQGDTEQKQLQLISGLCGSINKDVWPNCVNMPLWSAMSSEPNSALPQGKYRILPNKMKNLMKFDAPDSKTDPFGKNVKQHDSATDDDALHLLEILLAIDPDKRPTSDEAEDDIWF 413          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Fly
Match: Cdk12 (gene:FBgn0037093 transcript:FBtr0078357)

HSP 1 Score: 449.514 bits (1155), Expect = 1.136e-140
Identity = 224/357 (62.75%), Postives = 278/357 (77.87%), Query Frame = 3
Query: 1026 KKPGICAKRSATRNNVT-WGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRKLMRQEKE 2090
            ++P I  +R  +RNNV  WGER V  F  I ++GEGTYG V+KA D  T ++ ALKKVRLE+EKEGFPITA+REIKIL QL H NIVNL EIVTD  +A++F+KDKG+FYLVF+YMDHDL G+LES  V   +E  ASI KQLL+G+ YCH +NFLHRDIKCSNIL+NNRG++KLADFGLARLY ADD++RPYTNKVITLWYRPPELLLGEE Y P+ID+WS GCILGELF  + +F A+ EM Q+E+ISK+CG P    WP V +LPLF + K +  ++RRLRE +  +P+ ALDLLD ML LDP+KR TA  AL+S WLR ++  ++  P  P  +DCHEL SKKRR+ MR+++E
Sbjct:  779 QRPVILNRRD-SRNNVRDWGERCVDVFEMIAQIGEGTYGQVYKARDHHTNDMVALKKVRLEHEKEGFPITAVREIKILRQLNHRNIVNLHEIVTDKQDAVEFRKDKGSFYLVFEYMDHDLMGLLESGMVDFNEENNASIMKQLLDGLNYCHKKNFLHRDIKCSNILMNNRGKVKLADFGLARLYNADDRERPYTNKVITLWYRPPELLLGEERYGPSIDVWSCGCILGELFVKRPLFQANAEMAQLETISKICGSPVPAVWPNVIKLPLFHTLKQKKTHRRRLREDFEFMPAPALDLLDKMLDLDPDKRITAEDALRSPWLRKINPDEMPTPQLPTWQDCHELWSKKRRRQMREQQE 1134          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Fly
Match: Cdk12 (gene:FBgn0037093 transcript:FBtr0332716)

HSP 1 Score: 449.514 bits (1155), Expect = 1.136e-140
Identity = 224/357 (62.75%), Postives = 278/357 (77.87%), Query Frame = 3
Query: 1026 KKPGICAKRSATRNNVT-WGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRKLMRQEKE 2090
            ++P I  +R  +RNNV  WGER V  F  I ++GEGTYG V+KA D  T ++ ALKKVRLE+EKEGFPITA+REIKIL QL H NIVNL EIVTD  +A++F+KDKG+FYLVF+YMDHDL G+LES  V   +E  ASI KQLL+G+ YCH +NFLHRDIKCSNIL+NNRG++KLADFGLARLY ADD++RPYTNKVITLWYRPPELLLGEE Y P+ID+WS GCILGELF  + +F A+ EM Q+E+ISK+CG P    WP V +LPLF + K +  ++RRLRE +  +P+ ALDLLD ML LDP+KR TA  AL+S WLR ++  ++  P  P  +DCHEL SKKRR+ MR+++E
Sbjct:  779 QRPVILNRRD-SRNNVRDWGERCVDVFEMIAQIGEGTYGQVYKARDHHTNDMVALKKVRLEHEKEGFPITAVREIKILRQLNHRNIVNLHEIVTDKQDAVEFRKDKGSFYLVFEYMDHDLMGLLESGMVDFNEENNASIMKQLLDGLNYCHKKNFLHRDIKCSNILMNNRGKVKLADFGLARLYNADDRERPYTNKVITLWYRPPELLLGEERYGPSIDVWSCGCILGELFVKRPLFQANAEMAQLETISKICGSPVPAVWPNVIKLPLFHTLKQKKTHRRRLREDFEFMPAPALDLLDKMLDLDPDKRITAEDALRSPWLRKINPDEMPTPQLPTWQDCHELWSKKRRRQMREQQE 1134          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Fly
Match: Cdk12 (gene:FBgn0037093 transcript:FBtr0078358)

HSP 1 Score: 449.514 bits (1155), Expect = 1.136e-140
Identity = 224/357 (62.75%), Postives = 278/357 (77.87%), Query Frame = 3
Query: 1026 KKPGICAKRSATRNNVT-WGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRKLMRQEKE 2090
            ++P I  +R  +RNNV  WGER V  F  I ++GEGTYG V+KA D  T ++ ALKKVRLE+EKEGFPITA+REIKIL QL H NIVNL EIVTD  +A++F+KDKG+FYLVF+YMDHDL G+LES  V   +E  ASI KQLL+G+ YCH +NFLHRDIKCSNIL+NNRG++KLADFGLARLY ADD++RPYTNKVITLWYRPPELLLGEE Y P+ID+WS GCILGELF  + +F A+ EM Q+E+ISK+CG P    WP V +LPLF + K +  ++RRLRE +  +P+ ALDLLD ML LDP+KR TA  AL+S WLR ++  ++  P  P  +DCHEL SKKRR+ MR+++E
Sbjct:  779 QRPVILNRRD-SRNNVRDWGERCVDVFEMIAQIGEGTYGQVYKARDHHTNDMVALKKVRLEHEKEGFPITAVREIKILRQLNHRNIVNLHEIVTDKQDAVEFRKDKGSFYLVFEYMDHDLMGLLESGMVDFNEENNASIMKQLLDGLNYCHKKNFLHRDIKCSNILMNNRGKVKLADFGLARLYNADDRERPYTNKVITLWYRPPELLLGEERYGPSIDVWSCGCILGELFVKRPLFQANAEMAQLETISKICGSPVPAVWPNVIKLPLFHTLKQKKTHRRRLREDFEFMPAPALDLLDKMLDLDPDKRITAEDALRSPWLRKINPDEMPTPQLPTWQDCHELWSKKRRRQMREQQE 1134          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Fly
Match: Cdk9 (gene:FBgn0019949 transcript:FBtr0071937)

HSP 1 Score: 235.728 bits (600), Expect = 7.688e-69
Identity = 116/259 (44.79%), Postives = 170/259 (65.64%), Query Frame = 3
Query: 1110 IDKVGEGTYGHVFKAEDIQTGE-LKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYI--ADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLRE 1874
            + K+G+GT+G VFKA + +  +   A+KKV ++NEKEGFPITA+REI+IL  L H N+VNL EI      A +    +  FYLVFD+ +HDL G+L + +V  +  ++  + +QLL G+ Y HS   LHRD+K +N+L+   G +KLADFGLAR +    ++ K  YTN+V+TLWYRPPELLLG+  Y P +D+W  GCI+ E++T   +   + E +Q+  IS++CG    + WP V  L L++S +   N KRR++E
Sbjct:   53 VAKIGQGTFGEVFKAREKKGNKKFVAMKKVLMDNEKEGFPITALREIRILQLLKHENVVNLIEICRTKATATN--GYRSTFYLVFDFCEHDLAGLLSNMNVKFSLGEIKKVMQQLLNGLYYIHSNKILHRDMKAANVLITKHGILKLADFGLARAFSIPKNESKNRYTNRVVTLWYRPPELLLGDRNYGPPVDMWGAGCIMAEMWTRSPIMQGNTEQQQLTFISQLCGSFTPDVWPGVEELELYKSIELPKNQKRRVKE 309          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Fly
Match: Cdk2 (gene:FBgn0004107 transcript:FBtr0083922)

HSP 1 Score: 226.868 bits (577), Expect = 9.264e-67
Identity = 125/301 (41.53%), Postives = 183/301 (60.80%), Query Frame = 3
Query: 1101 FRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKS-VITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPR---HNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNV 1991
            F+  +K+GEGTYG V+KA    TG+  ALKK+RLE E EG P TAIREI +L  L H N+V L ++V   +N           Y++F+Y++ DL  +++ K  V T + + S   Q+L+ + +CH+   LHRD+K  N+LV+  G+IKLADFGLAR +  +   R YT++V+TLWYR PE+LLG + YS  +DIWSLGCI  E+   +++F    E++Q+  I +    P+  +WP VT+LP F++  PR    N  + + EH       A +L+  ML  DP  R +A  AL+  + RNV
Sbjct:    8 FQRAEKIGEGTYGIVYKARSNSTGQDVALKKIRLEGETEGVPSTAIREISLLKNLKHPNVVQLFDVVISGNN----------LYMIFEYLNMDLKKLMDKKKDVFTPQLIKSYMHQILDAVGFCHTNRILHRDLKPQNLLVDTAGKIKLADFGLARAF--NVPMRAYTHEVVTLWYRAPEILLGTKFYSTGVDIWSLGCIFSEMIMRRSLFPGDSEIDQLYRIFRTLSTPDETNWPGVTQLPDFKTKFPRWEGTNMPQPITEH------EAHELIMSMLCYDPNLRISAKDALQHAYFRNV 290          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Zebrafish
Match: cdk12 (cyclin-dependent kinase 12 [Source:ZFIN;Acc:ZDB-GENE-081104-294])

HSP 1 Score: 475.322 bits (1222), Expect = 4.386e-149
Identity = 226/354 (63.84%), Postives = 271/354 (76.55%), Query Frame = 3
Query: 1017 SLMKKPGICAKRSATRNNVT--WGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRK 2069
            S  K+P IC+ R   R      WG+R V  F  I  +GEGTYG V+KA+D  TGEL ALKKVRL+NEKEGFPITAIREIKIL QL H ++VN+ EIVTD  +ALDFKKDKGAFYLVF+YMDHDL G+LES  V  + E V S  +QL+EG+ YCH +NFLHRDIKCSNIL+NN G+IKLADFGLARLY +++  RPYTNKVITLWYRPPELLLGEE YSPAID+WS GCILGELFT + +F A++E+ Q+E IS++CG P    WP V RLP F + +P+  Y+RRLRE +  LP+ ALDLLD ML LDP +RCTA QAL S +L +V+  K+ PPD P  +DCHEL SKKRR+
Sbjct:  645 SFKKRPKICSPRYGERKQTQTDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLNHRSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVSFSHEHVQSFMRQLMEGLDYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEES-RPYTNKVITLWYRPPELLLGEERYSPAIDVWSCGCILGELFTKKPIFQANQELLQLELISRLCGSPCPAAWPDVIRLPYFNTMRPKKQYRRRLREEFSFLPTPALDLLDHMLTLDPSRRCTAEQALASQFLCDVEPNKMPPPDLPHWQDCHELWSKKRRR 997          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Zebrafish
Match: cdk13 (cyclin-dependent kinase 13 [Source:ZFIN;Acc:ZDB-GENE-030131-4975])

HSP 1 Score: 470.315 bits (1209), Expect = 2.825e-147
Identity = 225/363 (61.98%), Postives = 273/363 (75.21%), Query Frame = 3
Query: 1026 KKPGICAKRSA--TRNNVTWGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRKLMRQEKELKAHK 2105
            ++P IC  R        + WG+R V  F  I   GEGTYG V+KA+D  T EL ALKKVRL+NEKEGFPITAIREIKIL QL H +I+N+ EIVTD ++ALDFK DKGAFYLVF+YMDHDL G+LES  V   +  + S  +QLLEG+ YCH +NFLHRDIKCSNIL+NN+G+IKLADFGLARLY +++  RPYTNKVITLWYRPPELLLGEE Y+PAID+WS GCILGELFT + +F A++E+ Q+E IS++CG P    WP V +LP F + KP+  Y+RRLRE +  +P  ALDL D ML LDP KRCTA QAL SD+LR+VD  K+ PPD P  +DCHEL SKKRR+  +  +EL A K
Sbjct:  567 RRPKICGPRFGEIKETEIDWGKRCVDKFEIIGITGEGTYGQVYKAKDKDTAELVALKKVRLDNEKEGFPITAIREIKILRQLNHKSIINMKEIVTDKEDALDFKNDKGAFYLVFEYMDHDLMGLLESGLVHFNESHIKSFMRQLLEGLDYCHKKNFLHRDIKCSNILLNNKGQIKLADFGLARLYNSEES-RPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANQELAQLELISRICGSPCPAVWPDVIKLPYFNTMKPKKQYRRRLREEFAFIPLMALDLFDHMLALDPSKRCTAEQALNSDFLRDVDPAKMPPPDLPLWQDCHELWSKKRRRQKQMPEELTAPK 928          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Zebrafish
Match: cdk9 (cyclin-dependent kinase 9 (CDC2-related kinase) [Source:ZFIN;Acc:ZDB-GENE-030131-321])

HSP 1 Score: 257.299 bits (656), Expect = 4.258e-77
Identity = 135/303 (44.55%), Postives = 189/303 (62.38%), Query Frame = 3
Query: 1095 SAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLY--IADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKV-TRLPLFESYKPRHNYKRRLREH---YCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWL 1982
            S +  + K+G+GT+G VFKA+  QTG+  ALKKV +ENEKEGFPITA+REIKIL  L H N+VNL EI      A  F + KG+ YLVFD+ +HDL G+L + +V  T  ++  + + LL G+ Y H    LHRD+K +N+L+   G +KLADFGLAR +    + +   YTN+V+TLWYRPPELLLGE  Y P ID+W  GCI+ E++T   +   + E  Q+  IS++CG      WP V  +  L++  +     KR++++    Y   P  ALDL+D +L LDP +R  +  AL  D+ 
Sbjct:   17 SKYEKLAKIGQGTFGEVFKAKHRQTGKKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKGEATQFNRYKGSIYLVFDFCEHDLAGLLSNANVKFTLAEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQGNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLTLISQLCGSITPEVWPGVDKKYELYQKMELPKGQKRKVKDRLKAYVKDPY-ALDLIDKLLVLDPAQRIDSDDALNHDFF 318          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Zebrafish
Match: cdk9 (cyclin-dependent kinase 9 (CDC2-related kinase) [Source:ZFIN;Acc:ZDB-GENE-030131-321])

HSP 1 Score: 254.603 bits (649), Expect = 9.020e-76
Identity = 135/303 (44.55%), Postives = 189/303 (62.38%), Query Frame = 3
Query: 1095 SAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLY--IADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKV-TRLPLFESYKPRHNYKRRLREH---YCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWL 1982
            S +  + K+G+GT+G VFKA+  QTG+  ALKKV +ENEKEGFPITA+REIKIL  L H N+VNL EI      A  F + KG+ YLVFD+ +HDL G+L + +V  T  ++  + + LL G+ Y H    LHRD+K +N+L+   G +KLADFGLAR +    + +   YTN+V+TLWYRPPELLLGE  Y P ID+W  GCI+ E++T   +   + E  Q+  IS++CG      WP V  +  L++  +     KR++++    Y   P  ALDL+D +L LDP +R  +  AL  D+ 
Sbjct:   38 SKYEKLAKIGQGTFGEVFKAKHRQTGKKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICR--TKATQFNRYKGSIYLVFDFCEHDLAGLLSNANVKFTLAEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQGNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLTLISQLCGSITPEVWPGVDKKYELYQKMELPKGQKRKVKDRLKAYVKDPY-ALDLIDKLLVLDPAQRIDSDDALNHDFF 337          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Zebrafish
Match: cdk9 (cyclin-dependent kinase 9 (CDC2-related kinase) [Source:ZFIN;Acc:ZDB-GENE-030131-321])

