Triple functional domain protein

Overview
NameTriple functional domain protein
Smed IDSMED30002902
Length (bp)8033
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Triple functional domain protein (SMED30002902) t-SNE clustered cells

Violin plots show distribution of expression levels for Triple functional domain protein (SMED30002902) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Triple functional domain protein (SMED30002902) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Triple functional domain protein (SMED30002902) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002902

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30002902SMESG000061508.1 SMESG000027427.1 dd_Smed_v4_5483_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30002902SMESG000061508.1 SMESG000027427.1 dd_Smed_v4_5483_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002902SMESG000061508.1 SMESG000027427.1 dd_Smed_v4_5483_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Triple functional domain protein vs. Ensembl Human
Match: TRIO (trio Rho guanine nucleotide exchange factor [Source:HGNC Symbol;Acc:HGNC:12303])

HSP 1 Score: 663.3 bits (1710), Expect = 0.000e+0
Identity = 403/1152 (34.98%), Postives = 633/1152 (54.95%), Query Frame = 3
Query:  486 LKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRLVEE----------DEKNHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFE---ADVASAIDCLKHEVPTPMSYNF------LNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGK----SSVQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFI---RVKAEADELIHNFDEAGVSS 3860
            +KA D+L +LK  +A L G RDKRGGP+L FPA S+ D +  EDL  L+ YL  +P E V K  F+V++DMR G+ W S+KP+LK+L+E    C     IIKP+ F++KQ+    SSKF F+  +VS + L + +D SQLT  FDG L Y++EEWIEIR+  ED+ + A  M  +   L   L +K++P+ +  ++  +E+H  ++ K+I+AP+  L+ EG KL   L+   +S++  + +  + N D Q L+P+V   + +L+  R HL   W   + +L+Q +QLRLFE D  +M +W+   + LFL  Y +IG +   A +L  +H  F +NC +V   ++R+  VAN L +SGHYAS QI+  A +L+ +WK+F  AL++RS +L +S+ FH +AE +++N   W  A  + ++       +  L   I   Q +++   +A+ EV  DG++L   L  P+  GS  SL A+ +YS+   H   ++HEV    +++E +  HR  RL  RL L +F++DV QVL W+  HGE FL + T VGKSL RA  L   H  FEEVA NT  NA+KL+ AA++L      DPEEI Q   +LE RIQ F + VE R+  LD++V FH H K+L+ W  +L++     ++   ++E V+D ++RF  +++  L     V+KEG  L  +L +              NH + +L Q+   +    +L  ER+++L+L LQLR+FE    D+ S ++    E+   M+ +F      + + RL    ++   +       I  G++++Q  +E+    ++ GV           + V D  E+  E+ Q L        +A ++    L+  +  R L+ + +QVL WI   + ML    +  S+L EAEQLQ EH++FQ  + + H  A+     AE  +Q   + +                             ++ AE VA  WQ+L+   E++ KL+ A+  +YKTS+QV SVL SLE+EY+R EDWC          +  ++  ++S+H EQKEAFLKAC LARR ++ F+KYL R     PG      + +++V   + +L  +E  VL  W  RK RLD+C  ++   R   +A E IH+  E  +S+
Sbjct:   11 MKAMDVLPILKEKVAYLSGGRDKRGGPILTFPARSNHDRIRQEDLRRLISYLACIPSEEVCKRGFTVIVDMR-GSKWDSIKPLLKILQESFPCCIHVALIIKPDNFWQKQRTNFGSSKFEFETNMVSLEGLTKVVDPSQLTPEFDGCLEYNHEEWIEIRVAFEDYISNATHMLSRLEELQDILAKKELPQDLEGARNMIEEHSQLKKKVIKAPIEDLDLEGQKL---LQRIQSSESFPKKNSGSGNADLQNLLPKVSTMLDRLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAEKMFDWITHNKGLFLNSYTEIGTSHPHAMELQTQHNHFAMNCMNVYVNINRIMSVANRLVESGHYASQQIRQIASQLEQEWKAFAAALDERSTLLDMSSIFHQKAEKYMSNVDSWCKACGEVDLP----SELQDLEDAIHHHQGIYEHITLAYSEVSQDGKSLLDKLQRPLTPGSSDSLTASANYSKAVHHVLDVIHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYQAAHQLEDRIQDFVRRVEQRKILLDMSVSFHTHVKELWTWLEELQKE-LLDDVYAESVEAVQDLIKRFGQQQQTTLQVTVNVIKEGEDLIQQLRDSAISSNKTPHNSSINHIETVLQQLDEAQSQMEELFQERKIKLELFLQLRIFERDAIDIISDLESWNDELSQQMN-DFDTEDLTIAEQRLQHHADKALTMNNLTFDVIHQGQDLLQYVNEV----QASGVELLCDRDVDMATRVQDLLEFLHEKQQELD-------LAAEQHRKHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEAMLQANHYDMDM--------------------------IRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAFLKACTLARRNADVFLKYLHRNSVNMPGMVTHIKAPEQQVKNILNELFQRENRVLHYWTMRKRRLDQCQQYVVFERSAKQALEWIHDNGEFYLST 1115          

HSP 2 Score: 197.208 bits (500), Expect = 1.330e-49
Identity = 103/278 (37.05%), Postives = 169/278 (60.79%), Query Frame = 3
Query: 4230 KAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKI-DFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLT 5060
            K+A+++  ++ E+IQTE  YV DL   + TY   +  G+ +I  P  +V ++ ++F N++EI EFH ++FL E+ +Y+               LPED+GHCF+ +A+ F+ +YV Y  NK +  Q+++E    +F+E+          + N+I S+ IKPVQRITKY + LK+L   C+ G  GE+ +  EVML + KR ND +HL  ++G  E+  +ES G+ IL + F VW+P+ +I+KGR+R +FLF++ LV +K+      +  Y YKS + ++
Sbjct: 1239 KSARRKEFIMAELIQTEKAYVRDLRECMDTYLWEMTSGVEEI--PPGIVNKELIIFGNMQEIYEFHNNIFLKELEKYEQ--------------LPEDVGHCFVTWADKFQ-MYVTYCKNKPDSTQLILEHAGSYFDEIQQ-----RHGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGK-GEIKDGLEVMLSVPKRANDAMHLSMLEGFDEN--IESQGELILQESFQVWDPKTLIRKGRERHLFLFEMSLVFSKEVKDSSGRSKYLYKSKLFVS 1491          

HSP 3 Score: 85.1149 bits (209), Expect = 2.017e-15
Identity = 86/393 (21.88%), Postives = 166/393 (42.24%), Query Frame = 3
Query: 1191 NQTRSSWVTMNPDYQ-QLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETV--NSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGF 2357
            N+ ++S V +  D    +  +V+  ++ L+E +  L    +  R  LEQ  QLR  + ++ ++  W+     + L        +  +A  L  EH QF        +   ++   A  +  + HY    I+  A K+   W+     +EDR  ++  S +F+  +E   +     E   K++    G  + +  NS   ++T +     E + A  + C+  R  A      + + S              +   ++++E++    RV      R +RL      ++F     Q L W++++GE +L   TS G S+Q  ++L   H +F+  A  T    + LI  AD    + H    EI +  T +++R + F+  +E  R +L+ A+G 
Sbjct:  808 NEVQASGVELLCDRDVDMATRVQDLLEFLHEKQQELDLAAEQHRKHLEQCVQLRHLQAEVKQVLGWIRNGESM-LNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEAMLQANHYDMDMIRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAFLKACTLARRNADVFLKYLHRNSVNMPGMVTHIKAPEQQVKNILNELFQRENRVLHYWTMRKRRLDQCQQYVVFERSAKQALEWIHDNGEFYLSTHTSTGSSIQHTQELLKEHEEFQITAKQTKERVKLLIQLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRMEKYRTSLEKALGI 1199          
BLAST of Triple functional domain protein vs. Ensembl Human
Match: TRIO (trio Rho guanine nucleotide exchange factor [Source:HGNC Symbol;Acc:HGNC:12303])