HSP 1 Score: 254.603 bits (649), Expect = 9.020e-76
Identity = 135/303 (44.55%), Postives = 189/303 (62.38%), Query Frame = 3
Query: 1095 SAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLY--IADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKV-TRLPLFESYKPRHNYKRRLREH---YCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWL 1982
            S +  + K+G+GT+G VFKA+  QTG+  ALKKV +ENEKEGFPITA+REIKIL  L H N+VNL EI      A  F + KG+ YLVFD+ +HDL G+L + +V  T  ++  + + LL G+ Y H    LHRD+K +N+L+   G +KLADFGLAR +    + +   YTN+V+TLWYRPPELLLGE  Y P ID+W  GCI+ E++T   +   + E  Q+  IS++CG      WP V  +  L++  +     KR++++    Y   P  ALDL+D +L LDP +R  +  AL  D+ 
Sbjct:   38 SKYEKLAKIGQGTFGEVFKAKHRQTGKKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICR--TKATQFNRYKGSIYLVFDFCEHDLAGLLSNANVKFTLAEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQGNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLTLISQLCGSITPEVWPGVDKKYELYQKMELPKGQKRKVKDRLKAYVKDPY-ALDLIDKLLVLDPAQRIDSDDALNHDFF 337          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Xenopus
Match: cdk12 (cyclin-dependent kinase 12 [Source:NCBI gene;Acc:100038049])

HSP 1 Score: 474.937 bits (1221), Expect = 2.243e-152
Identity = 224/353 (63.46%), Postives = 274/353 (77.62%), Query Frame = 3
Query: 1020 LMKKPGICAKRSATRNNVT--WGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRK 2069
            L K+P IC  R   R      WG+R V  F  I  +GEGTYG V+KA+D  TGEL ALKKVRL+NEKEGFPITAIREIKIL QL+H ++VN+ EIVTD  +ALDFKKDKGAFYLVF+YMDHDL G+LES  V  +++ + S  KQL+EG++YCH +NFLHRDIKCSNIL+NN G+IKLADFGLARLY + ++ RPYTNKVITLWYRPPELLLGEE Y+PAID+WS GCILGELFT + +F A++E+ Q+E IS++CG P    WP V +LP F + KP+  Y+RRLRE +  +P+ ALDLLD ML LDP KRCTA Q L+SD+L++VD  K+  PD P  +DCHEL SKKRR+
Sbjct:  405 LKKRPKICCPRYGERKQTETDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLIHKSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVQFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLY-SSEESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANQELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQYRRRLREEFSFVPTPALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVDVCKMATPDLPHWQDCHELWSKKRRR 756          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Xenopus
Match: cdk12 (cyclin-dependent kinase 12 [Source:NCBI gene;Acc:100038049])

HSP 1 Score: 474.552 bits (1220), Expect = 2.602e-150
Identity = 224/353 (63.46%), Postives = 274/353 (77.62%), Query Frame = 3
Query: 1020 LMKKPGICAKRSATRNNVT--WGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRK 2069
            L K+P IC  R   R      WG+R V  F  I  +GEGTYG V+KA+D  TGEL ALKKVRL+NEKEGFPITAIREIKIL QL+H ++VN+ EIVTD  +ALDFKKDKGAFYLVF+YMDHDL G+LES  V  +++ + S  KQL+EG++YCH +NFLHRDIKCSNIL+NN G+IKLADFGLARLY +++  RPYTNKVITLWYRPPELLLGEE Y+PAID+WS GCILGELFT + +F A++E+ Q+E IS++CG P    WP V +LP F + KP+  Y+RRLRE +  +P+ ALDLLD ML LDP KRCTA Q L+SD+L++VD  K+  PD P  +DCHEL SKKRR+
Sbjct:  681 LKKRPKICCPRYGERKQTETDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLIHKSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVQFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYSSEES-RPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANQELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQYRRRLREEFSFVPTPALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVDVCKMATPDLPHWQDCHELWSKKRRR 1032          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Xenopus
Match: cdk12 (cyclin-dependent kinase 12 [Source:NCBI gene;Acc:100038049])

HSP 1 Score: 477.248 bits (1227), Expect = 3.701e-150
Identity = 224/353 (63.46%), Postives = 274/353 (77.62%), Query Frame = 3
Query: 1020 LMKKPGICAKRSATRNNVT--WGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRK 2069
            L K+P IC  R   R      WG+R V  F  I  +GEGTYG V+KA+D  TGEL ALKKVRL+NEKEGFPITAIREIKIL QL+H ++VN+ EIVTD  +ALDFKKDKGAFYLVF+YMDHDL G+LES  V  +++ + S  KQL+EG++YCH +NFLHRDIKCSNIL+NN G+IKLADFGLARLY +++  RPYTNKVITLWYRPPELLLGEE Y+PAID+WS GCILGELFT + +F A++E+ Q+E IS++CG P    WP V +LP F + KP+  Y+RRLRE +  +P+ ALDLLD ML LDP KRCTA Q L+SD+L++VD  K+  PD P  +DCHEL SKKRR+
Sbjct:  681 LKKRPKICCPRYGERKQTETDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLIHKSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVQFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYSSEES-RPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANQELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQYRRRLREEFSFVPTPALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVDVCKMATPDLPHWQDCHELWSKKRRR 1032          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Xenopus
Match: cdk12 (cyclin-dependent kinase 12 [Source:NCBI gene;Acc:100038049])

HSP 1 Score: 476.863 bits (1226), Expect = 1.575e-149
Identity = 224/353 (63.46%), Postives = 274/353 (77.62%), Query Frame = 3
Query: 1020 LMKKPGICAKRSATRNNVT--WGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRK 2069
            L K+P IC  R   R      WG+R V  F  I  +GEGTYG V+KA+D  TGEL ALKKVRL+NEKEGFPITAIREIKIL QL+H ++VN+ EIVTD  +ALDFKKDKGAFYLVF+YMDHDL G+LES  V  +++ + S  KQL+EG++YCH +NFLHRDIKCSNIL+NN G+IKLADFGLARLY +++  RPYTNKVITLWYRPPELLLGEE Y+PAID+WS GCILGELFT + +F A++E+ Q+E IS++CG P    WP V +LP F + KP+  Y+RRLRE +  +P+ ALDLLD ML LDP KRCTA Q L+SD+L++VD  K+  PD P  +DCHEL SKKRR+
Sbjct:  681 LKKRPKICCPRYGERKQTETDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLIHKSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVQFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYSSEES-RPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANQELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQYRRRLREEFSFVPTPALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVDVCKMATPDLPHWQDCHELWSKKRRR 1032          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Xenopus
Match: cdk12 (cyclin-dependent kinase 12 [Source:NCBI gene;Acc:100038049])

HSP 1 Score: 475.322 bits (1222), Expect = 1.055e-148
Identity = 224/353 (63.46%), Postives = 274/353 (77.62%), Query Frame = 3
Query: 1020 LMKKPGICAKRSATRNNVT--WGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRK 2069
            L K+P IC  R   R      WG+R V  F  I  +GEGTYG V+KA+D  TGEL ALKKVRL+NEKEGFPITAIREIKIL QL+H ++VN+ EIVTD  +ALDFKKDKGAFYLVF+YMDHDL G+LES  V  +++ + S  KQL+EG++YCH +NFLHRDIKCSNIL+NN G+IKLADFGLARLY +++  RPYTNKVITLWYRPPELLLGEE Y+PAID+WS GCILGELFT + +F A++E+ Q+E IS++CG P    WP V +LP F + KP+  Y+RRLRE +  +P+ ALDLLD ML LDP KRCTA Q L+SD+L++VD  K+  PD P  +DCHEL SKKRR+
Sbjct:  681 LKKRPKICCPRYGERKQTETDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLIHKSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVQFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYSSEES-RPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANQELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQYRRRLREEFSFVPTPALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVDVCKMATPDLPHWQDCHELWSKKRRR 1032          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Mouse
Match: Cdk13 (cyclin-dependent kinase 13 [Source:MGI Symbol;Acc:MGI:1916812])

HSP 1 Score: 468.003 bits (1203), Expect = 5.295e-151
Identity = 219/351 (62.39%), Postives = 273/351 (77.78%), Query Frame = 3
Query: 1026 KKPGICAKRSAT--RNNVTWGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSVITDE-QVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRK 2069
            ++P IC  R       ++ WG+R V  F  I  +GEGTYG V+KA D  TGE+ ALKKVRL+NEKEGFPITAIREIKIL QL H +I+N+ EIVTD ++ALDFKKDKGAFYLVF+YMDHDL G+LES  V  +E  + S  +QL+EG+ YCH +NFLHRDIKCSNIL+NNRG+IKLADFGLARLY + ++ RPYTNKVITLWYRPPELLLGEE Y+PAID+WS GCILGELFT + +F A++E+ Q+E IS++CG P    WP V +LP F + KP+  Y+R+LRE +  +P+ ALDL D+ML LDP KRCTA QAL+ ++LR+V+  K+ PPD P  +DCHEL SKKRR+
Sbjct:   64 RRPKICGPRYGEIKEKDIDWGKRCVDKFDIIGIIGEGTYGQVYKARDKDTGEMVALKKVRLDNEKEGFPITAIREIKILRQLTHQSIINMKEIVTDKEDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFNENHIKSFMRQLMEGLDYCHKKNFLHRDIKCSNILLNNRGQIKLADFGLARLY-SSEESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANQELAQLELISRICGSPCPAVWPDVIKLPYFNTMKPKKQYRRKLREEFVFIPAAALDLFDYMLALDPSKRCTAEQALQCEFLRDVEPSKMPPPDLPLWQDCHELWSKKRRR 413          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Mouse
Match: Cdk12 (cyclin-dependent kinase 12 [Source:MGI Symbol;Acc:MGI:1098802])

HSP 1 Score: 478.019 bits (1229), Expect = 2.196e-150
Identity = 225/351 (64.10%), Postives = 272/351 (77.49%), Query Frame = 3
Query: 1026 KKPGICAKRSATRNNVT--WGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRK 2069
            K+P IC  R   R      WG+R V  F  I  +GEGTYG V+KA+D  TGEL ALKKVRL+NEKEGFPITAIREIKIL QLVH ++VN+ EIVTD  +ALDFKKDKGAFYLVF+YMDHDL G+LES  V  +++ + S  KQL+EG+ YCH +NFLHRDIKCSNIL+NN G+IKLADFGLARLY +++  RPYTNKVITLWYRPPELLLGEE Y+PAID+WS GCILGELFT + +F A+ E+ Q+E IS++CG P    WP V +LP F + KP+  Y+RRLRE +  +PS ALDLLD ML LDP KRCTA Q L+SD+L++V+  K+ PPD P  +DCHEL SKKRR+
Sbjct:  696 KRPKICCPRYGERRQTESDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLVHQSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLDYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEES-RPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQYRRRLREEFSFIPSAALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVELSKMAPPDLPHWQDCHELWSKKRRR 1045          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Mouse
Match: Cdk12 (cyclin-dependent kinase 12 [Source:MGI Symbol;Acc:MGI:1098802])

HSP 1 Score: 477.633 bits (1228), Expect = 1.502e-148
Identity = 225/351 (64.10%), Postives = 272/351 (77.49%), Query Frame = 3
Query: 1026 KKPGICAKRSATRNNVT--WGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRK 2069
            K+P IC  R   R      WG+R V  F  I  +GEGTYG V+KA+D  TGEL ALKKVRL+NEKEGFPITAIREIKIL QLVH ++VN+ EIVTD  +ALDFKKDKGAFYLVF+YMDHDL G+LES  V  +++ + S  KQL+EG+ YCH +NFLHRDIKCSNIL+NN G+IKLADFGLARLY +++  RPYTNKVITLWYRPPELLLGEE Y+PAID+WS GCILGELFT + +F A+ E+ Q+E IS++CG P    WP V +LP F + KP+  Y+RRLRE +  +PS ALDLLD ML LDP KRCTA Q L+SD+L++V+  K+ PPD P  +DCHEL SKKRR+
Sbjct:  696 KRPKICCPRYGERRQTESDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLVHQSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLDYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEES-RPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQYRRRLREEFSFIPSAALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVELSKMAPPDLPHWQDCHELWSKKRRR 1045          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Mouse
Match: Cdk12 (cyclin-dependent kinase 12 [Source:MGI Symbol;Acc:MGI:1098802])

HSP 1 Score: 477.248 bits (1227), Expect = 2.916e-148
Identity = 225/351 (64.10%), Postives = 272/351 (77.49%), Query Frame = 3
Query: 1026 KKPGICAKRSATRNNVT--WGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRK 2069
            K+P IC  R   R      WG+R V  F  I  +GEGTYG V+KA+D  TGEL ALKKVRL+NEKEGFPITAIREIKIL QLVH ++VN+ EIVTD  +ALDFKKDKGAFYLVF+YMDHDL G+LES  V  +++ + S  KQL+EG+ YCH +NFLHRDIKCSNIL+NN G+IKLADFGLARLY +++  RPYTNKVITLWYRPPELLLGEE Y+PAID+WS GCILGELFT + +F A+ E+ Q+E IS++CG P    WP V +LP F + KP+  Y+RRLRE +  +PS ALDLLD ML LDP KRCTA Q L+SD+L++V+  K+ PPD P  +DCHEL SKKRR+
Sbjct:  696 KRPKICCPRYGERRQTESDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLVHQSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLDYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEES-RPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQYRRRLREEFSFIPSAALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVELSKMAPPDLPHWQDCHELWSKKRRR 1045          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Mouse
Match: Cdk13 (cyclin-dependent kinase 13 [Source:MGI Symbol;Acc:MGI:1916812])

HSP 1 Score: 472.241 bits (1214), Expect = 1.026e-146
Identity = 219/351 (62.39%), Postives = 273/351 (77.78%), Query Frame = 3
Query: 1026 KKPGICAKRSA--TRNNVTWGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSVITDE-QVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRK 2069
            ++P IC  R       ++ WG+R V  F  I  +GEGTYG V+KA D  TGE+ ALKKVRL+NEKEGFPITAIREIKIL QL H +I+N+ EIVTD ++ALDFKKDKGAFYLVF+YMDHDL G+LES  V  +E  + S  +QL+EG+ YCH +NFLHRDIKCSNIL+NNRG+IKLADFGLARLY + ++ RPYTNKVITLWYRPPELLLGEE Y+PAID+WS GCILGELFT + +F A++E+ Q+E IS++CG P    WP V +LP F + KP+  Y+R+LRE +  +P+ ALDL D+ML LDP KRCTA QAL+ ++LR+V+  K+ PPD P  +DCHEL SKKRR+
Sbjct:  678 RRPKICGPRYGEIKEKDIDWGKRCVDKFDIIGIIGEGTYGQVYKARDKDTGEMVALKKVRLDNEKEGFPITAIREIKILRQLTHQSIINMKEIVTDKEDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFNENHIKSFMRQLMEGLDYCHKKNFLHRDIKCSNILLNNRGQIKLADFGLARLY-SSEESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANQELAQLELISRICGSPCPAVWPDVIKLPYFNTMKPKKQYRRKLREEFVFIPAAALDLFDYMLALDPSKRCTAEQALQCEFLRDVEPSKMPPPDLPLWQDCHELWSKKRRR 1027          
BLAST of Cyclin-dependent kinase 12 vs. UniProt/SwissProt
Match: sp|B5DE93|CDK12_XENTR (Cyclin-dependent kinase 12 OS=Xenopus tropicalis OX=8364 GN=cdk12 PE=2 SV=1)

HSP 1 Score: 476.093 bits (1224), Expect = 5.570e-149
Identity = 224/353 (63.46%), Postives = 274/353 (77.62%), Query Frame = 3
Query: 1020 LMKKPGICAKRSATRNNVT--WGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRK 2069
            L K+P IC  R   R      WG+R V  F  I  +GEGTYG V+KA+D  TGEL ALKKVRL+NEKEGFPITAIREIKIL QL+H ++VN+ EIVTD  +ALDFKKDKGAFYLVF+YMDHDL G+LES  V  +++ + S  KQL+EG++YCH +NFLHRDIKCSNIL+NN G+IKLADFGLARLY +++  RPYTNKVITLWYRPPELLLGEE Y+PAID+WS GCILGELFT + +F A++E+ Q+E IS++CG P    WP V +LP F + KP+  Y+RRLRE +  +P+ ALDLLD ML LDP KRCTA Q L+SD+L++VD  K+  PD P  +DCHEL SKKRR+
Sbjct:  681 LKKRPKICCPRYGERKQTETDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLIHKSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVQFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYSSEES-RPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANQELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQYRRRLREEFSFVPTPALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVDVCKMATPDLPHWQDCHELWSKKRRR 1032          
BLAST of Cyclin-dependent kinase 12 vs. UniProt/SwissProt
Match: sp|Q9NYV4|CDK12_HUMAN (Cyclin-dependent kinase 12 OS=Homo sapiens OX=9606 GN=CDK12 PE=1 SV=2)

HSP 1 Score: 478.789 bits (1231), Expect = 5.168e-148
Identity = 224/351 (63.82%), Postives = 273/351 (77.78%), Query Frame = 3
Query: 1026 KKPGICAKRSATRNNVT--WGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRK 2069
            K+P IC  R   R      WG+R V  F  I  +GEGTYG V+KA+D  TGEL ALKKVRL+NEKEGFPITAIREIKIL QL+H ++VN+ EIVTD  +ALDFKKDKGAFYLVF+YMDHDL G+LES  V  +++ + S  KQL+EG++YCH +NFLHRDIKCSNIL+NN G+IKLADFGLARLY +++  RPYTNKVITLWYRPPELLLGEE Y+PAID+WS GCILGELFT + +F A+ E+ Q+E IS++CG P    WP V +LP F + KP+  Y+RRLRE +  +PS ALDLLD ML LDP KRCTA Q L+SD+L++V+  K+ PPD P  +DCHEL SKKRR+
Sbjct:  700 KRPKICCPRYGERRQTESDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLIHRSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEES-RPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQYRRRLREEFSFIPSAALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVELSKMAPPDLPHWQDCHELWSKKRRR 1049          
BLAST of Cyclin-dependent kinase 12 vs. UniProt/SwissProt
Match: sp|Q14AX6|CDK12_MOUSE (Cyclin-dependent kinase 12 OS=Mus musculus OX=10090 GN=Cdk12 PE=1 SV=2)

HSP 1 Score: 477.248 bits (1227), Expect = 2.040e-147
Identity = 225/351 (64.10%), Postives = 272/351 (77.49%), Query Frame = 3
Query: 1026 KKPGICAKRSATRNNVT--WGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRK 2069
            K+P IC  R   R      WG+R V  F  I  +GEGTYG V+KA+D  TGEL ALKKVRL+NEKEGFPITAIREIKIL QLVH ++VN+ EIVTD  +ALDFKKDKGAFYLVF+YMDHDL G+LES  V  +++ + S  KQL+EG+ YCH +NFLHRDIKCSNIL+NN G+IKLADFGLARLY +++  RPYTNKVITLWYRPPELLLGEE Y+PAID+WS GCILGELFT + +F A+ E+ Q+E IS++CG P    WP V +LP F + KP+  Y+RRLRE +  +PS ALDLLD ML LDP KRCTA Q L+SD+L++V+  K+ PPD P  +DCHEL SKKRR+
Sbjct:  696 KRPKICCPRYGERRQTESDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLVHQSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLDYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEES-RPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQYRRRLREEFSFIPSAALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVELSKMAPPDLPHWQDCHELWSKKRRR 1045          
BLAST of Cyclin-dependent kinase 12 vs. UniProt/SwissProt
Match: sp|Q3MJK5|CDK12_RAT (Cyclin-dependent kinase 12 OS=Rattus norvegicus OX=10116 GN=Cdk12 PE=1 SV=1)

HSP 1 Score: 476.863 bits (1226), Expect = 2.666e-147
Identity = 225/351 (64.10%), Postives = 272/351 (77.49%), Query Frame = 3
Query: 1026 KKPGICAKRSATRNNVT--WGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRK 2069
            K+P IC  R   R      WG+R V  F  I  +GEGTYG V+KA+D  TGEL ALKKVRL+NEKEGFPITAIREIKIL QLVH ++VN+ EIVTD  +ALDFKKDKGAFYLVF+YMDHDL G+LES  V  +++ + S  KQL+EG+ YCH +NFLHRDIKCSNIL+NN G+IKLADFGLARLY +++  RPYTNKVITLWYRPPELLLGEE Y+PAID+WS GCILGELFT + +F A+ E+ Q+E IS++CG P    WP V +LP F + KP+  Y+RRLRE +  +PS ALDLLD ML LDP KRCTA Q L+SD+L++V+  K+ PPD P  +DCHEL SKKRR+
Sbjct:  696 KRPKICCPRYGERRQTESDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLVHQSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLDYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEES-RPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQYRRRLREEFSFIPSAALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVELSKMAPPDLPHWQDCHELWSKKRRR 1045          
BLAST of Cyclin-dependent kinase 12 vs. UniProt/SwissProt
Match: sp|D2H526|CDK12_AILME (Cyclin-dependent kinase 12 OS=Ailuropoda melanoleuca OX=9646 GN=CDK12 PE=3 SV=1)

HSP 1 Score: 476.093 bits (1224), Expect = 5.953e-147
Identity = 224/351 (63.82%), Postives = 272/351 (77.49%), Query Frame = 3
Query: 1026 KKPGICAKRSATRNNVT--WGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRK 2069
            K+P IC  R   R      WG+R V  F  I  +GEGTYG V+KA+D  TGEL ALKKVRL+NEKEGFPITAIREIKIL QL+H ++VN+ EIVTD  +ALDFKKDKGAFYLVF+YMDHDL G+LES  V  +++ + S  KQL+EG+ YCH +NFLHRDIKCSNIL+NN G+IKLADFGLARLY +++  RPYTNKVITLWYRPPELLLGEE Y+PAID+WS GCILGELFT + +F A+ E+ Q+E IS++CG P    WP V +LP F + KP+  Y+RRLRE +  +PS ALDLLD ML LDP KRCTA Q L+SD+L++V+  K+ PPD P  +DCHEL SKKRR+
Sbjct:  701 KRPKICCPRYGERRQTESDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLIHRSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLDYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEES-RPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQYRRRLREEFSFIPSAALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVELSKMDPPDLPHWQDCHELWSKKRRR 1050          
BLAST of Cyclin-dependent kinase 12 vs. TrEMBL
Match: A0A0X3PWT4 (Protein kinase domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR154445 PE=4 SV=1)

HSP 1 Score: 560.066 bits (1442), Expect = 0.000e+0
Identity = 272/455 (59.78%), Postives = 339/455 (74.51%), Query Frame = 3
Query:  804 IPNNLPLPKIGSSVYENHINHKSEKSKNY-CKPT-------------LPLP-NIPTKSVNSIFRSSKSESKIDKSLSKSHQLSSDVSLMKKPGICAKRSATRNNVTWGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRKLMRQEKELKAHKMGVDL 2120
            +P+N P P+ G+  Y +   H      N    PT             LPLP      +++ I RS    ++   +  KS +     +++++P IC +RS TRNNVTWGERSV+AF  +++VGEGTYGHV+KA D  TGE KALKKVRLENE+EGFPITA+REIKIL QL H NIVNLCEIVTD D+A DFKKD+GAF+LVFDYMDHDL+G+LES  V  T+  VAS+ KQL+ G+ YCHSRNFLHRDIKCSNIL+NNRG++KLADFGLARLYIADDK+RPYTNKVITLWYRPPELLLGEE Y PA+DIWS GCILGELFT + MF A+EEMEQ+E I +VCG P+   WP V  LP++ +++P+  YKRRLR++Y  LP+ ALDLLD ML LDP KRC+A +AL   WLRN+D   I PP+ P ++ CHE+ SKKRRK+MR E+E+KA K+G+++
Sbjct:  202 LPSNPPKPQ-GTKRYRDSTPHLPSADPNLPSGPTSIKECSKRTTLVDLPLPPGFDASTMSDIARSQFPNTQASSNPRKSVR----STVLQRPKICEQRSKTRNNVTWGERSVTAFETLEQVGEGTYGHVYKARDRITGEFKALKKVRLENEREGFPITAVREIKILRQLRHENIVNLCEIVTDKDDATDFKKDRGAFFLVFDYMDHDLYGLLESGLVTFTEAHVASLMKQLMLGLHYCHSRNFLHRDIKCSNILINNRGQLKLADFGLARLYIADDKERPYTNKVITLWYRPPELLLGEERYGPAVDIWSCGCILGELFTRKPMFAANEEMEQLEVICRVCGYPDNLTWPDVDHLPMYSTFRPKQLYKRRLRQNYKFLPTLALDLLDSMLYLDPRKRCSAREALDCPWLRNIDPTAIPPPNMPTNQHCHEMWSKKRRKVMRHEQEIKAQKLGIEM 651          
BLAST of Cyclin-dependent kinase 12 vs. TrEMBL
Match: A0A0X3PU84 (Protein kinase domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR154445 PE=4 SV=1)

HSP 1 Score: 560.066 bits (1442), Expect = 0.000e+0
Identity = 272/455 (59.78%), Postives = 339/455 (74.51%), Query Frame = 3
Query:  804 IPNNLPLPKIGSSVYENHINHKSEKSKNY-CKPT-------------LPLP-NIPTKSVNSIFRSSKSESKIDKSLSKSHQLSSDVSLMKKPGICAKRSATRNNVTWGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRKLMRQEKELKAHKMGVDL 2120
            +P+N P P+ G+  Y +   H      N    PT             LPLP      +++ I RS    ++   +  KS +     +++++P IC +RS TRNNVTWGERSV+AF  +++VGEGTYGHV+KA D  TGE KALKKVRLENE+EGFPITA+REIKIL QL H NIVNLCEIVTD D+A DFKKD+GAF+LVFDYMDHDL+G+LES  V  T+  VAS+ KQL+ G+ YCHSRNFLHRDIKCSNIL+NNRG++KLADFGLARLYIADDK+RPYTNKVITLWYRPPELLLGEE Y PA+DIWS GCILGELFT + MF A+EEMEQ+E I +VCG P+   WP V  LP++ +++P+  YKRRLR++Y  LP+ ALDLLD ML LDP KRC+A +AL   WLRN+D   I PP+ P ++ CHE+ SKKRRK+MR E+E+KA K+G+++
Sbjct:  206 LPSNPPKPQ-GTKRYRDSTPHLPSADPNLPSGPTSIKECSKRTTLVDLPLPPGFDASTMSDIARSQFPNTQASSNPRKSVR----STVLQRPKICEQRSKTRNNVTWGERSVTAFETLEQVGEGTYGHVYKARDRITGEFKALKKVRLENEREGFPITAVREIKILRQLRHENIVNLCEIVTDKDDATDFKKDRGAFFLVFDYMDHDLYGLLESGLVTFTEAHVASLMKQLMLGLHYCHSRNFLHRDIKCSNILINNRGQLKLADFGLARLYIADDKERPYTNKVITLWYRPPELLLGEERYGPAVDIWSCGCILGELFTRKPMFAANEEMEQLEVICRVCGYPDNLTWPDVDHLPMYSTFRPKQLYKRRLRQNYKFLPTLALDLLDSMLYLDPRKRCSAREALDCPWLRNIDPTAIPPPNMPTNQHCHEMWSKKRRKVMRHEQEIKAQKLGIEM 655          
BLAST of Cyclin-dependent kinase 12 vs. TrEMBL
Match: A0A183SXW5 (Protein kinase domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS9063 PE=4 SV=1)

HSP 1 Score: 560.066 bits (1442), Expect = 0.000e+0
Identity = 272/455 (59.78%), Postives = 339/455 (74.51%), Query Frame = 3
Query:  804 IPNNLPLPKIGSSVYENHINHKSEKSKNY-CKPT-------------LPLP-NIPTKSVNSIFRSSKSESKIDKSLSKSHQLSSDVSLMKKPGICAKRSATRNNVTWGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRKLMRQEKELKAHKMGVDL 2120
            +P+N P P+ G+  Y +   H      N    PT             LPLP      +++ I RS    ++   +  KS +     +++++P IC +RS TRNNVTWGERSV+AF  +++VGEGTYGHV+KA D  TGE KALKKVRLENE+EGFPITA+REIKIL QL H NIVNLCEIVTD D+A DFKKD+GAF+LVFDYMDHDL+G+LES  V  T+  VAS+ KQL+ G+ YCHSRNFLHRDIKCSNIL+NNRG++KLADFGLARLYIADDK+RPYTNKVITLWYRPPELLLGEE Y PA+DIWS GCILGELFT + MF A+EEMEQ+E I +VCG P+   WP V  LP++ +++P+  YKRRLR++Y  LP+ ALDLLD ML LDP KRC+A +AL   WLRN+D   I PP+ P ++ CHE+ SKKRRK+MR E+E+KA K+G+++
Sbjct:  127 LPSNPPKPQ-GTKRYRDSTPHLPSADPNLPSGPTSIKECSKRTTLVDLPLPPGFDASTMSDIARSQFPNTQASSNPRKSVR----STVLQRPKICEQRSKTRNNVTWGERSVTAFETLEQVGEGTYGHVYKARDRITGEFKALKKVRLENEREGFPITAVREIKILRQLRHENIVNLCEIVTDKDDATDFKKDRGAFFLVFDYMDHDLYGLLESGLVTFTEAHVASLMKQLMLGLHYCHSRNFLHRDIKCSNILINNRGQLKLADFGLARLYIADDKERPYTNKVITLWYRPPELLLGEERYGPAVDIWSCGCILGELFTRKPMFAANEEMEQLEVICRVCGYPDNLTWPDVDHLPMYSTFRPKQLYKRRLRQNYKFLPTLALDLLDSMLYLDPRKRCSAREALDCPWLRNIDPTAIPPPNMPTNQHCHEMWSKKRRKVMRHEQEIKAQKLGIEM 576          
BLAST of Cyclin-dependent kinase 12 vs. TrEMBL
Match: A0A0X3P5G7 (Protein kinase domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR154445 PE=4 SV=1)