HSP 1 Score: 663.3 bits (1710), Expect = 0.000e+0
Identity = 403/1152 (34.98%), Postives = 633/1152 (54.95%), Query Frame = 3
Query:  486 LKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRLVEE----------DEKNHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFE---ADVASAIDCLKHEVPTPMSYNF------LNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGK----SSVQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFI---RVKAEADELIHNFDEAGVSS 3860
            +KA D+L +LK  +A L G RDKRGGP+L FPA S+ D +  EDL  L+ YL  +P E V K  F+V++DMR G+ W S+KP+LK+L+E    C     IIKP+ F++KQ+    SSKF F+  +VS + L + +D SQLT  FDG L Y++EEWIEIR+  ED+ + A  M  +   L   L +K++P+ +  ++  +E+H  ++ K+I+AP+  L+ EG KL   L+   +S++  + +  + N D Q L+P+V   + +L+  R HL   W   + +L+Q +QLRLFE D  +M +W+   + LFL  Y +IG +   A +L  +H  F +NC +V   ++R+  VAN L +SGHYAS QI+  A +L+ +WK+F  AL++RS +L +S+ FH +AE +++N   W  A  + ++       +  L   I   Q +++   +A+ EV  DG++L   L  P+  GS  SL A+ +YS+   H   ++HEV    +++E +  HR  RL  RL L +F++DV QVL W+  HGE FL + T VGKSL RA  L   H  FEEVA NT  NA+KL+ AA++L      DPEEI Q   +LE RIQ F + VE R+  LD++V FH H K+L+ W  +L++     ++   ++E V+D ++RF  +++  L     V+KEG  L  +L +              NH + +L Q+   +    +L  ER+++L+L LQLR+FE    D+ S ++    E+   M+ +F      + + RL    ++   +       I  G++++Q  +E+    ++ GV           + V D  E+  E+ Q L        +A ++    L+  +  R L+ + +QVL WI   + ML    +  S+L EAEQLQ EH++FQ  + + H  A+     AE  +Q   + +                             ++ AE VA  WQ+L+   E++ KL+ A+  +YKTS+QV SVL SLE+EY+R EDWC          +  ++  ++S+H EQKEAFLKAC LARR ++ F+KYL R     PG      + +++V   + +L  +E  VL  W  RK RLD+C  ++   R   +A E IH+  E  +S+
Sbjct:    1 MKAMDVLPILKEKVAYLSGGRDKRGGPILTFPARSNHDRIRQEDLRRLISYLACIPSEEVCKRGFTVIVDMR-GSKWDSIKPLLKILQESFPCCIHVALIIKPDNFWQKQRTNFGSSKFEFETNMVSLEGLTKVVDPSQLTPEFDGCLEYNHEEWIEIRVAFEDYISNATHMLSRLEELQDILAKKELPQDLEGARNMIEEHSQLKKKVIKAPIEDLDLEGQKL---LQRIQSSESFPKKNSGSGNADLQNLLPKVSTMLDRLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAEKMFDWITHNKGLFLNSYTEIGTSHPHAMELQTQHNHFAMNCMNVYVNINRIMSVANRLVESGHYASQQIRQIASQLEQEWKAFAAALDERSTLLDMSSIFHQKAEKYMSNVDSWCKACGEVDLP----SELQDLEDAIHHHQGIYEHITLAYSEVSQDGKSLLDKLQRPLTPGSSDSLTASANYSKAVHHVLDVIHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYQAAHQLEDRIQDFVRRVEQRKILLDMSVSFHTHVKELWTWLEELQKE-LLDDVYAESVEAVQDLIKRFGQQQQTTLQVTVNVIKEGEDLIQQLRDSAISSNKTPHNSSINHIETVLQQLDEAQSQMEELFQERKIKLELFLQLRIFERDAIDIISDLESWNDELSQQMN-DFDTEDLTIAEQRLQHHADKALTMNNLTFDVIHQGQDLLQYVNEV----QASGVELLCDRDVDMATRVQDLLEFLHEKQQELD-------LAAEQHRKHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEAMLQANHYDMDM--------------------------IRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAFLKACTLARRNADVFLKYLHRNSVNMPGMVTHIKAPEQQVKNILNELFQRENRVLHYWTMRKRRLDQCQQYVVFERSAKQALEWIHDNGEFYLST 1105          

HSP 2 Score: 275.018 bits (702), Expect = 5.248e-73
Identity = 158/469 (33.69%), Postives = 249/469 (53.09%), Query Frame = 3
Query: 4230 KAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKI-DFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEE-------------------------------------NQRTRMTSSTSDVARNADNIFYVLDDFTALEISQLSVQRNQRVQLIEQI---GEWASVRTICTNSDIVDDESTKVQGLVPASLLISVSTR 5513
            K+A+++  ++ E+IQTE  YV DL   + TY   +  G+ +I  P  +V ++ ++F N++EI EFH ++FL E+ +Y+               LPED+GHCF+ +A+ F+ +YV Y  NK +  Q+++E    +F+E+          + N+I S+ IKPVQRITKY + LK+L   C+ G  GE+ +  EVML + KR ND +HL  ++G  E+  +ES G+ IL + F VW+P+ +I+KGR+R +FLF++ LV +K+      +  Y YKS +  +E  +TEH+EGD CKFALW GR P   + ++VLK   +E KQ W++ +RE +QER        +E                                       RT   +  SD       +  V+ DFTA   ++L+++R Q V+++E+     +W  VRT         D S   +GLVP   L    +R
Sbjct: 1229 KSARRKEFIMAELIQTEKAYVRDLRECMDTYLWEMTSGVEEI--PPGIVNKELIIFGNMQEIYEFHNNIFLKELEKYEQ--------------LPEDVGHCFVTWADKFQ-MYVTYCKNKPDSTQLILEHAGSYFDEIQQ-----RHGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGK-GEIKDGLEVMLSVPKRANDAMHLSMLEGFDEN--IESQGELILQESFQVWDPKTLIRKGRERHLFLFEMSLVFSKEVKDSSGRSKYLYKSKLFTSELGVTEHVEGDPCKFALWVGRTPT-SDNKIVLKASSIENKQDWIKHIREVIQERTIHLKGALKEPIHIPKTAPATRQKGRRDGEDLDSQGDGSSQPDTISIASRTSQNTLDSDKLSGGCELTVVIHDFTACNSNELTIRRGQTVEVLERPHDKPDWCLVRTT--------DRSPAAEGLVPCGSLCIAHSR 1663          

HSP 3 Score: 127.102 bits (318), Expect = 3.852e-28
Identity = 97/358 (27.09%), Postives = 171/358 (47.77%), Query Frame = 3
Query: 4239 KKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGS--AGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWE-PRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIF----YQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEENQRTRMTSSTSDV 5291
            K+R +++ E+++TE  YV DL   ++ Y   + E      +P D+  +  ++F NI +I ++H+  FL E+ +              C   PE +G  F+++      +Y+ Y  NK +   I+ E ID F E +        Q+ + +    IKPVQRI KY + LKD        S    EL  A EVM  + +R ND +++  ++G   D  + + G  +L D F V +    ++ + R+RR+FLF+  ++ ++    D  K F    + +K+ I ++   + E++E D CKFAL T R   + E   +L      ++Q W+  + + +            ENQR  + + TS +
Sbjct: 1909 KRRHYVLQELVETERDYVRDLGYVVEGYMALMKED----GVPDDMKGKDKIVFGNIHQIYDWHRDFFLGELEK--------------CLEDPEKLGSLFVKHERRL-HMYIAYCQNKPKSEHIVSEYIDTFFEDLKQRLGHRLQLTDLL----IKPVQRIMKYQLLLKDFLKYSKKASLDTSELERAVEVMCIVPRRCNDMMNVGRLQGF--DGKIVAQGKLLLQDTFLVTDQDAGLLPRCRERRIFLFEQIVIFSEPL--DKKKGFSMPGFLFKNSIKVSCLCLEENVENDPCKFAL-TSRTGDVVET-FILHSSSPSVRQTWIHEINQIL------------ENQRNFLNALTSPI 2225          