HSP 1 Score: 559.681 bits (1441), Expect = 0.000e+0
Identity = 272/455 (59.78%), Postives = 339/455 (74.51%), Query Frame = 3
Query:  804 IPNNLPLPKIGSSVYENHINHKSEKSKNY-CKPT-------------LPLP-NIPTKSVNSIFRSSKSESKIDKSLSKSHQLSSDVSLMKKPGICAKRSATRNNVTWGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRKLMRQEKELKAHKMGVDL 2120
            +P+N P P+ G+  Y +   H      N    PT             LPLP      +++ I RS    ++   +  KS +     +++++P IC +RS TRNNVTWGERSV+AF  +++VGEGTYGHV+KA D  TGE KALKKVRLENE+EGFPITA+REIKIL QL H NIVNLCEIVTD D+A DFKKD+GAF+LVFDYMDHDL+G+LES  V  T+  VAS+ KQL+ G+ YCHSRNFLHRDIKCSNIL+NNRG++KLADFGLARLYIADDK+RPYTNKVITLWYRPPELLLGEE Y PA+DIWS GCILGELFT + MF A+EEMEQ+E I +VCG P+   WP V  LP++ +++P+  YKRRLR++Y  LP+ ALDLLD ML LDP KRC+A +AL   WLRN+D   I PP+ P ++ CHE+ SKKRRK+MR E+E+KA K+G+++
Sbjct:  210 LPSNPPKPQ-GTKRYRDSTPHLPSADPNLPSGPTSIKECSKRTTLVDLPLPPGFDASTMSDIARSQFPNTQASSNPRKSVR----STVLQRPKICEQRSKTRNNVTWGERSVTAFETLEQVGEGTYGHVYKARDRITGEFKALKKVRLENEREGFPITAVREIKILRQLRHENIVNLCEIVTDKDDATDFKKDRGAFFLVFDYMDHDLYGLLESGLVTFTEAHVASLMKQLMLGLHYCHSRNFLHRDIKCSNILINNRGQLKLADFGLARLYIADDKERPYTNKVITLWYRPPELLLGEERYGPAVDIWSCGCILGELFTRKPMFAANEEMEQLEVICRVCGYPDNLTWPDVDHLPMYSTFRPKQLYKRRLRQNYKFLPTLALDLLDSMLYLDPRKRCSAREALDCPWLRNIDPTAIPPPNMPTNQHCHEMWSKKRRKVMRHEQEIKAQKLGIEM 659          
BLAST of Cyclin-dependent kinase 12 vs. TrEMBL
Match: A0A0X3NHI9 (Protein kinase domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR154445 PE=4 SV=1)

HSP 1 Score: 559.681 bits (1441), Expect = 0.000e+0
Identity = 272/455 (59.78%), Postives = 339/455 (74.51%), Query Frame = 3
Query:  804 IPNNLPLPKIGSSVYENHINHKSEKSKNY-CKPT-------------LPLP-NIPTKSVNSIFRSSKSESKIDKSLSKSHQLSSDVSLMKKPGICAKRSATRNNVTWGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRKLMRQEKELKAHKMGVDL 2120
            +P+N P P+ G+  Y +   H      N    PT             LPLP      +++ I RS    ++   +  KS +     +++++P IC +RS TRNNVTWGERSV+AF  +++VGEGTYGHV+KA D  TGE KALKKVRLENE+EGFPITA+REIKIL QL H NIVNLCEIVTD D+A DFKKD+GAF+LVFDYMDHDL+G+LES  V  T+  VAS+ KQL+ G+ YCHSRNFLHRDIKCSNIL+NNRG++KLADFGLARLYIADDK+RPYTNKVITLWYRPPELLLGEE Y PA+DIWS GCILGELFT + MF A+EEMEQ+E I +VCG P+   WP V  LP++ +++P+  YKRRLR++Y  LP+ ALDLLD ML LDP KRC+A +AL   WLRN+D   I PP+ P ++ CHE+ SKKRRK+MR E+E+KA K+G+++
Sbjct:  206 LPSNPPKPQ-GTKRYRDSTPHLPSADPNLPSGPTSIKECSKRTTLVDLPLPPGFDASTMSDIARSQFPNTQASSNPRKSVR----STVLQRPKICEQRSKTRNNVTWGERSVTAFETLEQVGEGTYGHVYKARDRITGEFKALKKVRLENEREGFPITAVREIKILRQLRHENIVNLCEIVTDKDDATDFKKDRGAFFLVFDYMDHDLYGLLESGLVTFTEAHVASLMKQLMLGLHYCHSRNFLHRDIKCSNILINNRGQLKLADFGLARLYIADDKERPYTNKVITLWYRPPELLLGEERYGPAVDIWSCGCILGELFTRKPMFAANEEMEQLEVICRVCGYPDNLTWPDVDHLPMYSTFRPKQLYKRRLRQNYKFLPTLALDLLDSMLYLDPRKRCSAREALDCPWLRNIDPTAIPPPNMPTNQHCHEMWSKKRRKVMRHEQEIKAQKLGIEM 655          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Cavefish
Match: cdk12 (cyclin dependent kinase 12 [Source:NCBI gene;Acc:103040863])

HSP 1 Score: 472.626 bits (1215), Expect = 4.813e-148
Identity = 224/351 (63.82%), Postives = 271/351 (77.21%), Query Frame = 3
Query: 1026 KKPGICAKRSATR--NNVTWGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRK 2069
            K+P  C+ R   R    + WG+R V  F  I  +GEGTYG V+KA+D  TGEL ALKKVRL+NEKEGFPITAIREIKIL QL H ++VN+ EIVTD  +ALDFKKDKGAFYLVF+YMDHDL G+LES  V  + E + S  +QL+EG+ YCH +NFLHRDIKCSNIL+NN G+IKLADFGLARLY +++  RPYTNKVITLWYRPPELLLGEE YSPAID+WS GCILGELFT + +F A++E+ Q+E IS++CG P    WP V +LP F + KP+  Y+RRLRE +  LP+ ALDLLD ML LDP +RCTA QAL+S +L +VD  K+ PPD P  +DCHEL SKKRR+
Sbjct:  647 KRPKFCSPRFGERRQTQIDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLNHRSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVSFSQEHIRSFMRQLMEGLDYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEES-RPYTNKVITLWYRPPELLLGEERYSPAIDVWSCGCILGELFTKKPIFQANQELLQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQYRRRLREEFSFLPTPALDLLDRMLTLDPSRRCTAEQALESQFLCDVDPSKMSPPDLPHWQDCHELWSKKRRR 996          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Cavefish
Match: cdk12 (cyclin dependent kinase 12 [Source:NCBI gene;Acc:103040863])

HSP 1 Score: 472.626 bits (1215), Expect = 5.539e-148
Identity = 224/351 (63.82%), Postives = 271/351 (77.21%), Query Frame = 3
Query: 1026 KKPGICAKRSATR--NNVTWGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRK 2069
            K+P  C+ R   R    + WG+R V  F  I  +GEGTYG V+KA+D  TGEL ALKKVRL+NEKEGFPITAIREIKIL QL H ++VN+ EIVTD  +ALDFKKDKGAFYLVF+YMDHDL G+LES  V  + E + S  +QL+EG+ YCH +NFLHRDIKCSNIL+NN G+IKLADFGLARLY +++  RPYTNKVITLWYRPPELLLGEE YSPAID+WS GCILGELFT + +F A++E+ Q+E IS++CG P    WP V +LP F + KP+  Y+RRLRE +  LP+ ALDLLD ML LDP +RCTA QAL+S +L +VD  K+ PPD P  +DCHEL SKKRR+
Sbjct:  658 KRPKFCSPRFGERRQTQIDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLNHRSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVSFSQEHIRSFMRQLMEGLDYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEES-RPYTNKVITLWYRPPELLLGEERYSPAIDVWSCGCILGELFTKKPIFQANQELLQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQYRRRLREEFSFLPTPALDLLDRMLTLDPSRRCTAEQALESQFLCDVDPSKMSPPDLPHWQDCHELWSKKRRR 1007          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Cavefish
Match: cdk13 (cyclin dependent kinase 13 [Source:NCBI gene;Acc:103043281])

HSP 1 Score: 470.7 bits (1210), Expect = 2.401e-146
Identity = 222/362 (61.33%), Postives = 272/362 (75.14%), Query Frame = 3
Query: 1017 SLMKKPGICAKRSA--TRNNVTWGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRKLMRQEKEL 2093
            +L ++P IC  R        + WG+R V  F  +   GEGTYG V+KA D  T E+ ALKKVRL+NEKEGFPITAIREIKIL QL H +I+N+ EIVTD ++ALDFK DKGAFYLVF+YMDHDL G+LES  V   +  + S  +QLLEG+ YCH +NFLHRDIKCSNIL+NN+G+IKLADFGLARLY +++  RPYTNKVITLWYRPPELLLGEE Y+PAID+WS GCILGELFT + +F A++E+ Q+E IS++CG P    WP V +LP F + KP+  Y+RRLRE +  +P  ALDL D ML LDP KRCTA QAL SD+LR+VD  K+ PPD P  +DCHEL SKKRR+  +  +EL
Sbjct:  609 TLRRRPKICGPRFGEIKETEIDWGKRCVDKFEILGITGEGTYGQVYKARDKDTAEMVALKKVRLDNEKEGFPITAIREIKILRQLNHKSIINMKEIVTDKEDALDFKNDKGAFYLVFEYMDHDLMGLLESGLVHFNESHIKSFMRQLLEGLDYCHKKNFLHRDIKCSNILLNNKGQIKLADFGLARLYNSEES-RPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANQELAQLELISRICGSPCPAVWPDVIKLPYFNTMKPKKQYRRRLREEFAFIPPTALDLFDHMLALDPSKRCTAEQALNSDFLRDVDPAKMPPPDLPLWQDCHELWSKKRRRQKQMPEEL 969          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Cavefish
Match: cdk9 (cyclin-dependent kinase 9 (CDC2-related kinase) [Source:ZFIN;Acc:ZDB-GENE-030131-321])

HSP 1 Score: 254.603 bits (649), Expect = 4.531e-75
Identity = 135/303 (44.55%), Postives = 189/303 (62.38%), Query Frame = 3
Query: 1095 SAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLY--IADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKV-TRLPLFESYKPRHNYKRRLREH---YCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWL 1982
            S +  + K+G+GT+G VFKA+  QTG+  ALKKV +ENEKEGFPITA+REIKIL  L H N+VNL EI      A  F + KG+ YLVFD+ +HDL G+L + +V  T  ++  + + LL G+ Y H    LHRD+K +N+L+   G +KLADFGLAR +    + +   YTN+V+TLWYRPPELLLGE  Y P ID+W  GCI+ E++T   +   + E  Q+  IS++CG      WP V  +  L++  +     KR++++    Y   P  ALDL+D +L LDP +R  +  AL  D+ 
Sbjct:  102 SKYEKLAKIGQGTFGEVFKAKHRQTGKKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICR--TKATQFNRYKGSIYLVFDFCEHDLAGLLSNANVKFTLAEIKKVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGILKLADFGLARAFSLAKNSQGNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGGGCIMAEMWTRSPIMQGNTEQHQLTLISQLCGSITAEVWPGVDKKYELYQKMELPKGQKRKVKDRLKAYVKDPY-ALDLIDKLLVLDPAQRIDSDDALNHDFF 401          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Cavefish
Match: cdk10 (cyclin dependent kinase 10 [Source:NCBI gene;Acc:103043383])

HSP 1 Score: 249.595 bits (636), Expect = 1.799e-74
Identity = 127/320 (39.69%), Postives = 202/320 (63.12%), Query Frame = 3
Query: 1086 RSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILES-KSVITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRN--VDSKKIKPPDFPRDRD 2036
            R+V  F  ++++GEGTYG V++A D +T E+ ALKKVR++ EK+G PI+++REI +L++L H NIV L E+V  + + L+      + +LV  Y + DL  +LE+ +S  ++ QV  I  QLL+G++Y H    LHRD+K SN+L+ ++G +K+ADFGLAR+Y     ++P T KV+TLWYR PELLLG +  + A+D+W++GCIL EL   + + + S E++Q++ I ++ G PN N WP  +RLPL   Y  R      L+  +  L    L LL+ +   +P++R +A  +L+S + +   +  +    P FP  R+
Sbjct:   31 RNVKEFEKLNRIGEGTYGIVYRARDTRTNEIVALKKVRMDKEKDGIPISSLREITLLLRLRHPNIVELKEVV--VGSHLE------SLFLVMSYCEQDLASLLENMQSPFSEAQVKCIVLQLLKGLEYLHHNFILHRDLKVSNLLMTDKGCVKIADFGLARVY--GVPQQPMTPKVVTLWYRAPELLLGTKTQTTALDMWAVGCILAELLAHKPLLSGSSEIQQLDLIVQLLGTPNENIWPGFSRLPLVGQYSLRKQPYNNLKNKFTWLSEAGLRLLNLLFMYNPQRRASAKDSLESSYFKEKPLPCEPELMPTFPHHRN 340          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000855.1 (pep scaffold:Pmarinus_7.0:GL480767:13986:34488:-1 gene:ENSPMAG00000000768.1 transcript:ENSPMAT00000000855.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 469.929 bits (1208), Expect = 1.094e-149
Identity = 224/351 (63.82%), Postives = 270/351 (76.92%), Query Frame = 3
Query: 1026 KKPGICAKRSA--TRNNVTWGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRK 2069
            ++P IC  R          WG+R V  F  I  +GEGTYG V+KA+D  TGEL ALKKVRL+NEKEGFPITAIREIKIL QL H +I+N+ EIVTD ++A+DFKKDKGAFYLVFDYMDHDL G+LES  V  +++ + S  KQL+EG+ YCH +NFLHRDIKCSNIL+NNRG IKLADFGLARLY + ++ RPYTNKVITLWYRPPELLLGEE Y PAID+WS GCILGELFT + +F A++EM Q+E IS++CG P    WP V +LP F + KP+  Y+RRLRE +  LP+ ALDL D  L LDP KRCTA QAL+SD+LR++D  K+ PPD P  +DCHEL SKKRR+
Sbjct:  571 RRPKICGPRYGEIKGTEADWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLNHRSIINMKEIVTDKEDAIDFKKDKGAFYLVFDYMDHDLMGLLESGLVSFSEDHIKSFMKQLMEGLDYCHRKNFLHRDIKCSNILLNNRGHIKLADFGLARLY-SSEESRPYTNKVITLWYRPPELLLGEERYGPAIDVWSCGCILGELFTRKPIFQANQEMAQLELISRLCGTPCPAVWPDVIKLPYFHTMKPKKQYRRRLREEFSMLPTAALDLFD-HLALDPSKRCTAEQALQSDFLRDIDPYKMPPPDLPLWQDCHELWSKKRRR 919          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000851.1 (pep scaffold:Pmarinus_7.0:GL480767:12807:33146:-1 gene:ENSPMAG00000000768.1 transcript:ENSPMAT00000000851.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 471.47 bits (1212), Expect = 1.342e-148
Identity = 225/351 (64.10%), Postives = 271/351 (77.21%), Query Frame = 3
Query: 1026 KKPGICAKRSA--TRNNVTWGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRK 2069
            ++P IC  R          WG+R V  F  I  +GEGTYG V+KA+D  TGEL ALKKVRL+NEKEGFPITAIREIKIL QL H +I+N+ EIVTD ++A+DFKKDKGAFYLVFDYMDHDL G+LES  V  +++ + S  KQL+EG+ YCH +NFLHRDIKCSNIL+NNRG IKLADFGLARLY + ++ RPYTNKVITLWYRPPELLLGEE Y PAID+WS GCILGELFT + +F A++EM Q+E IS++CG P    WP V +LP F + KP+  Y+RRLRE +  LP+ ALDL D ML LDP KRCTA QAL+SD+LR++D  K+ PPD P  +DCHEL SKKRR+
Sbjct:  529 RRPKICGPRYGEIKGTEADWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLNHRSIINMKEIVTDKEDAIDFKKDKGAFYLVFDYMDHDLMGLLESGLVSFSEDHIKSFMKQLMEGLDYCHRKNFLHRDIKCSNILLNNRGHIKLADFGLARLY-SSEESRPYTNKVITLWYRPPELLLGEERYGPAIDVWSCGCILGELFTRKPIFQANQEMAQLELISRLCGTPCPAVWPDVIKLPYFHTMKPKKQYRRRLREEFSMLPTAALDLFD-MLALDPSKRCTAEQALQSDFLRDIDPYKMPPPDLPLWQDCHELWSKKRRR 877          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000850.1 (pep scaffold:Pmarinus_7.0:GL480767:12801:33146:-1 gene:ENSPMAG00000000768.1 transcript:ENSPMAT00000000850.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 471.47 bits (1212), Expect = 1.759e-148
Identity = 225/351 (64.10%), Postives = 271/351 (77.21%), Query Frame = 3
Query: 1026 KKPGICAKRSA--TRNNVTWGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRK 2069
            ++P IC  R          WG+R V  F  I  +GEGTYG V+KA+D  TGEL ALKKVRL+NEKEGFPITAIREIKIL QL H +I+N+ EIVTD ++A+DFKKDKGAFYLVFDYMDHDL G+LES  V  +++ + S  KQL+EG+ YCH +NFLHRDIKCSNIL+NNRG IKLADFGLARLY + ++ RPYTNKVITLWYRPPELLLGEE Y PAID+WS GCILGELFT + +F A++EM Q+E IS++CG P    WP V +LP F + KP+  Y+RRLRE +  LP+ ALDL D ML LDP KRCTA QAL+SD+LR++D  K+ PPD P  +DCHEL SKKRR+
Sbjct:  528 RRPKICGPRYGEIKGTEADWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLNHRSIINMKEIVTDKEDAIDFKKDKGAFYLVFDYMDHDLMGLLESGLVSFSEDHIKSFMKQLMEGLDYCHRKNFLHRDIKCSNILLNNRGHIKLADFGLARLY-SSEESRPYTNKVITLWYRPPELLLGEERYGPAIDVWSCGCILGELFTRKPIFQANQEMAQLELISRLCGTPCPAVWPDVIKLPYFHTMKPKKQYRRRLREEFSMLPTAALDLFD-MLALDPSKRCTAEQALQSDFLRDIDPYKMPPPDLPLWQDCHELWSKKRRR 876          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Sea Lamprey
Match: cdk2 (cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2741])

HSP 1 Score: 239.965 bits (611), Expect = 1.782e-72
Identity = 134/306 (43.79%), Postives = 186/306 (60.78%), Query Frame = 3
Query: 1101 FRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILE--SKSVITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKP 2012
            F+ ++K+GEGTYG V+KA +  TGE  ALKK+RL+ E EG P TAIREI +L +L H NIV L  I+            +   YLVF+ +D DL   ++  + S I    V S   QLL+GI +CHS   LHRD+K  N+L+N  G IKLADFGLAR +     +R YT++V+TLWYR PE+LLG + YS ++D+WS+GCI  E+ T + +F    E++Q+  I +  G P+   WP V++LP ++S  PR    + L +   TL     DLL  ML+ DP +R TA  AL   + +NV  K+I P
Sbjct:    4 FQKVEKIGEGTYGVVYKARNKLTGEAVALKKIRLDTETEGVPSTAIREISLLRELNHPNIVRLLTII----------HSEKKLYLVFELLDQDLKKFMDNATPSGIPLPLVKSYLYQLLQGIAFCHSHRILHRDLKPQNLLINAEGAIKLADFGLARAF--GVPQRTYTHEVVTLWYRAPEILLGCKHYSTSVDVWSIGCIFAEMLTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVSQLPDYKSTFPRWA-NQELTKVVPTLNFEGRDLLALMLQYDPNQRVTANMALSHCFFQNV--KQIVP 294          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Sea Lamprey
Match: cdk2 (cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2741])

HSP 1 Score: 228.409 bits (581), Expect = 3.168e-68
Identity = 124/300 (41.33%), Postives = 181/300 (60.33%), Query Frame = 3
Query: 1101 FRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKS--VITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVD 1994
            F+ ++K+GEGTYG V+KA    TG+  ALKK+RL+ E EG P TAIREI +L +L H NIV L +++            +   YLVF+++D DL   +++     I+   V S   QLL+GI +CH++  LHRD+K  N+L+N  G IKLADFGLAR +      R YT++V+TLWYR PE+LLG + YS A+D+WSLGCI  E+ T + +F    E++Q+  I +  G P+   W  +T+LP ++   PR    + L +    L +   DLL  ML+ DP +R +A  AL   +  N++
Sbjct:    4 FQKVEKIGEGTYGVVYKARHKMTGDTVALKKIRLDTETEGVPSTAIREIALLRELNHPNIVRLLDVI----------HSETKLYLVFEFLDQDLKKYMDNAPPLGISLPLVKSYMHQLLQGIAFCHAQRTLHRDLKPQNLLINADGAIKLADFGLARAF--GVPLRTYTHEVVTLWYRAPEILLGCKYYSTAVDVWSLGCIFAEMLTRRALFPGDSEIDQLFRIFRTLGTPDETVWQGITQLPDYKPSFPRWC-AQDLTKVVPLLDAAGHDLLMQMLQYDPTRRVSAKAALNHHFFHNLE 290          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Yeast
Match: CTK1 (Catalytic (alpha) subunit of C-terminal domain kinase I (CTDK-I); phosphorylates both RNA pol II subunit Rpo21p to affect transcription and pre-mRNA 3' end processing, and ribosomal protein Rps2p to increase translational fidelity; required for H3K36 trimethylation but not dimethylation by Set2p; suggested stimulatory role in 80S formation during translation initiation; similar to the Drosophila dCDK12 and human CDK12 and probably CDK13 [Source:SGD;Acc:S000001622])

HSP 1 Score: 268.47 bits (685), Expect = 2.866e-80
Identity = 146/337 (43.32%), Postives = 203/337 (60.24%), Query Frame = 3
Query: 1083 ERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHN--YKRRLREHY-CTLP-SRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRKLMR 2078
            +RS S +  I +VGEGTYG V+KA++  T +L ALKK+RL+ E+EGFPIT+IREIK+L    H N+  + EI+ +          +   Y++F+Y D+DL G+L +K V I+  Q   +FKQLL G++Y H    LHRD+K SNIL++N+G +K+ DFGLAR     + +  YTN+VITLWYRPPELLLG   Y   +D+W  GC+L ELF    +F  S E+EQ+ESI K+ G P +N WP +  +P F    P+    Y     E +   LP S+ L L   +L  D  KR +AT+AL+SD+ +  +  K +P        CHE   K  RK  R
Sbjct:  177 QRSTSVYLRIMQVGEGTYGKVYKAKNTNTEKLVALKKLRLQGEREGFPITSIREIKLLQSFDHPNVSTIKEIMVE---------SQKTVYMIFEYADNDLSGLLLNKEVQISHSQCKHLFKQLLLGMEYLHDNKILHRDVKGSNILIDNQGNLKITDFGLAR---KMNSRADYTNRVITLWYRPPELLLGTTNYGTEVDMWGCGCLLVELFNKTAIFQGSNELEQIESIFKIMGTPTINSWPTLYDMPWFFMIMPQQTTKYVNNFSEKFKSVLPSSKCLQLAINLLCYDQTKRFSATEALQSDYFK--EEPKPEPLVLDGLVSCHEYEVKLARKQKR 499          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Yeast
Match: CDC28 (Cyclin-dependent kinase (CDK) catalytic subunit; master regulator of mitotic and meiotic cell cycles; alternately associates with G1, S, G2/M phase cyclins, which provide substrate specificity; regulates metabolism, basal transcription, chromosome dynamics, growth and morphogenesis; transcript induction in osmostress involves antisense RNA; human homologs CDK1, CDK2, CDK3 can complement yeast conditional cdc28 mutants; human CDK1, CDK2 can complement yeast cdc28 null mutant [Source:SGD;Acc:S000000364])

HSP 1 Score: 219.164 bits (557), Expect = 5.329e-65
Identity = 122/297 (41.08%), Postives = 177/297 (59.60%), Query Frame = 3
Query: 1092 VSAFRFIDKVGEGTYGHVFKAEDIQTGE---LKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILES---KSVITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQA 1964
            ++ ++ ++KVGEGTYG V+KA D++ G+   + ALKK+RLE+E EG P TAIREI +L +L   NIV L +IV           D    YLVF+++D DL   +E       +  + V     QL +GI YCHS   LHRD+K  N+L+N  G +KL DFGLAR +      R YT++++TLWYR PE+LLG + YS  +D WS+GCI  E+   + +F+   E++Q+  I +V G PN   WP +  LP F+   P+   ++ L +   +L  R +DLLD +L  DP  R +A +A
Sbjct:    5 LANYKRLEKVGEGTYGVVYKALDLRPGQGQRVVALKKIRLESEDEGVPSTAIREISLLKELKDDNIVRLYDIV---------HSDAHKLYLVFEFLDLDLKRYMEGIPKDQPLGADIVKKFMMQLCKGIAYCHSHRILHRDLKPQNLLINKDGNLKLGDFGLARAFGV--PLRAYTHEIVTLWYRAPEVLLGGKQYSTGVDTWSIGCIFAEMCNRKPIFSGDSEIDQIFKIFRVLGTPNEAIWPDIVYLPDFKPSFPQWR-RKDLSQVVPSLDPRGIDLLDKLLAYDPINRISARRA 289          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Yeast
Match: PHO85 (Cyclin-dependent kinase; has ten cyclin partners; involved in regulating the cellular response to nutrient levels and environmental conditions and progression through the cell cycle; human lissencephaly-associated homolog CDK5 functionally complements null mutation [Source:SGD;Acc:S000005952])

HSP 1 Score: 217.624 bits (553), Expect = 1.793e-64
Identity = 120/308 (38.96%), Postives = 187/308 (60.71%), Query Frame = 3
Query: 1089 SVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSVITDEQ-----VASIFK-QLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFE---SYKPRHNYKRRLREHYCT-LPSRALDLLDWMLRLDPEKRCTATQALKSDWL 1982
            S S F+ ++K+G GTY  V+K  +  TG   ALK+V+L++E EG P TAIREI ++ +L H NIV L +++   +N L          LVF++MD+DL   ++S++V    +     +   F+ QLL+G+ +CH    LHRD+K  N+L+N RG++KL DFGLAR +        ++++V+TLWYR P++L+G   YS +IDIWS GCIL E+ TG+ +F  + + EQ++ I  + G PN + WP VT+LP +      +P  + ++ L+ H    L    +D L  +L+L+P+ R +A QAL   W 
Sbjct:    3 SSSQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSE-EGTPSTAIREISLMKELKHENIVRLYDVI-HTENKLT---------LVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAF--GIPVNTFSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMGTPNESLWPSVTKLPKYNPNIQQRPPRDLRQVLQPHTKEPLDGNLMDFLHGLLQLNPDMRLSAKQALHHPWF 297          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Yeast
Match: SGV1 (Cyclin (Bur2p)-dependent protein kinase; part of the BUR kinase complex which functions in transcriptional regulation; phosphorylates the carboxy-terminal domain (CTD) of Rpo21p and the C-terminal repeat domain of Spt5p; recruits Spt6p to the CTD at the onset of transcription; regulated by Cak1p; similar to metazoan CDK9 proteins [Source:SGD;Acc:S000006365])

HSP 1 Score: 223.016 bits (567), Expect = 1.022e-62
Identity = 133/345 (38.55%), Postives = 191/345 (55.36%), Query Frame = 3
Query: 1101 FRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIV----TDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSVITDE-QVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIA--DDKKRP--------YTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCT-LPSRALDLLDWMLRLDPEKRCTATQALKSDWLRN--VDSKKIKPPDFPRDRDCHELSSKKRRKLMRQ 2081
            +R  +K+G+GT+G V+K   ++T    A+KK+ +  EK+ FPITA REI IL +L H NI+ L E+V     DI NA      K +FY++  YM  DL G+L +  +  +   + ++  Q+LEG+ Y H   F+HRDIK +NIL+++ G +KLADFGLARLY     + K P        YT+ V+T WYR PEL+LG++ Y+ A+DIW +GC+  E F  + +     +++Q   I K+ G P   DW     LP  E      NYK  LRE +   L    LD L  +L LDP KR TA  A    W +   + S+KI  P      + HE   K+ ++ M Q
Sbjct:   60 YREDEKLGQGTFGEVYKGIHLETQRQVAMKKIIVSVEKDLFPITAQREITILKRLNHKNIIKLIEMVYDHSPDITNAASSNLHK-SFYMILPYMVADLSGVLHNPRINLEMCDIKNMMLQILEGLNYIHCAKFMHRDIKTANILIDHNGVLKLADFGLARLYYGCPPNLKYPGGAGSGAKYTSVVVTRWYRAPELVLGDKQYTTAVDIWGVGCVFAEFFEKKPILQGKTDIDQGHVIFKLLGTPTEEDWAVARYLPGAELTTT--NYKPTLRERFGKYLSETGLDFLGQLLALDPYKRLTAMSAKHHPWFKEDPLPSEKITLP----TEESHEADIKRYKEEMHQ 397          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Yeast
Match: KIN28 (Serine/threonine protein kinase, subunit of transcription factor TFIIH; involved in transcription initiation at RNA polymerase II promoters; phosphorylates Ser5 residue of the PolII C-terminal domain (CTD) at gene promoters; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000002266])

HSP 1 Score: 186.037 bits (471), Expect = 4.708e-53
Identity = 109/308 (35.39%), Postives = 165/308 (53.57%), Query Frame = 3
Query: 1116 KVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSVI-TDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNY----KRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFP 2024
            KVGEGTY  V+      TG   A+K+++    K+G  ++AIRE+K L ++ H N++ L +I    DN            LV +++  DL  +++ KS++ T   + +     L G+ +CH    LHRD+K +N+L +  G+IK+ADFGLAR   A  +    T+ V+T WYR PELL G + Y+ AIDIWS+G I  EL           +++QME   +  G P   DWP+V+    F +Y     Y    +  LR+ +      ALD +  ML ++P+KR TA Q L+SD+      K++ PP  P
Sbjct:   12 KVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNVIELIDIFMAYDN----------LNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEI--LTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSS---FMTYNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYF-----KELPPPSDP 299          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Nematostella
Match: EDO46173 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQW1])