HSP 4 Score: 87.0409 bits (214), Expect = 5.946e-16
Identity = 86/393 (21.88%), Postives = 166/393 (42.24%), Query Frame = 3
Query: 1191 NQTRSSWVTMNPDYQ-QLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETV--NSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGF 2357
            N+ ++S V +  D    +  +V+  ++ L+E +  L    +  R  LEQ  QLR  + ++ ++  W+     + L        +  +A  L  EH QF        +   ++   A  +  + HY    I+  A K+   W+     +EDR  ++  S +F+  +E   +     E   K++    G  + +  NS   ++T +     E + A  + C+  R  A      + + S              +   ++++E++    RV      R +RL      ++F     Q L W++++GE +L   TS G S+Q  ++L   H +F+  A  T    + LI  AD    + H    EI +  T +++R + F+  +E  R +L+ A+G 
Sbjct:  798 NEVQASGVELLCDRDVDMATRVQDLLEFLHEKQQELDLAAEQHRKHLEQCVQLRHLQAEVKQVLGWIRNGESM-LNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEAMLQANHYDMDMIRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAFLKACTLARRNADVFLKYLHRNSVNMPGMVTHIKAPEQQVKNILNELFQRENRVLHYWTMRKRRLDQCQQYVVFERSAKQALEWIHDNGEFYLSTHTSTGSSIQHTQELLKEHEEFQITAKQTKERVKLLIQLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRMEKYRTSLEKALGI 1189          
BLAST of Triple functional domain protein vs. Ensembl Human
Match: TRIO (trio Rho guanine nucleotide exchange factor [Source:HGNC Symbol;Acc:HGNC:12303])

HSP 1 Score: 662.914 bits (1709), Expect = 0.000e+0
Identity = 403/1152 (34.98%), Postives = 633/1152 (54.95%), Query Frame = 3
Query:  486 LKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRLVEE----------DEKNHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFE---ADVASAIDCLKHEVPTPMSYNF------LNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGK----SSVQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFI---RVKAEADELIHNFDEAGVSS 3860
            +KA D+L +LK  +A L G RDKRGGP+L FPA S+ D +  EDL  L+ YL  +P E V K  F+V++DMR G+ W S+KP+LK+L+E    C     IIKP+ F++KQ+    SSKF F+  +VS + L + +D SQLT  FDG L Y++EEWIEIR+  ED+ + A  M  +   L   L +K++P+ +  ++  +E+H  ++ K+I+AP+  L+ EG KL   L+   +S++  + +  + N D Q L+P+V   + +L+  R HL   W   + +L+Q +QLRLFE D  +M +W+   + LFL  Y +IG +   A +L  +H  F +NC +V   ++R+  VAN L +SGHYAS QI+  A +L+ +WK+F  AL++RS +L +S+ FH +AE +++N   W  A  + ++       +  L   I   Q +++   +A+ EV  DG++L   L  P+  GS  SL A+ +YS+   H   ++HEV    +++E +  HR  RL  RL L +F++DV QVL W+  HGE FL + T VGKSL RA  L   H  FEEVA NT  NA+KL+ AA++L      DPEEI Q   +LE RIQ F + VE R+  LD++V FH H K+L+ W  +L++     ++   ++E V+D ++RF  +++  L     V+KEG  L  +L +              NH + +L Q+   +    +L  ER+++L+L LQLR+FE    D+ S ++    E+   M+ +F      + + RL    ++   +       I  G++++Q  +E+    ++ GV           + V D  E+  E+ Q L        +A ++    L+  +  R L+ + +QVL WI   + ML    +  S+L EAEQLQ EH++FQ  + + H  A+     AE  +Q   + +                             ++ AE VA  WQ+L+   E++ KL+ A+  +YKTS+QV SVL SLE+EY+R EDWC          +  ++  ++S+H EQKEAFLKAC LARR ++ F+KYL R     PG      + +++V   + +L  +E  VL  W  RK RLD+C  ++   R   +A E IH+  E  +S+
Sbjct:   60 MKAMDVLPILKEKVAYLSGGRDKRGGPILTFPARSNHDRIRQEDLRRLISYLACIPSEEVCKRGFTVIVDMR-GSKWDSIKPLLKILQESFPCCIHVALIIKPDNFWQKQRTNFGSSKFEFETNMVSLEGLTKVVDPSQLTPEFDGCLEYNHEEWIEIRVAFEDYISNATHMLSRLEELQDILAKKELPQDLEGARNMIEEHSQLKKKVIKAPIEDLDLEGQKL---LQRIQSSESFPKKNSGSGNADLQNLLPKVSTMLDRLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAEKMFDWITHNKGLFLNSYTEIGTSHPHAMELQTQHNHFAMNCMNVYVNINRIMSVANRLVESGHYASQQIRQIASQLEQEWKAFAAALDERSTLLDMSSIFHQKAEKYMSNVDSWCKACGEVDLP----SELQDLEDAIHHHQGIYEHITLAYSEVSQDGKSLLDKLQRPLTPGSSDSLTASANYSKAVHHVLDVIHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYQAAHQLEDRIQDFVRRVEQRKILLDMSVSFHTHVKELWTWLEELQKEL-LDDVYAESVEAVQDLIKRFGQQQQTTLQVTVNVIKEGEDLIQQLRDSAISSNKTPHNSSINHIETVLQQLDEAQSQMEELFQERKIKLELFLQLRIFERDAIDIISDLESWNDELSQQMN-DFDTEDLTIAEQRLQHHADKALTMNNLTFDVIHQGQDLLQYVNEV----QASGVELLCDRDVDMATRVQDLLEFLHEKQQELD-------LAAEQHRKHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEAMLQANHYDM--------------------------DMIRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAFLKACTLARRNADVFLKYLHRNSVNMPGMVTHIKAPEQQVKNILNELFQRENRVLHYWTMRKRRLDQCQQYVVFERSAKQALEWIHDNGEFYLST 1164          

HSP 2 Score: 275.789 bits (704), Expect = 3.840e-73
Identity = 158/471 (33.55%), Postives = 250/471 (53.08%), Query Frame = 3
Query: 4224 QEKAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKI-DFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEE-------------------------------------NQRTRMTSSTSDVARNADNIFYVLDDFTALEISQLSVQRNQRVQLIEQI---GEWASVRTICTNSDIVDDESTKVQGLVPASLLISVSTR 5513
            + K+A+++  ++ E+IQTE  YV DL   + TY   +  G+ +I  P  +V ++ ++F N++EI EFH ++FL E+ +Y+               LPED+GHCF+ +A+ F+ +YV Y  NK +  Q+++E    +F+E+          + N+I S+ IKPVQRITKY + LK+L   C+ G  GE+ +  EVML + KR ND +HL  ++G  E+  +ES G+ IL + F VW+P+ +I+KGR+R +FLF++ LV +K+      +  Y YKS +  +E  +TEH+EGD CKFALW GR  P  + ++VLK   +E KQ W++ +RE +QER        +E                                       RT   +  SD       +  V+ DFTA   ++L+++R Q V+++E+     +W  VRT         D S   +GLVP   L    +R
Sbjct: 1286 KRKSARRKEFIMAELIQTEKAYVRDLRECMDTYLWEMTSGVEEI--PPGIVNKELIIFGNMQEIYEFHNNIFLKELEKYEQ--------------LPEDVGHCFVTWADKFQ-MYVTYCKNKPDSTQLILEHAGSYFDEIQQ-----RHGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGK-GEIKDGLEVMLSVPKRANDAMHLSMLEGFDEN--IESQGELILQESFQVWDPKTLIRKGRERHLFLFEMSLVFSKEVKDSSGRSKYLYKSKLFTSELGVTEHVEGDPCKFALWVGRT-PTSDNKIVLKASSIENKQDWIKHIREVIQERTIHLKGALKEPIHIPKTAPATRQKGRRDGEDLDSQGDGSSQPDTISIASRTSQNTLDSDKLSGGCELTVVIHDFTACNSNELTIRRGQTVEVLERPHDKPDWCLVRTT--------DRSPAAEGLVPCGSLCIAHSR 1722          