HSP 1 Score: 400.593 bits (1028), Expect = 7.876e-133
Identity = 194/295 (65.76%), Postives = 233/295 (78.98%), Query Frame = 3
Query: 1101 FRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWL 1982
            F  I+++GEGTYG V+KA+D  TGEL  LKKVR +NEKEGFPITA+REIKIL QL H NI+NL EIVTD  NALDF+KDKGAFYLVF+YMDHDL G+LES  V +T++ + S  +QLL+G+ YCH +NFLHRDIKCSNIL+NN+GEIKLADFGLARLY AD++ RPYTNKVITLWYRPPELLLGEE Y P IDIWS+GCIL ELFT + +F A +E+ Q+E IS+VCG P    WP +  LP F S KP+  Y+RR+RE +  LP  ALDL D ML LDP +R TA +AL+  +L
Sbjct:    2 FDIIEQIGEGTYGQVYKAKDKITGELVGLKKVRTDNEKEGFPITAVREIKILCQLNHPNIINLKEIVTDKPNALDFRKDKGAFYLVFEYMDHDLMGLLESGLVHLTEDHIKSFIRQLLDGLNYCHKKNFLHRDIKCSNILLNNKGEIKLADFGLARLYEADER-RPYTNKVITLWYRPPELLLGEERYGPGIDIWSVGCILAELFTKKPIFPAYQEIGQLELISRVCGTPTPAVWPSIINLPHFHSIKPKRQYRRRIREEFNFLPEDALDLFDAMLTLDPSQRITAEKALEHPFL 295          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Nematostella
Match: EDO28453 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6F2])

HSP 1 Score: 350.903 bits (899), Expect = 4.287e-114
Identity = 176/287 (61.32%), Postives = 215/287 (74.91%), Query Frame = 3
Query: 1170 GELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPR 2027
            GEL  LKKVR +NEKEGFPITA+REIKIL QL H NI+NL EIVTD  NALDF+KDKGAFYLVF+YMDHDL G+LES  V +T++ + S  +QLL+G+ YCH +NFLHRDIKCSNIL+NN+GEIKLADFGLARLY AD+ +RPYTNKVITLWYRPPELLLGEE Y P IDIWS    LGE+ +   + ++ +E+    S+ +VCG P    WP +  LP F S KP+  Y+RR+RE +  LP  ALDL D ML LDP +R TA +AL+  +L +V+   I PP + R
Sbjct:    1 GELVGLKKVRTDNEKEGFPITAVREIKILCQLNHPNIINLKEIVTDKPNALDFRKDKGAFYLVFEYMDHDLMGLLESGLVHLTEDHIKSFIRQLLDGLNYCHKKNFLHRDIKCSNILLNNKGEIKLADFGLARLYEADE-RRPYTNKVITLWYRPPELLLGEERYGPGIDIWS---CLGEM-SSAIIVSSGDELSHY-SVYRVCGTPTPAVWPSIINLPHFHSIKPKRQYRRRIREEFNFLPEDALDLFDAMLTLDPSQRITAEKALEHPFLTDVNPHNIIPPRYSR 281          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Nematostella
Match: EDO34765 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNE8])

HSP 1 Score: 253.062 bits (645), Expect = 5.408e-76
Identity = 136/302 (45.03%), Postives = 189/302 (62.58%), Query Frame = 3
Query: 1092 VSAFRFIDKVGEGTYGHVFKAEDIQT-GELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLAR-LYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLRE--HYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWL 1982
            VS +    K+G+GT+G VFKA++ +   E+ ALKKV ++NEKEGFPITA+REIKIL  L H N+V L EI      A  F ++K + YLVF++ +HDL G+L +++V  +  ++  I + LL  + + HS   LHRD+K +NIL+   G +KLA+FGLAR ++I  ++K+ YTN+V+TLWYRPPELLLGE  Y P ID+W  GCI+ EL+T   +   + E  Q+  IS +CG      WP V +L LF+        KRR++E          ALDL+D ML LDP  R  A  AL  D+ 
Sbjct:   14 VSKYERQAKIGQGTFGEVFKAKNRKNPKEIVALKKVLMDNEKEGFPITALREIKILQLLNHENVVKLLEICRT--KAQPFNRNKASIYLVFEFCEHDLAGLLNNQAVKFSPPEMKKIMQMLLNALYFIHSNKILHRDMKAANILITKNGVLKLAEFGLARAIHINKEQKQRYTNRVVTLWYRPPELLLGERNYGPPIDLWGAGCIMAELWTRTPIMQGNTEQHQLTLISHLCGSITPEVWPGVDKLELFDKMVLPSGQKRRVKERLRMYVKDHNALDLIDKMLSLDPGPRIDADSALNHDYF 313          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Nematostella
Match: EDO29995 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T226])

HSP 1 Score: 243.047 bits (619), Expect = 2.626e-72
Identity = 130/347 (37.46%), Postives = 204/347 (58.79%), Query Frame = 3
Query: 1086 RSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRN----VDSKKIKPPDFPRDRDCHELSSKKRRKLMRQEKELKAHKMG 2111
            R V+ F  ++++GEGTYG V++A+D ++G++ ALKKVR+E E++G PI+ +REI +L+ L H NIV L E+V  +   LD      + +L  +Y + D+  +L++ S   ++ Q+  +  QLLEG +Y H    +HRD+K SN+L+  +G +K+ADFGLAR +      +P T  V+TLWYR PELLLG + ++ A+D+W++GCI GEL   + +     E+ Q++ I  + G PN + WP  + LP  +S   +H     L+  +  +    L LL++ML  DP KR TA ++L+S +       VD+  +  P FP  R+      K R      EK+ KAH  G
Sbjct:   31 RPVAEFEKLNRIGEGTYGIVYRAKDTKSGKIVALKKVRMEQERDGIPISGLREITLLLNLRHENIVQLLEVV--VGKHLD------SLFLSMEYCEQDIASLLDNMSCPFSEAQIKCLMIQLLEGTKYLHEHFIVHRDLKVSNLLLTGKGVLKIADFGLARTF--GYPYKPMTPVVVTLWYRSPELLLGAKVHTTAVDMWAVGCIFGELLGNKPLLAGKSEINQLQLIVDLLGTPNDHIWPGYSSLPGVKSISLKHQPYNNLKHKFSWVSQAGLSLLNYMLMYDPCKRATAAESLQSSYFVEKPLPVDADMM--PTFPEHRNF-----KNRSPTEGVEKKDKAHSRG 360          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Nematostella
Match: EDO41403 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4F0])

HSP 1 Score: 235.728 bits (600), Expect = 1.147e-70
Identity = 123/302 (40.73%), Postives = 182/302 (60.26%), Query Frame = 3
Query: 1101 FRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILES--KSVITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSK 2000
            F  ++K+GEGTYG V+KA D  TG + ALKK+RL+ E EG P TAIREI +L +L H N+V+L ++V           ++ + YLVF+++  DL   ++    S I+   + S   QLL G+ YCHS   LHRD+K  N+L++  G IKLADFGLAR +      R YT++V+TLWYR PE+LLG   Y+  +D+WS+GCI  E+ T + +F    E++Q+  I +  G P+   WP V+ LP +++  P+   +  +R    TL + A+DLL  ML   P  R +A  AL  ++ ++V  K
Sbjct:    4 FEKVEKIGEGTYGVVYKARDKTTGRMVALKKIRLDTESEGVPSTAIREISLLKELNHPNVVSLLDVV----------HNQKSLYLVFEFLSQDLKKYMDCLPPSGISTSLIKSYVYQLLSGVAYCHSHRVLHRDLKPQNLLIDKNGAIKLADFGLARAF--GVPVRSYTHEVVTLWYRAPEILLGSRYYATPVDVWSIGCIFAEMKTRRALFPGDSEIDQLFRIFRTLGTPDDKVWPGVSELPDYKTSFPKWPVQ-SIRHVLPTLDNTAIDLLQKMLTYQPNARISAKAALSHEFFKDVQRK 292          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Medaka
Match: cdk12 (cyclin-dependent kinase 12 [Source:NCBI gene;Acc:101169207])

HSP 1 Score: 479.174 bits (1232), Expect = 4.164e-150
Identity = 229/355 (64.51%), Postives = 275/355 (77.46%), Query Frame = 3
Query: 1014 VSLMKKPGICAKRSATR--NNVTWGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRK 2069
            ++L K+P IC  R   R  N   WG+R V  F  I  +GEGTYG V+KA+D  TGEL ALKKVRL+NEKEGFPITAIREIKIL QL H ++VN+ EIVTD  +ALDFKKDKGAFYLVF+YMDHDL G+LES  V  + E V S  +QL+EG+ YCH  NFLHRDIKCSNIL+NNRG+IKLADFGLARLY +++  RPYTNKVITLWYRPPELLLGEE YSPAID+WS GCILGELFT + +F A++E+ Q+E IS++CG P    WP V +LPLF + KP+  Y+RRLRE +  LP+ ALDLLD ML LDP +RCT+ QAL SD+L +V+  K+ PPD P  +DCHEL SKKRR+
Sbjct:  672 MTLKKRPKICCPRYGERKHNLSDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLKHRSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVQFSHEHVRSFMRQLMEGLDYCHKNNFLHRDIKCSNILLNNRGQIKLADFGLARLYNSEES-RPYTNKVITLWYRPPELLLGEERYSPAIDVWSCGCILGELFTKKPIFQANQELLQLELISRLCGSPCPAVWPDVIKLPLFNTMKPKKQYRRRLREEFAFLPTPALDLLDRMLTLDPARRCTSEQALTSDFLCDVEPSKMPPPDLPHHQDCHELWSKKRRR 1025          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Medaka
Match: cdk13 (cyclin dependent kinase 13 [Source:NCBI gene;Acc:101169150])

HSP 1 Score: 470.315 bits (1209), Expect = 1.712e-146
Identity = 226/383 (59.01%), Postives = 282/383 (73.63%), Query Frame = 3
Query:  999 QLSSDVSLMKKPGICAKRSATRNNVT--WGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRKLMRQEKELKAHK-----MGVDLS 2123
            +L    +  ++P IC  R      +   WG+R V  F  I   GEGTYG V+KA+D  TGE+ ALKKVRL+NEKEGFPITAIREIKIL QL H +I+N+ EIVTD ++ALDF+ DKGAFYLVF+YMDHDL G+LES  V   +  + S  +QLLEG+ YCH +NFLHRDIKCSNIL+NNRG+IKLADFGLARLY +++  RPYTNKVITLWYRPPELLLGEE Y+PAID+WS GCILGELFT + +F A++E+ Q+E IS++CG P    WP V +LP F + KP+  Y+RRLRE +  +P  ALDL D ML LDP +RCTA QAL S++L++VD  K+ PPD P  +DCHEL SKKRR+  +  +EL A K     +G+D S
Sbjct:  600 KLEKSQTFRRRPKICGPRFGEIKEIEIDWGKRCVDKFEIIGITGEGTYGQVYKAKDKDTGEMVALKKVRLDNEKEGFPITAIREIKILRQLNHKSIINMKEIVTDKEDALDFRNDKGAFYLVFEYMDHDLMGLLESGLVHFNESHIKSFMRQLLEGLDYCHKKNFLHRDIKCSNILLNNRGQIKLADFGLARLYNSEES-RPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANQELAQLELISRICGSPCPAVWPDVIKLPFFNTMKPKKQYRRRLREEFAFIPPAALDLFDHMLNLDPGRRCTAEQALSSEFLKDVDPDKMPPPDLPLWQDCHELWSKKRRRQKQMPEELVAPKAPRKELGLDDS 981          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Medaka
Match: cdk9 (cyclin dependent kinase 9 [Source:NCBI gene;Acc:101158180])

HSP 1 Score: 253.062 bits (645), Expect = 2.747e-75
Identity = 132/302 (43.71%), Postives = 187/302 (61.92%), Query Frame = 3
Query: 1095 SAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLY--IADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKV-TRLPLFESYKPRHNYKRRLREHYCTL--PSRALDLLDWMLRLDPEKRCTATQALKSDWL 1982
            S +  + K+G+GT+G VFKA+   TG+  ALKKV +ENEKEGFPITA+REIKIL  L H N+VNL EI      A  F + KG+ YLVFD+ +HDL G+L + +V  T  ++  + + LL G+ Y H    LHRD+K +N+L+   G +KLADFGLAR +    + +   YTN+V+TLWYRPPELLLGE  Y P ID+W  GCI+ E++T   +   + E  Q+  IS++CG      WP V  +  L++  +     KR++++        + ALDL+D +L LDP +R  +  AL  D+ 
Sbjct:   38 SKYEKMAKIGQGTFGEVFKAKHRTTGKKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRT--KATQFNRYKGSIYLVFDFCEHDLAGLLSNANVKFTLAEIKKVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQGNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLTLISQLCGSITAEVWPGVDKKYELYQKMELPKGQKRKVKDRLKAYVKDAYALDLIDKLLVLDPAQRIDSDDALNHDFF 337          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Medaka
Match: cdk2 (cyclin dependent kinase 2 [Source:NCBI gene;Acc:101161880])

HSP 1 Score: 239.58 bits (610), Expect = 1.512e-71
Identity = 131/302 (43.38%), Postives = 187/302 (61.92%), Query Frame = 3
Query: 1092 VSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV--ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNV 1991
            +  F+ ++K+GEGTYG V+KA++  TGE  ALKK+RL+ E EG P TAIREI +L +L H NIV L +++   +N L         YLVF+++  DL   ++S SV  I    V S   QLL+G+ +CHS   LHRD+K  N+L+N +GEIKLADFGLAR +      R YT++V+TLWYR PE+LLG + YS A+D+WSLGCI  E+ T + +F    E++Q+  I +  G P+   WP VT +P ++   P+   ++ L +    L     +LL  ML+ DP KR +A  AL   + R+V
Sbjct:    1 MDTFQKVEKIGEGTYGVVYKAKNKLTGETVALKKIRLDTETEGVPSTAIREISLLKELSHPNIVKLQDVI-HTENKL---------YLVFEFLHQDLKKFMDSSSVTGIPLALVKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINAQGEIKLADFGLARAFGV--PVRTYTHEVVTLWYRAPEILLGCKYYSTAVDVWSLGCIFAEMITRRALFPGDSEIDQLFRIFRTLGTPDETAWPGVTSMPDYKPSFPKWA-RQDLSKVVPLLDEDGRELLGEMLKYDPNKRLSAKNALVHRFFRDV 289          
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Medaka
Match: cdk10 (cyclin dependent kinase 10 [Source:NCBI gene;Acc:101169200])

HSP 1 Score: 231.876 bits (590), Expect = 5.051e-68
Identity = 120/320 (37.50%), Postives = 196/320 (61.25%), Query Frame = 3
Query: 1086 RSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILES-KSVITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRN--VDSKKIKPPDFPRDRD 2036
            RSV  F  ++++GEGTYG V++A D ++ E+ ALKKVR++ EK+G PI+++REI +L++L H NIV L E+V  + + L+      + +LV  Y + DL  +LE+ ++  ++ QV  I  QLL+G++Y H    +HRD+K SN+L+ ++G +K+ADFGLAR+Y     +   T +V+TLWYR PE+LLG +  + A+D+W++GCIL EL   + +   + E++Q++ I ++ G PN N WP  ++LPL   Y  R      L+  +  L      LL+ +   +P +R TA   L+S + +   +  +    P FP  R+
Sbjct:   35 RSVREFEKLNRIGEGTYGIVYRARDTRSNEIVALKKVRMDKEKDGIPISSLREITLLLRLRHPNIVELKEVV--VGSQLE------SLFLVMSYCEQDLASLLENMQTPFSETQVKCIVLQLLKGLEYLHHNFIIHRDLKVSNLLMTDKGYVKIADFGLARMY--GIPQPLMTPRVVTLWYRAPEVLLGTKIQTTALDMWAVGCILAELLAHKPLLPGTSEIQQVDLIVQLLGTPNENIWPGFSQLPLIGQYSLRKQPYNNLKNKFTWLSDAGHRLLNLLFMYNPLRRATAKDCLESSYFKEKPLPCEPELMPTFPHHRN 344          
BLAST of Cyclin-dependent kinase 12 vs. Planmine SMEST
Match: SMESG000057162.1 (SMESG000057162.1)