HSP 3 Score: 127.487 bits (319), Expect = 3.300e-28
Identity = 97/358 (27.09%), Postives = 171/358 (47.77%), Query Frame = 3
Query: 4239 KKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGS--AGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWE-PRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIF----YQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEENQRTRMTSSTSDV 5291
            K+R +++ E+++TE  YV DL   ++ Y   + E      +P D+  +  ++F NI +I ++H+  FL E+ +              C   PE +G  F+++      +Y+ Y  NK +   I+ E ID F E +        Q+ + +    IKPVQRI KY + LKD        S    EL  A EVM  + +R ND +++  ++G   D  + + G  +L D F V +    ++ + R+RR+FLF+  ++ ++    D  K F    + +K+ I ++   + E++E D CKFAL T R   + E   +L      ++Q W+  + + +            ENQR  + + TS +
Sbjct: 1968 KRRHYVLQELVETERDYVRDLGYVVEGYMALMKED----GVPDDMKGKDKIVFGNIHQIYDWHRDFFLGELEK--------------CLEDPEKLGSLFVKHERRL-HMYIAYCQNKPKSEHIVSEYIDTFFEDLKQRLGHRLQLTDLL----IKPVQRIMKYQLLLKDFLKYSKKASLDTSELERAVEVMCIVPRRCNDMMNVGRLQGF--DGKIVAQGKLLLQDTFLVTDQDAGLLPRCRERRIFLFEQIVIFSEPL--DKKKGFSMPGFLFKNSIKVSCLCLEENVENDPCKFAL-TSRTGDVVET-FILHSSSPSVRQTWIHEINQIL------------ENQRNFLNALTSPI 2284          

HSP 4 Score: 87.4261 bits (215), Expect = 4.852e-16
Identity = 91/408 (22.30%), Postives = 168/408 (41.18%), Query Frame = 3
Query: 1263 VQQLYEYRAHLQHKWDAG----RSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETV--NSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELR 2465
            VQ L E+    Q + D      R  LEQ  QLR  + ++ ++  W+     + L        +  +A  L  EH QF        +   ++   A  +  + HY    I+  A K+   W+     +EDR  ++  S +F+  +E   +     E   K++    G  + +  NS   ++T +     E + A  + C+  R  A      + + S              +   ++++E++    RV      R +RL      ++F     Q L W++++GE +L   TS G S+Q  ++L   H +F+  A  T    + LI  AD    + H    EI +  T +++R + F+  +E  R +L+ A+G  + +    K            +++P +I G E +LR
Sbjct:  878 VQDLLEFLHEKQQELDLAAEQHRKHLEQCVQLRHLQAEVKQVLGWIRNGESM-LNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEAMLQANHYDMDMIRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAFLKACTLARRNADVFLKYLHRNSVNMPGMVTHIKAPEQQVKNILNELFQRENRVLHYWTMRKRRLDQCQQYVVFERSAKQALEWIHDNGEFYLSTHTSTGSSIQHTQELLKEHEEFQITAKQTKERVKLLIQLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRMEKYRTSLEKALGISSDSNKSSKSLQ--------LDIIPASIPGSEVKLR 1276          

HSP 5 Score: 63.1586 bits (152), Expect = 9.097e-9
Identity = 31/129 (24.03%), Postives = 62/129 (48.06%), Query Frame = 3
Query: 1248 QVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALE 1634
            QVK  + +L++    + H W   + RL+Q  Q  +FE    +  EW++     +L+ +   G +     +L  EH +F +     +E+V  L  +A+   + GH  +A+I+     +D  ++ F+  +E
Sbjct: 1108 QVKNILNELFQRENRVLHYWTMRKRRLDQCQQYVVFERSAKQALEWIHDNGEFYLSTHTSTGSSIQHTQELLKEHEEFQITAKQTKERVKLLIQLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRME 1236          
BLAST of Triple functional domain protein vs. Ensembl Human
Match: KALRN (kalirin RhoGEF kinase [Source:HGNC Symbol;Acc:HGNC:4814])

HSP 1 Score: 649.432 bits (1674), Expect = 0.000e+0
Identity = 409/1155 (35.41%), Postives = 628/1155 (54.37%), Query Frame = 3
Query:  486 LKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRY--GLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSR-------LVEEDEKNHFKV----------------LLMQVQSDKETATDLLTERQVRLDLCLQLRLFE---ADVASAIDCLKHEVPTPMSYNFLNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGKSS----VQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFIRVKAEADELIHNFDEAG 3851
            LKA D+L +LK  +A + G RDKRGGP+L FPA S+ D +  EDL  LV YL  +P E+V K  F+V+IDMR G+ W  +KP+LK L+E          IIKP+ F++KQK    SSKF F+  +VS + L + +D SQLT+ FDG+L Y++EEWIE+R+ LE+FF  A  +  +   L + L RK+ P  V  S+R +++H  ++ K+++APV  L+ EG +L   +R   G + +N      +  + D+Q L+P++   + +L+  R HL   W   + +L+Q +QLRLFE D  +M +W++  + LFL  + +IG +   A DL  +H  F +N  +    ++R+  VA+ L+++GHYAS QI+  + +LD +WKSF  AL++RS +L +SA FH +AE FL+    W     +     G    +  L   I   Q L+++   A+ EV  DG+AL   L  P+  G+  SL A  +YS+       ++HEV    +R+E++  HR  RL  RL L +F++DV QVL W+  HGE FL + T VGKSL RA  L   H  FEEVA NT  NA+KL+ AA++L      DPEEI +    LE RIQ F + VE R+  LD++V FH HTK+L+ W   L++     ++   +++ V++ +++F  ++   LDA   V+KEG  L  +       L E  E     V                +L Q+   +    +L  ER+++LD+ LQLR+FE    +V + +D    ++   M  N  N   L  +   L+  T   +A      EVIQ+G +L +    V     A G        +D A    E ++ L  +  +L +  ++ + +L+  L  R L+ + +QVL WI   + ML  + +  S+L+EAEQLQ EH++FQ  + + H  A+     AE+ +Q                   + H     I       +  AE VA  WQ+L+   E++ KL+ A+  +YKTS+QV SVL SLE+EYRR EDWC          ++ ++  L+S+H EQKEAFLKAC LARR +E F+KY+ R     P  +S     +++V A + +L+ +E  VL  W  +K RLD+C  ++  +  A + +    E G
Sbjct:    8 LKASDVLPILKEKVAFVSGGRDKRGGPILTFPARSNHDRIRQEDLRKLVTYLASVPSEDVCKRGFTVIIDMR-GSKWDLIKPLLKTLQEAFPAEIHVALIIKPDNFWQKQKTNFGSSKFIFETSMVSVEGLTKLVDPSQLTEEFDGSLDYNHEEWIELRLSLEEFFNSAVHLLSRLEDLQEMLARKEFPVDVEGSRRLIDEHTQLKKKVLKAPVEELDREGQRLLQCIRCSDGFSGRN-----CIPGSADFQSLVPKITSLLDKLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAEKMFDWISHNKELFLQSHTEIGVSYQYALDLQTQHNHFAMNSMNAYVNINRIMSVASRLSEAGHYASQQIKQISTQLDQEWKSFAAALDERSTILAMSAVFHQKAEQFLSGVDAWCKMCSEG----GLPSEMQDLELAIHHHQTLYEQVTQAYTEVSQDGKALLDVLQRPLSPGNSESLTATANYSKAVHQVLDVVHEVLHHQRRLESIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHDDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYKAARHLEVRIQDFVRRVEQRKLLLDMSVSFHTHTKELWTWMEDLQKEM-LEDVCADSVDAVQELIKQFQQQQTATLDATLNVIKEGEDLIQQLRSAPPSLGEPSEARDSAVSNNKTPHSSSISHIESVLQQLDDAQVQMEELFHERKIKLDIFLQLRIFEQYTIEVTAELDAWNEDLLRQM--NDFNTEDLTLAEQRLQRHTERKLAMNNMTFEVIQQGQDLHQYITEVQ----ASGIELICEKDIDLAAQVQELLEFLHEKQHELELNAEQTHKRLEQCLQLRHLQAEVKQVLGWIRNGESMLNASLVNASSLSEAEQLQREHEQFQLAIEKTHQSALQVQQKAEVLLQ-------------------AGHYDADAI-------RECAEKVALHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYRRDEDWCGGRDKLGPAAEIDHVIPLISKHLEQKEAFLKACTLARRNAEVFLKYIHRNNVSMPSVASHTRGPEQQVKAILSELLQRENRVLHFWTLKKRRLDQCQQYVVFERSAKQALDWIQETG 1119          

HSP 2 Score: 283.108 bits (723), Expect = 2.052e-75
Identity = 165/470 (35.11%), Postives = 257/470 (54.68%), Query Frame = 3
Query: 4230 KAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKID-FFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSF-GPIYEENQ-------------------------------------RTRMTSSTSDVARNADNIFYVLDDFTALEISQLSVQRNQRVQLIEQIGE---WASVRTICTNSDIVDDESTKVQGLVPASLLISVSTR 5513
            K+A+K+  ++ E++QTE  YV DL   L+TY   +  G+ +I  P  ++ ++ ++F NI+EI +FH ++FL E+ +Y+               LPED+GHCF+ +A+ F+ +YV Y  NK + NQ+++E    FF+E+          + N+I S+ IKPVQRITKY + LK+L   C+ G  GEL +  EVML + K+ ND +H+  ++G  E+  L+  G+ IL D F VW+P+ +I+KGR+R +FLF++ LV +K+         Y YK+ +L +E  +TEH+EGD CKFALW+GR P   + + VLK  ++E KQ+W++ +RE +QERI    G + E  Q                                     RT   +  SD       +  VL DF+A   S+L++Q  Q V+L+E+  E   W  VRT         + S  ++GLVP+S L    +R
Sbjct: 1246 KSARKKEFIMAELLQTEKAYVRDLHECLETYLWEMTSGVEEI--PPGILNKEHIIFGNIQEIYDFHNNIFLKELEKYEQ--------------LPEDVGHCFVTWADKFQ-MYVTYCKNKPDSNQLILEHAGTFFDEIQQ-----RHGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGK-GELKDGLEVMLSVPKKANDAMHVSMLEGFDEN--LDVQGELILQDAFQVWDPKSLIRKGRERHLFLFEISLVFSKEIKDSSGHTKYVYKNKLLTSELGVTEHVEGDPCKFALWSGRTPS-SDNKTVLKASNIETKQEWIKNIREVIQERIIHLKGALKEPLQLPKTPAKQRNNSKRDGVEDIDSQGDGSSQPDTISIASRTSQNTVDSDKLSGGCELTVVLQDFSAGHSSELTIQVGQTVELLERPSERPGWCLVRTT--------ERSPPLEGLVPSSALCISHSR 1681          

HSP 3 Score: 130.183 bits (326), Expect = 4.853e-29
Identity = 93/333 (27.93%), Postives = 162/333 (48.65%), Query Frame = 3
Query: 4230 KAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPED-IGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGS--AGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWE-PRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQ 5216
            KA + R+ ++NE++QTE  YV DL   ++ + K I E      +P+D+  +  ++F NI +I ++HK  FL E+ +               C   +D +   FI++      IYV Y  NK     I+ E   +F E+       E   + T+  F IKP+QRITKY + LKD     +       ++ +A E+M  + KR ND ++L  ++G   +  L + G  +  D F V E    +  + ++RRVFLF+  ++ ++          Y +K  I +    + E+++ D CKFAL           R+VL+  + +I+Q WV+ + + ++
Sbjct: 1894 KALRGRMFVLNELVQTEKDYVKDLGIVVEGFMKRIEEK----GVPEDMRGKDKIVFGNIHQIYDWHKDFFLAELEK---------------CIQEQDRLAQLFIKHERKLH-IYVWYCQNKPRSEYIVAEYDAYFEEVKQ-----EINQRLTLSDFLIKPIQRITKYQLLLKDFLRYSEKAGLECSDIEKAVELMCLVPKRCNDMMNLGRLQGF--EGTLTAQGKLLQQDTFYVIELDAGMQSRTKERRVFLFEQIVIFSELLRKGSLTPGYMFKRSIKMNYLVLEENVDNDPCKFALMNRET----SERVVLQAANADIQQAWVQDINQVLE 2195          

HSP 4 Score: 68.9366 bits (167), Expect = 1.755e-10
Identity = 83/385 (21.56%), Postives = 166/385 (43.12%), Query Frame = 3
Query: 1239 LIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQ--YITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEG-RKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNH-TKDL 2378
            L  QV++ ++ L+E +  L+   +    RLEQ  QLR  + ++ ++  W+     +      +   + S+A  L  EH QF +      +   ++   A +L  +GHY +  I+  A K+   W+     +EDR  ++  S +F+  +E   +     E   ++     G  + +    +  ++  L     E + A  + C+  R  A      + + ++ S+ +   ++ G  +    ++ E+     RV      + +RL      ++F     Q L W+ E GE +L   TS G++ +  ++L   + +F   A  T    + LI  AD  V + H    EI +  T +++  + F+  +   R +L+ A+G +    KDL
Sbjct:  835 LAAQVQELLEFLHEKQHELELNAEQTHKRLEQCLQLRHLQAEVKQVLGWIRNGESMLNASLVN-ASSLSEAEQLQREHEQFQLAIEKTHQSALQVQQKAEVLLQAGHYDADAIRECAEKVALHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYRRDEDWCGGRDKLGPAAEIDHVIPLISKHLEQKEAFLKACTLARRNAEVFLKYIHR-NNVSMPSVASHTRGPEQQVKAILSELLQRENRVLHFWTLKKRRLDQCQQYVVFERSAKQALDWIQETGEFYLSTHTSTGETTEETQELLKEYGEFRVPAKQTKEKVKLLIQLADSFVEKGHIHATEIRKWVTTVDKHYRDFSLRMGKYRYSLEKALGVNTEDNKDL 1217          
BLAST of Triple functional domain protein vs. Ensembl Human
Match: KALRN (kalirin RhoGEF kinase [Source:HGNC Symbol;Acc:HGNC:4814])