HSP 1 Score: 1367.44 bits (3538), Expect = 0.000e+0
Identity = 889/889 (100.00%), Postives = 889/889 (100.00%), Query Frame = 3
Query:   21 MNSKRKMCEPYDSESESTEKIXXXXXXXXXXXXDYSLSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXINSNYKEDSTKFDSYPSEFMDKFKKQSGIMSELQKINCSNSLLSEIQKKFQXXXXXXXXXXXXXXXXATPNKSEKVITDTPPDEIKDEPNAELFDNMNIKLEDINLXXXXXXXXXXXXXXXXXXLNEXXXXXXXXXXXXXXXLIXXXXXXXXXXXXXXXXXXXXXXXXAVFGNTEFTKLSTIPNNLPLPKIGSSVYENHINHKSEKSKNYCKPTLPLPNIPTKSVNSIFRSSKSESKIDKSLSKSHQLSSDVSLMKKPGICAKRSATRNNVTWGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSVITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRKLMRQEKELKAHKMGVDLSGEVKSSRTSSKITDXXXXXXXXXXXXXXXXXXXXXXXXXXKFDEXXXXXXXXXXXLINGDANDISEALSKLIPNAKDLIKNILEQLPKGTQFDPVKLNEALLPFVNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDNAKIDTGCNGPKKQSQPACISFDYNHGDNLLLPPDEKCLRQADQAIIRNQWR 2687
            MNSKRKMCEPYDSESESTEKIRKSRKSHHRSSSDYSLSPKRVKLEKKLKKSKKHKSSKSHKYKHSHSAKSRSRSASKRKKINSNYKEDSTKFDSYPSEFMDKFKKQSGIMSELQKINCSNSLLSEIQKKFQKSENSNSSEKSTPTPSATPNKSEKVITDTPPDEIKDEPNAELFDNMNIKLEDINLPPEPEKPKKIIEEVKAEILNEPPPPPPLTPEMVPPPLIELEKPETESELSTLLPTKEETKTKAVFGNTEFTKLSTIPNNLPLPKIGSSVYENHINHKSEKSKNYCKPTLPLPNIPTKSVNSIFRSSKSESKIDKSLSKSHQLSSDVSLMKKPGICAKRSATRNNVTWGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSVITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRKLMRQEKELKAHKMGVDLSGEVKSSRTSSKITDNNSKSHNSSSVPVSVGIGNNNNSSRNKFDEKSDKSDSYYDKLINGDANDISEALSKLIPNAKDLIKNILEQLPKGTQFDPVKLNEALLPFVNQINNASSSTSLSSSNSKPQQQQQQHVSNDDNAKIDTGCNGPKKQSQPACISFDYNHGDNLLLPPDEKCLRQADQAIIRNQWR
Sbjct:    1 MNSKRKMCEPYDSESESTEKIRKSRKSHHRSSSDYSLSPKRVKLEKKLKKSKKHKSSKSHKYKHSHSAKSRSRSASKRKKINSNYKEDSTKFDSYPSEFMDKFKKQSGIMSELQKINCSNSLLSEIQKKFQKSENSNSSEKSTPTPSATPNKSEKVITDTPPDEIKDEPNAELFDNMNIKLEDINLPPEPEKPKKIIEEVKAEILNEPPPPPPLTPEMVPPPLIELEKPETESELSTLLPTKEETKTKAVFGNTEFTKLSTIPNNLPLPKIGSSVYENHINHKSEKSKNYCKPTLPLPNIPTKSVNSIFRSSKSESKIDKSLSKSHQLSSDVSLMKKPGICAKRSATRNNVTWGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSVITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRKLMRQEKELKAHKMGVDLSGEVKSSRTSSKITDNNSKSHNSSSVPVSVGIGNNNNSSRNKFDEKSDKSDSYYDKLINGDANDISEALSKLIPNAKDLIKNILEQLPKGTQFDPVKLNEALLPFVNQINNASSSTSLSSSNSKPQQQQQQHVSNDDNAKIDTGCNGPKKQSQPACISFDYNHGDNLLLPPDEKCLRQADQAIIRNQWR 889          
BLAST of Cyclin-dependent kinase 12 vs. Planmine SMEST
Match: SMESG000057162.1 (SMESG000057162.1)

HSP 1 Score: 1355.89 bits (3508), Expect = 0.000e+0
Identity = 883/883 (100.00%), Postives = 883/883 (100.00%), Query Frame = 3
Query:   39 MCEPYDSESESTEKIXXXXXXXXXXXXDYSLSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXINSNYKEDSTKFDSYPSEFMDKFKKQSGIMSELQKINCSNSLLSEIQKKFQXXXXXXXXXXXXXXXXATPNKSEKVITDTPPDEIKDEPNAELFDNMNIKLEDINLXXXXXXXXXXXXXXXXXXLNEXXXXXXXXXXXXXXXLIXXXXXXXXXXXXXXXXXXXXXXXXAVFGNTEFTKLSTIPNNLPLPKIGSSVYENHINHKSEKSKNYCKPTLPLPNIPTKSVNSIFRSSKSESKIDKSLSKSHQLSSDVSLMKKPGICAKRSATRNNVTWGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSVITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRKLMRQEKELKAHKMGVDLSGEVKSSRTSSKITDXXXXXXXXXXXXXXXXXXXXXXXXXXKFDEXXXXXXXXXXXLINGDANDISEALSKLIPNAKDLIKNILEQLPKGTQFDPVKLNEALLPFVNXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDNAKIDTGCNGPKKQSQPACISFDYNHGDNLLLPPDEKCLRQADQAIIRNQWR 2687
            MCEPYDSESESTEKIRKSRKSHHRSSSDYSLSPKRVKLEKKLKKSKKHKSSKSHKYKHSHSAKSRSRSASKRKKINSNYKEDSTKFDSYPSEFMDKFKKQSGIMSELQKINCSNSLLSEIQKKFQKSENSNSSEKSTPTPSATPNKSEKVITDTPPDEIKDEPNAELFDNMNIKLEDINLPPEPEKPKKIIEEVKAEILNEPPPPPPLTPEMVPPPLIELEKPETESELSTLLPTKEETKTKAVFGNTEFTKLSTIPNNLPLPKIGSSVYENHINHKSEKSKNYCKPTLPLPNIPTKSVNSIFRSSKSESKIDKSLSKSHQLSSDVSLMKKPGICAKRSATRNNVTWGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSVITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRKLMRQEKELKAHKMGVDLSGEVKSSRTSSKITDNNSKSHNSSSVPVSVGIGNNNNSSRNKFDEKSDKSDSYYDKLINGDANDISEALSKLIPNAKDLIKNILEQLPKGTQFDPVKLNEALLPFVNQINNASSSTSLSSSNSKPQQQQQQHVSNDDNAKIDTGCNGPKKQSQPACISFDYNHGDNLLLPPDEKCLRQADQAIIRNQWR
Sbjct:    1 MCEPYDSESESTEKIRKSRKSHHRSSSDYSLSPKRVKLEKKLKKSKKHKSSKSHKYKHSHSAKSRSRSASKRKKINSNYKEDSTKFDSYPSEFMDKFKKQSGIMSELQKINCSNSLLSEIQKKFQKSENSNSSEKSTPTPSATPNKSEKVITDTPPDEIKDEPNAELFDNMNIKLEDINLPPEPEKPKKIIEEVKAEILNEPPPPPPLTPEMVPPPLIELEKPETESELSTLLPTKEETKTKAVFGNTEFTKLSTIPNNLPLPKIGSSVYENHINHKSEKSKNYCKPTLPLPNIPTKSVNSIFRSSKSESKIDKSLSKSHQLSSDVSLMKKPGICAKRSATRNNVTWGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSVITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRKLMRQEKELKAHKMGVDLSGEVKSSRTSSKITDNNSKSHNSSSVPVSVGIGNNNNSSRNKFDEKSDKSDSYYDKLINGDANDISEALSKLIPNAKDLIKNILEQLPKGTQFDPVKLNEALLPFVNQINNASSSTSLSSSNSKPQQQQQQHVSNDDNAKIDTGCNGPKKQSQPACISFDYNHGDNLLLPPDEKCLRQADQAIIRNQWR 883          
BLAST of Cyclin-dependent kinase 12 vs. Planmine SMEST
Match: SMESG000078149.1 (SMESG000078149.1)

HSP 1 Score: 488.804 bits (1257), Expect = 8.655e-162
Identity = 237/401 (59.10%), Postives = 295/401 (73.57%), Query Frame = 3
Query:  903 LPLPNIPTKSVNSIFRSSKSESKIDKSLSKSHQLSSDVSLMKKPGICAKRSATRNNVTWGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSVITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRKLMRQEKELKAHK 2105
            LPLP +P  S N+  ++ K E +I               + K P IC  RS  +N     ERSV +F+ I +VGEGTYGHVFKA D QT  +KALKK+RLENE+EGFPIT +REIKIL +L H NI+ L E+VTD D+  +  K KG FYLVF+YMDHDL+GIL+S   + + Q+ASI KQ++ GI YCH R FLHRDIK SNILVNN+GE+K+ADFGLAR + AD+ KRPYTNKVITLWYR PELLLGEE Y  AID+WS+GCI+GELF  +TMFTAS EM+Q+E+ISKVCG PN   WP VT+LPLF +++P+ NYKRRLRE+YCTLP  AL++LDWML+LDP++RC+  QAL S WLR +D K+I PP FP D+D HELS K+R +    +   K+ K
Sbjct:  117 LPLPVVP--SNNTHVKNDKKEKEI---------------IFKMPKICESRSRIKNT----ERSVKSFKIIAEVGEGTYGHVFKAIDRQTNAMKALKKIRLENEREGFPITTVREIKILHKLNHPNIIYLNEVVTDYDSKSN-SKVKG-FYLVFEYMDHDLYGILDSGITLNENQIASIMKQIISGICYCHKRKFLHRDIKSSNILVNNKGEVKIADFGLARKFEADNSKRPYTNKVITLWYRAPELLLGEEIYGEAIDVWSIGCIMGELFVRRTMFTASNEMDQLETISKVCGTPNAGIWPNVTKLPLFATFRPKCNYKRRLREYYCTLPHSALEVLDWMLQLDPKRRCSTEQALNSYWLRKIDPKQIPPPAFPADKDYHELSCKRRHRQNHSDTGYKSSK 494          
BLAST of Cyclin-dependent kinase 12 vs. Planmine SMEST
Match: SMESG000055046.1 (SMESG000055046.1)

HSP 1 Score: 235.728 bits (600), Expect = 4.758e-68
Identity = 132/323 (40.87%), Postives = 194/323 (60.06%), Query Frame = 3
Query: 1080 GERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILES-KSVITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESY------KPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALKSDWLRNVDSKKIKPPDFPR 2027
            G R +S + F++K+ EGTYG VF+A+D +T E+ ALK++++ENEK GFPIT++RE+  LM+  H NIV + E+V  + N LD      + YLV D+++HDL  +++         +V  +  QLLE I + H    +HRD+K SN+L+++ G +K+ADFGLAR Y +  K   YTN V+TLWYR PELLLG++ YS  ID+WS+GCI GEL   + +F    EMEQ++ + +  GVP    WP V+ LP+ +        KPR+  ++RL      L      + + +L   PEKR TA +A K  +        I P  FP+
Sbjct:  156 GCRFLSNYEFLNKIEEGTYGEVFRAKDKKTKEIVALKRLKMENEKYGFPITSLREVNTLMKAQHENIVTVREVV--VGNDLD------SIYLVMDFVEHDLKSLMKIINRAFEISEVKCLMLQLLEAIAHLHDNWIIHRDLKTSNLLLSHNGILKVADFGLAREYGSPLKS--YTNLVVTLWYRAPELLLGQKMYSTNIDMWSVGCIFGELLLNRALFAGKSEMEQIQILFRELGVPTEETWPGVSELPMMKKVNFKLKEKPRN--EKRLSNR---LSLGGKYVFNKLLTFCPEKRFTAEEAKKHYYFSET-PLPIHPQQFPK 462          
BLAST of Cyclin-dependent kinase 12 vs. Planmine SMEST
Match: SMESG000028783.1 (SMESG000028783.1)