HSP 1 Score: 649.047 bits (1673), Expect = 0.000e+0
Identity = 409/1155 (35.41%), Postives = 628/1155 (54.37%), Query Frame = 3
Query:  486 LKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRY--GLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSR-------LVEEDEKNHFKV----------------LLMQVQSDKETATDLLTERQVRLDLCLQLRLFE---ADVASAIDCLKHEVPTPMSYNFLNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGKSS----VQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFIRVKAEADELIHNFDEAG 3851
            LKA D+L +LK  +A + G RDKRGGP+L FPA S+ D +  EDL  LV YL  +P E+V K  F+V+IDMR G+ W  +KP+LK L+E          IIKP+ F++KQK    SSKF F+  +VS + L + +D SQLT+ FDG+L Y++EEWIE+R+ LE+FF  A  +  +   L + L RK+ P  V  S+R +++H  ++ K+++APV  L+ EG +L   +R   G + +N      +  + D+Q L+P++   + +L+  R HL   W   + +L+Q +QLRLFE D  +M +W++  + LFL  + +IG +   A DL  +H  F +N  +    ++R+  VA+ L+++GHYAS QI+  + +LD +WKSF  AL++RS +L +SA FH +AE FL+    W     +     G    +  L   I   Q L+++   A+ EV  DG+AL   L  P+  G+  SL A  +YS+       ++HEV    +R+E++  HR  RL  RL L +F++DV QVL W+  HGE FL + T VGKSL RA  L   H  FEEVA NT  NA+KL+ AA++L      DPEEI +    LE RIQ F + VE R+  LD++V FH HTK+L+ W   L++     ++   +++ V++ +++F  ++   LDA   V+KEG  L  +       L E  E     V                +L Q+   +    +L  ER+++LD+ LQLR+FE    +V + +D    ++   M  N  N   L  +   L+  T   +A      EVIQ+G +L +    V     A G        +D A    E ++ L  +  +L +  ++ + +L+  L  R L+ + +QVL WI   + ML  + +  S+L+EAEQLQ EH++FQ  + + H  A+     AE+ +Q                   + H     I       +  AE VA  WQ+L+   E++ KL+ A+  +YKTS+QV SVL SLE+EYRR EDWC          ++ ++  L+S+H EQKEAFLKAC LARR +E F+KY+ R     P  +S     +++V A + +L+ +E  VL  W  +K RLD+C  ++  +  A + +    E G
Sbjct:   30 LKASDVLPILKEKVAFVSGGRDKRGGPILTFPARSNHDRIRQEDLRKLVTYLASVPSEDVCKRGFTVIIDMR-GSKWDLIKPLLKTLQEAFPAEIHVALIIKPDNFWQKQKTNFGSSKFIFETSMVSVEGLTKLVDPSQLTEEFDGSLDYNHEEWIELRLSLEEFFNSAVHLLSRLEDLQEMLARKEFPVDVEGSRRLIDEHTQLKKKVLKAPVEELDREGQRLLQCIRCSDGFSGRN-----CIPGSADFQSLVPKITSLLDKLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAEKMFDWISHNKELFLQSHTEIGVSYQYALDLQTQHNHFAMNSMNAYVNINRIMSVASRLSEAGHYASQQIKQISTQLDQEWKSFAAALDERSTILAMSAVFHQKAEQFLSGVDAWCKMCSEG----GLPSEMQDLELAIHHHQTLYEQVTQAYTEVSQDGKALLDVLQRPLSPGNSESLTATANYSKAVHQVLDVVHEVLHHQRRLESIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHDDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYKAARHLEVRIQDFVRRVEQRKLLLDMSVSFHTHTKELWTWMEDLQKEM-LEDVCADSVDAVQELIKQFQQQQTATLDATLNVIKEGEDLIQQLRSAPPSLGEPSEARDSAVSNNKTPHSSSISHIESVLQQLDDAQVQMEELFHERKIKLDIFLQLRIFEQYTIEVTAELDAWNEDLLRQM--NDFNTEDLTLAEQRLQRHTERKLAMNNMTFEVIQQGQDLHQYITEV----QASGIELICEKDIDLAAQVQELLEFLHEKQHELELNAEQTHKRLEQCLQLRHLQAEVKQVLGWIRNGESMLNASLVNASSLSEAEQLQREHEQFQLAIEKTHQSALQVQQKAEVLLQ-------------------AGHYDADAI-------RECAEKVALHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYRRDEDWCGGRDKLGPAAEIDHVIPLISKHLEQKEAFLKACTLARRNAEVFLKYIHRNNVSMPSVASHTRGPEQQVKAILSELLQRENRVLHFWTLKKRRLDQCQQYVVFERSAKQALDWIQETG 1141          

HSP 2 Score: 265.388 bits (677), Expect = 2.073e-70
Identity = 134/342 (39.18%), Postives = 212/342 (61.99%), Query Frame = 3
Query: 4230 KAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKID-FFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEE 5252
            K+A+K+  ++ E++QTE  YV DL   L+TY   +  G+ +I  P  ++ ++ ++F NI+EI +FH ++FL E+ +Y+               LPED+GHCF+ +A+ F+ +YV Y  NK + NQ+++E    FF+E+          + N+I S+ IKPVQRITKY + LK+L   C+ G  GEL +  EVML + K+ ND +H+  ++G  E+  L+  G+ IL D F VW+P+ +I+KGR+R +FLF++ LV +K+         Y YK+ +L +E  +TEH+EGD CKFALW+GR P   + + VLK  ++E KQ+W++ +RE +QERI       +E
Sbjct: 1268 KSARKKEFIMAELLQTEKAYVRDLHECLETYLWEMTSGVEEI--PPGILNKEHIIFGNIQEIYDFHNNIFLKELEKYEQ--------------LPEDVGHCFVTWADKFQ-MYVTYCKNKPDSNQLILEHAGTFFDEIQQ-----RHGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGK-GELKDGLEVMLSVPKKANDAMHVSMLEGFDEN--LDVQGELILQDAFQVWDPKSLIRKGRERHLFLFEISLVFSKEIKDSSGHTKYVYKNKLLTSELGVTEHVEGDPCKFALWSGRTPS-SDNKTVLKASNIETKQEWIKNIREVIQERIIHLKGALKE 1583          

HSP 3 Score: 66.6254 bits (161), Expect = 8.075e-10
Identity = 83/385 (21.56%), Postives = 166/385 (43.12%), Query Frame = 3
Query: 1239 LIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQ--YITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEG-RKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNH-TKDL 2378
            L  QV++ ++ L+E +  L+   +    RLEQ  QLR  + ++ ++  W+     +      +   + S+A  L  EH QF +      +   ++   A +L  +GHY +  I+  A K+   W+     +EDR  ++  S +F+  +E   +     E   ++     G  + +    +  ++  L     E + A  + C+  R  A      + + ++ S+ +   ++ G  +    ++ E+     RV      + +RL      ++F     Q L W+ E GE +L   TS G++ +  ++L   + +F   A  T    + LI  AD  V + H    EI +  T +++  + F+  +   R +L+ A+G +    KDL
Sbjct:  857 LAAQVQELLEFLHEKQHELELNAEQTHKRLEQCLQLRHLQAEVKQVLGWIRNGESMLNASLVN-ASSLSEAEQLQREHEQFQLAIEKTHQSALQVQQKAEVLLQAGHYDADAIRECAEKVALHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYRRDEDWCGGRDKLGPAAEIDHVIPLISKHLEQKEAFLKACTLARRNAEVFLKYIHR-NNVSMPSVASHTRGPEQQVKAILSELLQRENRVLHFWTLKKRRLDQCQQYVVFERSAKQALDWIQETGEFYLSTHTSTGETTEETQELLKEYGEFRVPAKQTKEKVKLLIQLADSFVEKGHIHATEIRKWVTTVDKHYRDFSLRMGKYRYSLEKALGVNTEDNKDL 1239          
BLAST of Triple functional domain protein vs. Ensembl Celegans
Match: unc-73 (Guanine nucleotide exchange factor UNC-73B [Source:UniProtKB/TrEMBL;Acc:Q7KPP4])

HSP 1 Score: 290.812 bits (743), Expect = 1.031e-78
Identity = 279/1139 (24.50%), Postives = 487/1139 (42.76%), Query Frame = 3
Query:  486 LKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQ-AIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHW--ETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELV---SQAHDPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTL------CSRLVEEDEK---NHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFEADVASAIDCLK------HEVPTPMSYNFLNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSD-QVTSVLRSLEKEYRR--AEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGKSSVQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFIRVKAEADELI 3830
            +KA+D+L +L+ GIA+LPG R + G  V+  P  S    ++ ++L  +  YL  +  +  ++  F VVIDMR   TW +V+ ILK L       T  VFIIKPEKF+EKQKA M+   + F+++++S + L + ID S L +   G+ PY ++EW+E+R+ LE +     ++ +K  S+ + +   + P  V  +   ++  +  +  I   PV  +E EG+K+   +          + S    NPD +   P +      L   +  +   W+  +  L ++YQ + FE D   M E L   +        D+G  A+    L AE  QF +    +   V ++    N L   G  A  QI    A +L  +W      +E RS VL  +  F + A+ + A  P W  +  +   ++   Q     SL + I      W +    + +   D   +   L             A  + +  R+H + L        K++      R   L   L+++ F  DV  V+ WL +HGEP+L+R   +G+++ +A      H  F+ VAANT  N +KL     ++    S+  D + +    T+L  +I+ FTK   +R   L  +V FH H K+L  W+ ++ E +     + LT+   +    RF  E      A    + EG TL       +R+ + D      H ++L+  ++      +   + R+  L +  +  +FE +    ++ +K       E+    S+    D  L    +  ++V        KS +       ELS+A       +    +   D       E   E ++ L    + ++   +E +++++   +   L + S  V   I      L Q  ++P++  +  Q Q E   F+  +   H       AF       I F+                  L     + R E     E +  ++ +L+   E+++KLL +A   YKT +  V  +L  LE EY      DWC    +S   D+  Y+ DLLS+H + KE F K C  A R  +  ++Y+ R       +   + K+     ++  ++  +L+ W  +K  L+ C  FI ++A A EL+
Sbjct:   10 MKAEDILHVLRDGIAVLPGGRCRAGQAVIVCP--SREQPVNQDNLRNVFLYLFEVTSKMAREKGFLVVIDMRGKQTWTNVRHILKALSSIESSSTVQVFIIKPEKFWEKQKAQMSLGTWDFEVEMISFESLIKIIDSSHLPKTVGGSYPYDHDEWLELRLDLEKWIWNITEIMEKLESVRREICEGEQPVDVTTANAALKKSQHAKNSIFNVPVEGIETEGNKIATRI---------LKPSKGVKNPDLEATTPYISNLTDSLRLLKGEVAKNWEVRQMELSKVYQQKQFERDAEHMIETLRPYKKACERSMGDVGGCANDVVRLSAEFEQFQIAVRGMEVSVKQVFDKENHLRTIG--ARNQITDHVAARLAEEWHLVKELMERRSAVLHNAKEFFTSAQRYFAEVPRWTAQPGVNPNDVLFNQ----ESLEEAIRKHDAFWAQVEEVYAQAYDDASKVTRALKE-----------ADAEDNVAREHSSRLQR----AHKQLMEKWKERQVLLHHMLAMIAFETDVRLVVDWLEQHGEPYLRRNIHIGENVNQARSFQRNHTNFQRVAANTYGNVQKLHQVYQDVTKSGSKICDVDTMHGLMTDLSAKIEKFTKIENSRELLLRQSVLFHTHYKELTDWYGKMGEKYK-DRRIDLTVPTCDKNKERFVLETDETAQAYAMTIDEGKTLIEMMQRATRVFDVDYSASVAHIQLLISDIEDKNTQISSEWSPRRTLLHIASKFAMFEQNQFEVLEQIKSWEVDMREMAESDSFYDKADSVLPFHKDNQQQVRNAIADIQKSAK-------ELSQAL------YSQKLTDLRDKRDRVVLEAIREHVRELEIAESRVMTYANETSMRMQAASEVGDLRRISNSVCKLIDNQLSALTQLGVIPNDYNDTVQKQEELRAFRDAVQ--HKLKEPYDAFV------IRFR-----------------ELMENRLANRDEVVYHNEAIQAKYCRLMNLCEDRNKLLKSAHGCYKTYETAVLPILNQLESEYHSPTVTDWCAGCTSSIDADRAAYVADLLSKHMDYKERFGKGCTYALRNGDFLLRYIRRSTVNQSERKRHETKIADMKNNIRERQSNILELWMQKKLLLEGCQSFIFIEASAKELL 1077          

HSP 2 Score: 173.326 bits (438), Expect = 1.265e-42
Identity = 139/465 (29.89%), Postives = 218/465 (46.88%), Query Frame = 3
Query: 4239 KKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMM--EKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIH-----LKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIK-KGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHIL-LTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERI---------FSFGPIYEENQ-RTRMTSSTSDVARN-----------------------ADNIFYVLDDFTALEISQLSVQRNQRVQLIE----QIGEWASVRTICTNSDIVDDESTKVQGLVPASLL 5495
            +K +  + E+IQ+E  Y+ DLE  +  Y K   +   +  IP  L   K  +F NI++I +FH    L E+ +Y+  NQ            PE +G  FI + +   ++Y +Y  NK++ N ++   + + FF  +      G E + N I S  IKPVQRIT+Y + ++ L  +C T    +L EA+EV+  + +++ND IH     LKD K       ++ LG F+  D  T WEPR   K +G++R+VFLFD+ +V  K+       I Y  K   L L+E +I EH+EGD C+F L  G V    + R+ LK  +   K KWV+ +R+     +         +S G +        R  +STS    N                       +  ++ V  DF       L+V +  RV+++E       E+  V  +C       D+ TK  GLVPAS++
Sbjct: 1204 RKMLEPMRELIQSERDYIKDLERCVNIYVKEFDQAAKNGTIPT-LNPLKYEIFGNIEKIFKFHNDKLLHELIKYE--NQ------------PEAVGASFIVWIDLLNELYTEYCVNKEQKNHVIATPDAVSFFTGIRER--HGLE-INNEIASLLIKPVQRITRYRLLIEQLMRSC-TDKTNDLKEAYEVVCSVPRKVNDLIHYNCLDLKDFK-------VDELGPFVTQDTLTFWEPRAYFKGRGKERQVFLFDISIVFAKRIEVSPKNIKYVIKGKPLPLSEVSIVEHVEGDTCRFGLRVGTVSS-NDNRIDLKANNHHTKVKWVQKIRDLTAGMLPLGLGVSEAYSVGTLSTARSVSVRSGASTSSGGENRQSQDVESLLRHRYSVHSCDSEQSSEVWIVTADFDGQVEGHLTVHKGDRVEIVEDQATDCAEYVQV-VLC-------DQPTK-HGLVPASII 1632          
BLAST of Triple functional domain protein vs. Ensembl Celegans
Match: unc-73 (Guanine nucleotide exchange factor UNC-73B [Source:UniProtKB/TrEMBL;Acc:Q7KPP4])

HSP 1 Score: 250.366 bits (638), Expect = 5.901e-66
Identity = 195/746 (26.14%), Postives = 334/746 (44.77%), Query Frame = 3
Query:  486 LKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQ-AIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHW--ETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELV---SQAHDPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTL------CSRLVEED---EKNHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFE 2678
            +KA+D+L +L+ GIA+LPG R + G  V+  P  S    ++ ++L  +  YL  +  +  ++  F VVIDMR   TW +V+ ILK L       T  VFIIKPEKF+EKQKA M+   + F+++++S + L + ID S L +   G+ PY ++EW+E+R+ LE +     ++ +K  S+ + +   + P  V  +   ++  +  +  I   PV  +E EG+K+   +          + S    NPD +   P +      L   +  +   W+  +  L ++YQ + FE D   M E L   +        D+G  A+    L AE  QF +    +   V ++    N L   G  A  QI    A +L  +W      +E RS VL  +  F + A+ + A  P W  +  +   ++   Q     SL + I      W +    + +   D   +   L             A  + +  R+H + L        K++      R   L   L+++ F  DV  V+ WL +HGEP+L+R   +G+++ +A      H  F+ VAANT  N +KL     ++    S+  D + +    T+L  +I+ FTK   +R   L  +V FH H K+L  W+ ++ E +     + LT+   +    RF  E      A    + EG TL       +R+ + D      H ++L+  ++      +   + R+  L +  +  +FE
Sbjct:   10 MKAEDILHVLRDGIAVLPGGRCRAGQAVIVCP--SREQPVNQDNLRNVFLYLFEVTSKMAREKGFLVVIDMRGKQTWTNVRHILKALSSIESSSTVQVFIIKPEKFWEKQKAQMSLGTWDFEVEMISFESLIKIIDSSHLPKTVGGSYPYDHDEWLELRLDLEKWIWNITEIMEKLESVRREICEGEQPVDVTTANAALKKSQHAKNSIFNVPVEGIETEGNKIATRI---------LKPSKGVKNPDLEATTPYISNLTDSLRLLKGEVAKNWEVRQMELSKVYQQKQFERDAEHMIETLRPYKKACERSMGDVGGCANDVVRLSAEFEQFQIAVRGMEVSVKQVFDKENHLRTIG--ARNQITDHVAARLAEEWHLVKELMERRSAVLHNAKEFFTSAQRYFAEVPRWTAQPGVNPNDVLFNQ----ESLEEAIRKHDAFWAQVEEVYAQAYDDASKVTRALKE-----------ADAEDNVAREHSSRLQR----AHKQLMEKWKERQVLLHHMLAMIAFETDVRLVVDWLEQHGEPYLRRNIHIGENVNQARSFQRNHTNFQRVAANTYGNVQKLHQVYQDVTKSGSKICDVDTMHGLMTDLSAKIEKFTKIENSRELLLRQSVLFHTHYKELTDWYGKMGEKYK-DRRIDLTVPTCDKNKERFVLETDETAQAYAMTIDEGKTLIEMMQRATRVFDVDYSASVAHIQLLISDIEDKNTQISSEWSPRRTLLHIASKFAMFE 722          