HSP 1 Score: 232.261 bits (591), Expect = 6.356e-68
Identity = 134/305 (43.93%), Postives = 187/305 (61.31%), Query Frame = 3
Query: 1086 RSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEGFPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYMDHDLFGILESKSV-ITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILVNNRGEIKLADFGLARLYIAD---DKKRPYTNKVITLWYRPPELLLGEECYSPAIDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRLPLFESYKPRHNYKRRLREHYCTLP--SRALDLLDWMLRLDPEKRCTATQALKSDWL 1982
            + V  +  + K+G+GT+G VFK  DIQT +  ALK+++LE EKEGFPITA+REIKIL  L H NIV L EI     +    K  K  FYL+FD  DHDL G+L  +++  +  Q  SI KQL  GI Y H  N +HRD+K +NIL+   G +K+ADFGLAR  I     D    YT++V+T+WYRPPE+LL +  Y  ++D+W  GCI+ EL+T   +     E+ Q++ I  +CG  N   WP V++L  F+  + R N+KR +R+    +     A+DL+D +L LDP KR TA  AL  ++ 
Sbjct:   36 KHVDQYEKLQKIGQGTFGEVFKVRDIQTKKYYALKRIKLEQEKEGFPITALREIKILQSLNHPNIVCLREICC--SSPTKEKLYKPEFYLLFDLCDHDLAGLLSDQNMKFSLPQRKSIMKQLFTGIFYLHRNNVIHRDLKAANILIEKHGTLKIADFGLARYTIKSPKPDHPPKYTSRVVTMWYRPPEILLNDRHYDKSVDMWGAGCIMAELWTKYPIMQGESEIHQLKLIINLCGSINEESWPGVSKLEAFKRLE-RTNHKRFVRQQLLKVIDCHSAVDLIDKLLLLDPRKRLTADIALMHEFF 337          
The following BLAST results are available for this feature:
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CDK123.113e-15163.82cyclin dependent kinase 12 [Source:HGNC Symbol;Acc... [more]
CDK125.958e-14963.82cyclin dependent kinase 12 [Source:HGNC Symbol;Acc... [more]
CDK121.076e-14863.82cyclin dependent kinase 12 [Source:HGNC Symbol;Acc... [more]
CDK131.224e-14662.39cyclin dependent kinase 13 [Source:HGNC Symbol;Acc... [more]
CDK131.898e-14662.39cyclin dependent kinase 13 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdk-125.563e-12551.50Cyclin-dependent kinase 12 [Source:UniProtKB/Swis... [more]
cdk-126.360e-12551.50Cyclin-dependent kinase 12 [Source:UniProtKB/Swis... [more]
cdk-126.826e-12551.50Cyclin-dependent kinase 12 [Source:UniProtKB/Swis... [more]
cdk-91.319e-7137.72Probable cyclin-dependent kinase 9 [Source:UniPro... [more]
cdk-91.667e-7137.72Probable cyclin-dependent kinase 9 [Source:UniPro... [more]
back to top
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cdk121.136e-14062.75gene:FBgn0037093 transcript:FBtr0078357[more]
Cdk121.136e-14062.75gene:FBgn0037093 transcript:FBtr0332716[more]
Cdk121.136e-14062.75gene:FBgn0037093 transcript:FBtr0078358[more]
Cdk97.688e-6944.79gene:FBgn0019949 transcript:FBtr0071937[more]
Cdk29.264e-6741.53gene:FBgn0004107 transcript:FBtr0083922[more]
back to top
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdk124.386e-14963.84cyclin-dependent kinase 12 [Source:ZFIN;Acc:ZDB-GE... [more]
cdk132.825e-14761.98cyclin-dependent kinase 13 [Source:ZFIN;Acc:ZDB-GE... [more]
cdk94.258e-7744.55cyclin-dependent kinase 9 (CDC2-related kinase) [S... [more]
cdk99.020e-7644.55cyclin-dependent kinase 9 (CDC2-related kinase) [S... [more]
cdk99.020e-7644.55cyclin-dependent kinase 9 (CDC2-related kinase) [S... [more]
back to top
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdk122.243e-15263.46cyclin-dependent kinase 12 [Source:NCBI gene;Acc:1... [more]
cdk122.602e-15063.46cyclin-dependent kinase 12 [Source:NCBI gene;Acc:1... [more]
cdk123.701e-15063.46cyclin-dependent kinase 12 [Source:NCBI gene;Acc:1... [more]
cdk121.575e-14963.46cyclin-dependent kinase 12 [Source:NCBI gene;Acc:1... [more]
cdk121.055e-14863.46cyclin-dependent kinase 12 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cdk135.295e-15162.39cyclin-dependent kinase 13 [Source:MGI Symbol;Acc:... [more]
Cdk122.196e-15064.10cyclin-dependent kinase 12 [Source:MGI Symbol;Acc:... [more]
Cdk121.502e-14864.10cyclin-dependent kinase 12 [Source:MGI Symbol;Acc:... [more]
Cdk122.916e-14864.10cyclin-dependent kinase 12 [Source:MGI Symbol;Acc:... [more]
Cdk131.026e-14662.39cyclin-dependent kinase 13 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Cyclin-dependent kinase 12 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B5DE93|CDK12_XENTR5.570e-14963.46Cyclin-dependent kinase 12 OS=Xenopus tropicalis O... [more]
sp|Q9NYV4|CDK12_HUMAN5.168e-14863.82Cyclin-dependent kinase 12 OS=Homo sapiens OX=9606... [more]
sp|Q14AX6|CDK12_MOUSE2.040e-14764.10Cyclin-dependent kinase 12 OS=Mus musculus OX=1009... [more]
sp|Q3MJK5|CDK12_RAT2.666e-14764.10Cyclin-dependent kinase 12 OS=Rattus norvegicus OX... [more]
sp|D2H526|CDK12_AILME5.953e-14763.82Cyclin-dependent kinase 12 OS=Ailuropoda melanoleu... [more]
back to top
BLAST of Cyclin-dependent kinase 12 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3PWT40.000e+059.78Protein kinase domain-containing protein OS=Schist... [more]
A0A0X3PU840.000e+059.78Protein kinase domain-containing protein OS=Schist... [more]
A0A183SXW50.000e+059.78Protein kinase domain-containing protein OS=Schist... [more]
A0A0X3P5G70.000e+059.78Protein kinase domain-containing protein OS=Schist... [more]
A0A0X3NHI90.000e+059.78Protein kinase domain-containing protein OS=Schist... [more]
back to top
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdk124.813e-14863.82cyclin dependent kinase 12 [Source:NCBI gene;Acc:1... [more]
cdk125.539e-14863.82cyclin dependent kinase 12 [Source:NCBI gene;Acc:1... [more]
cdk132.401e-14661.33cyclin dependent kinase 13 [Source:NCBI gene;Acc:1... [more]
cdk94.531e-7544.55cyclin-dependent kinase 9 (CDC2-related kinase) [S... [more]
cdk101.799e-7439.69cyclin dependent kinase 10 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000855.11.094e-14963.82pep scaffold:Pmarinus_7.0:GL480767:13986:34488:-1 ... [more]
ENSPMAT00000000851.11.342e-14864.10pep scaffold:Pmarinus_7.0:GL480767:12807:33146:-1 ... [more]
ENSPMAT00000000850.11.759e-14864.10pep scaffold:Pmarinus_7.0:GL480767:12801:33146:-1 ... [more]
cdk21.782e-7243.79cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
cdk23.168e-6841.33cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CTK12.866e-8043.32Catalytic (alpha) subunit of C-terminal domain kin... [more]
CDC285.329e-6541.08Cyclin-dependent kinase (CDK) catalytic subunit; m... [more]
PHO851.793e-6438.96Cyclin-dependent kinase; has ten cyclin partners; ... [more]
SGV11.022e-6238.55Cyclin (Bur2p)-dependent protein kinase; part of t... [more]
KIN284.708e-5335.39Serine/threonine protein kinase, subunit of transc... [more]
back to top
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461737.876e-13365.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO284534.287e-11461.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO347655.408e-7645.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO299952.626e-7237.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414031.147e-7040.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cyclin-dependent kinase 12 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdk124.164e-15064.51cyclin-dependent kinase 12 [Source:NCBI gene;Acc:1... [more]
cdk131.712e-14659.01cyclin dependent kinase 13 [Source:NCBI gene;Acc:1... [more]
cdk92.747e-7543.71cyclin dependent kinase 9 [Source:NCBI gene;Acc:10... [more]
cdk21.512e-7143.38cyclin dependent kinase 2 [Source:NCBI gene;Acc:10... [more]
cdk105.051e-6837.50cyclin dependent kinase 10 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Cyclin-dependent kinase 12 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000057162.10.000e+0100.00SMESG000057162.1[more]
SMESG000057162.10.000e+0100.00SMESG000057162.1[more]
SMESG000078149.18.655e-16259.10SMESG000078149.1[more]
SMESG000055046.14.758e-6840.87SMESG000055046.1[more]
SMESG000028783.16.356e-6843.93SMESG000028783.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002908 ID=SMED30002908|Name=Cyclin-dependent kinase 12|organism=Schmidtea mediterranea sexual|type=transcript|length=2808bp
CTATATAAATCTTATATGATATGAATAGCAAAAGAAAAATGTGCGAACCA
TATGATAGTGAATCAGAATCAACTGAAAAAATTAGAAAATCACGGAAATC
ACACCATAGATCTTCTAGTGATTATTCTCTGTCTCCGAAAAGAGTTAAGC
TTGAAAAAAAATTAAAAAAATCTAAAAAACATAAATCTAGTAAATCTCAT
AAATATAAGCACTCACATAGTGCTAAATCTAGATCTAGAAGTGCTTCAAA
AAGGAAAAAAATCAACTCTAATTATAAGGAGGATTCAACAAAATTTGATT
CATACCCTTCTGAATTTATGGATAAATTTAAAAAACAGTCAGGAATAATG
TCTGAATTACAAAAAATTAATTGTTCTAACTCTTTATTGAGTGAAATACA
AAAAAAGTTTCAAAAATCAGAAAATAGTAATTCCAGTGAAAAATCGACAC
CCACACCATCTGCAACTCCAAATAAATCAGAAAAAGTCATTACTGACACA
CCACCCGATGAAATCAAGGATGAACCAAATGCAGAGCTTTTTGACAATAT
GAATATAAAATTGGAAGATATTAATTTACCCCCTGAACCTGAAAAACCTA
AAAAGATAATCGAAGAAGTTAAAGCAGAAATTTTAAATGAACCACCCCCT
CCGCCTCCATTAACACCTGAAATGGTTCCACCACCCCTAATTGAATTAGA
AAAACCAGAAACTGAGAGCGAACTTAGTACACTTCTTCCAACTAAGGAAG
AAACGAAAACTAAAGCTGTTTTTGGAAACACAGAATTTACCAAATTATCA
ACAATTCCCAACAATTTGCCGTTGCCGAAAATCGGTAGTTCAGTCTATGA
AAACCATATCAATCACAAATCAGAAAAGTCAAAGAACTATTGTAAGCCAA
CTCTACCTCTTCCGAATATACCTACGAAATCCGTCAATTCAATTTTTAGA
TCAAGTAAATCCGAGAGCAAAATTGATAAATCTCTATCTAAAAGTCATCA
GCTTTCATCAGATGTATCTTTAATGAAAAAACCTGGAATATGTGCAAAAC
GTAGTGCAACTAGAAATAACGTAACATGGGGTGAACGATCGGTCAGCGCT
TTCAGATTCATAGACAAAGTCGGTGAAGGAACTTATGGGCACGTGTTCAA
GGCCGAAGATATTCAAACTGGAGAATTGAAAGCCCTGAAAAAAGTCAGAT
TAGAAAATGAAAAAGAAGGCTTTCCAATAACGGCAATTCGGGAAATCAAG
ATTTTGATGCAATTAGTCCATGCTAATATAGTGAATTTGTGCGAAATCGT
CACCGACATAGACAATGCTTTGGATTTCAAAAAAGATAAAGGCGCATTTT
ATTTGGTGTTTGATTACATGGATCATGATTTGTTTGGGATTCTTGAATCA
AAATCTGTCATTACTGACGAACAAGTCGCATCAATTTTCAAACAATTACT
CGAAGGAATTCAATACTGTCACAGTCGAAATTTCCTTCATCGCGACATCA
AATGCTCGAATATTTTAGTCAATAACAGAGGAGAGATAAAACTAGCGGAT
TTCGGATTAGCCCGACTTTATATTGCCGATGATAAAAAACGACCATATAC
AAACAAAGTGATAACGTTGTGGTATCGACCACCAGAGCTATTGTTGGGTG
AGGAATGTTATAGTCCCGCAATAGATATTTGGTCGCTGGGCTGTATTCTT
GGTGAATTGTTCACCGGACAAACTATGTTCACTGCAAGTGAAGAAATGGA
ACAAATGGAATCAATTTCCAAAGTTTGTGGAGTGCCTAATGTAAACGATT
GGCCCAAAGTCACTCGATTGCCTTTATTTGAATCATACAAACCCAGACAC
AATTATAAACGGCGACTGCGTGAACATTATTGCACATTACCGTCACGAGC
TCTCGATTTATTGGACTGGATGTTGAGACTAGATCCAGAAAAGCGTTGCA
CGGCAACACAAGCATTGAAAAGTGACTGGCTACGCAATGTCGATTCGAAA
AAGATAAAACCACCCGATTTCCCTAGAGACAGAGATTGCCATGAACTGTC
CAGTAAAAAAAGGCGCAAGCTAATGCGACAGGAAAAAGAATTGAAAGCAC
ACAAAATGGGAGTGGATTTATCGGGAGAAGTGAAAAGCAGTCGTACTAGT
TCAAAAATCACAGACAATAATAGTAAAAGTCACAATTCATCGTCAGTTCC
AGTGTCTGTAGGAATCGGTAACAATAACAATTCATCGAGAAATAAATTCG
ACGAAAAAAGTGATAAATCTGACAGTTATTATGACAAATTGATTAATGGG
GACGCTAACGATATTTCTGAAGCTCTCTCGAAATTGATTCCAAATGCCAA
AGATCTCATCAAAAATATTCTAGAACAATTACCGAAAGGAACTCAATTTG
ACCCAGTTAAGCTAAACGAAGCACTTCTTCCATTTGTGAATCAGATCAAT
AATGCATCATCATCGACATCATTATCATCGAGCAACTCTAAACCGCAACA
GCAGCAACAGCAACATGTCAGCAATGATGATAATGCCAAAATTGATACCG
GCTGTAACGGGCCTAAGAAACAATCCCAACCTGCCTGTATATCATTTGAT
TATAATCATGGCGATAATTTATTGTTGCCGCCTGATGAGAAATGTCTCCG
TCAAGCAGATCAAGCAATTATCAGAAACCAATGGCGATCAAATAATAGTA
AGGAGATTTCGTCTAGTTCCAAACTAAATTCAGATTATTATTTCATTGGC
AATAAACACCCATAAAACATTTTTTTTTCACCAATAGTTTTTGCTTCTGT
ATTCATTA
back to top

protein sequence of SMED30002908-orf-1

>SMED30002908-orf-1 ID=SMED30002908-orf-1|Name=SMED30002908-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=915bp
MNSKRKMCEPYDSESESTEKIRKSRKSHHRSSSDYSLSPKRVKLEKKLKK
SKKHKSSKSHKYKHSHSAKSRSRSASKRKKINSNYKEDSTKFDSYPSEFM
DKFKKQSGIMSELQKINCSNSLLSEIQKKFQKSENSNSSEKSTPTPSATP
NKSEKVITDTPPDEIKDEPNAELFDNMNIKLEDINLPPEPEKPKKIIEEV
KAEILNEPPPPPPLTPEMVPPPLIELEKPETESELSTLLPTKEETKTKAV
FGNTEFTKLSTIPNNLPLPKIGSSVYENHINHKSEKSKNYCKPTLPLPNI
PTKSVNSIFRSSKSESKIDKSLSKSHQLSSDVSLMKKPGICAKRSATRNN
VTWGERSVSAFRFIDKVGEGTYGHVFKAEDIQTGELKALKKVRLENEKEG
FPITAIREIKILMQLVHANIVNLCEIVTDIDNALDFKKDKGAFYLVFDYM
DHDLFGILESKSVITDEQVASIFKQLLEGIQYCHSRNFLHRDIKCSNILV
NNRGEIKLADFGLARLYIADDKKRPYTNKVITLWYRPPELLLGEECYSPA
IDIWSLGCILGELFTGQTMFTASEEMEQMESISKVCGVPNVNDWPKVTRL
PLFESYKPRHNYKRRLREHYCTLPSRALDLLDWMLRLDPEKRCTATQALK
SDWLRNVDSKKIKPPDFPRDRDCHELSSKKRRKLMRQEKELKAHKMGVDL
SGEVKSSRTSSKITDNNSKSHNSSSVPVSVGIGNNNNSSRNKFDEKSDKS
DSYYDKLINGDANDISEALSKLIPNAKDLIKNILEQLPKGTQFDPVKLNE
ALLPFVNQINNASSSTSLSSSNSKPQQQQQQHVSNDDNAKIDTGCNGPKK
QSQPACISFDYNHGDNLLLPPDEKCLRQADQAIIRNQWRSNNSKEISSSS
KLNSDYYFIGNKHP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 362..655
e-value: 3.1E-91
score: 319.1
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 363..655
e-value: 9.5E-72
score: 241.5
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 362..655
score: 43.707
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 348..452
e-value: 4.0E-38
score: 131.5
NoneNo IPR availablePFAMPF12330Haspin_kinasecoord: 283..527
e-value: 3.0E-9
score: 36.3
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 453..696
e-value: 8.2E-75
score: 253.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 665..684
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 815..837
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 44..80
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 690..751
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 704..741
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..23
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 128..157
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..93
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 128..177
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 158..174
NoneNo IPR availablePANTHERPTHR24056:SF362CYCLIN-DEPENDENT KINASE 12coord: 318..733
NoneNo IPR availablePANTHERPTHR24056CELL DIVISION PROTEIN KINASEcoord: 318..733
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 489..501
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 354..659