HSP 2 Score: 177.563 bits (449), Expect = 8.736e-44
Identity = 149/498 (29.92%), Postives = 233/498 (46.79%), Query Frame = 3
Query: 4239 KKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMM--EKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIH-----LKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIK-KGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHIL-LTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERI---------FSFGPI-YEENQRTRMTSSTSDVARN-----------------------ADNIFYVLDDFTALEISQLSVQRNQRVQLIE----QIGEWASVRTICTNSDIVDDESTKVQGLVPASLLI-----SVSTRRYLVDDKSINGSSMKKWLRDRR 5579
            +K +  + E+IQ+E  Y+ DLE  +  Y K   +   +  IP  L   K  +F NI++I +FH    L E+ +Y+  NQ            PE +G  FI + +   ++Y +Y  NK++ N ++   + + FF  +      G E + N I S  IKPVQRIT+Y + ++ L  +C T    +L EA+EV+  + +++ND IH     LKD K       ++ LG F+  D  T WEPR   K +G++R+VFLFD+ +V  K+       I Y  K   L L+E +I EH+EGD C+F L  G V    + R+ LK  +   K KWV+ +R+     +         +S G +    +   R  +STS    N                       +  ++ V  DF       L+V +  RV+++E       E+  V  +C       D+ TK  GLVPAS++      SV  R    DD + +GS++ K    RR
Sbjct: 1204 RKMLEPMRELIQSERDYIKDLERCVNIYVKEFDQAAKNGTIPT-LNPLKYEIFGNIEKIFKFHNDKLLHELIKYE--NQ------------PEAVGASFIVWIDLLNELYTEYCVNKEQKNHVIATPDAVSFFTGIRER--HGLE-INNEIASLLIKPVQRITRYRLLIEQLMRSC-TDKTNDLKEAYEVVCSVPRKVNDLIHYNCLDLKDFK-------VDELGPFVTQDTLTFWEPRAYFKGRGKERQVFLFDISIVFAKRIEVSPKNIKYVIKGKPLPLSEVSIVEHVEGDTCRFGLRVGTVSS-NDNRIDLKANNHHTKVKWVQKIRDLTAGMLPLGLGVSEAYSVGTLSTARSVSVRSGASTSSGGENRQSQDVESLLRHRYSVHSCDSEQSSEVWIVTADFDGQVEGHLTVHKGDRVEIVEDQATDCAEYVQV-VLC-------DQPTK-HGLVPASIIAPPESGSVPDR---PDDSNASGSTVSKRKSLRR 1662          

HSP 3 Score: 103.219 bits (256), Expect = 2.828e-21
Identity = 87/365 (23.84%), Postives = 162/365 (44.38%), Query Frame = 3
Query: 4224 QEKAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTG--SAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEP-RQIIKKGRDRRVFLFDVCLVLTKKY--NHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEENQRTRMTSSTSDVARNA 5303
            +E A  KR +++ E+++TE  YV DL + ++ Y       ++ + +P DLV +  ++F+NI  ILEFHK+ FL EI +              C    E  G  F++Y      +YV Y  NK + + ++ +  D F    +     +   K  +    IKPVQRI KY + LKD+    +        L +A +VM  + K  +D + +  ++    D+ L + G  I      + E     ++K +DRR+FLF+   ++        +     Y +KS  ++ +     ++  D  +F + +    P      +   +  E K +W R + E + ++      + +  +   M+S   D++  A
Sbjct: 1803 EETARFKRSYVLMELVETEQDYVKDLTSVVEGYIG----NLNKMDLPADLVGKDKIIFANIVNILEFHKTNFLKEIEK--------------CSENYEAAGAAFVKYERRLHTLYVTYCQNKPKSDYLLAQ--DDFEAFFADT-KAKLGHKVALCDLLIKPVQRIMKYQLLLKDILKFTERAKDKTDTLKKALQVMHVVPKACDDMMQVGRLQNF--DKSLSAQGKLIHQGTLQISESIAGNVQKPKDRRIFLFEQSAIIADHIPPKKEFGNPTYIFKSQFMVNKMVFEPNVPDDPLRFVIKSS--DPTQPTSFIANAQSQEEKDEWNRKMSELLDQQKRLLAALVDPRRYNDMSSGMGDLSLGA 2142          

HSP 4 Score: 72.0182 bits (175), Expect = 8.656e-12
Identity = 41/134 (30.60%), Postives = 66/134 (49.25%), Query Frame = 3
Query: 3438 YKTSD-QVTSVLRSLEKEYRR--AEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGKSSVQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFIRVKAEADELI 3830
            YKT +  V  +L  LE EY      DWC    +S   D+  Y+ DLLS+H + KE F K C  A R  +  ++Y+ R       +   + K+     ++  ++  +L+ W  +K  L+ C  FI ++A A EL+
Sbjct:  944 YKTYETAVLPILNQLESEYHSPTVTDWCAGCTSSIDADRAAYVADLLSKHMDYKERFGKGCTYALRNGDFLLRYIRRSTVNQSERKRHETKIADMKNNIRERQSNILELWMQKKLLLEGCQSFIFIEASAKELL 1077          
BLAST of Triple functional domain protein vs. Ensembl Celegans
Match: unc-73 (Guanine nucleotide exchange factor UNC-73B [Source:UniProtKB/TrEMBL;Acc:Q7KPP4])

HSP 1 Score: 249.21 bits (635), Expect = 1.089e-65
Identity = 195/746 (26.14%), Postives = 334/746 (44.77%), Query Frame = 3
Query:  486 LKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQ-AIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHW--ETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELV---SQAHDPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTL------CSRLVEEDEK---NHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFE 2678
            +KA+D+L +L+ GIA+LPG R + G  V+  P  S    ++ ++L  +  YL  +  +  ++  F VVIDMR   TW +V+ ILK L       T  VFIIKPEKF+EKQKA M+   + F+++++S + L + ID S L +   G+ PY ++EW+E+R+ LE +     ++ +K  S+ + +   + P  V  +   ++  +  +  I   PV  +E EG+K+   +          + S    NPD +   P +      L   +  +   W+  +  L ++YQ + FE D   M E L   +        D+G  A+    L AE  QF +    +   V ++    N L   G  A  QI    A +L  +W      +E RS VL  +  F + A+ + A  P W  +  +   ++   Q     SL + I      W +    + +   D   +   L             A  + +  R+H + L        K++      R   L   L+++ F  DV  V+ WL +HGEP+L+R   +G+++ +A      H  F+ VAANT  N +KL     ++    S+  D + +    T+L  +I+ FTK   +R   L  +V FH H K+L  W+ ++ E +     + LT+   +    RF  E      A    + EG TL       +R+ + D      H ++L+  ++      +   + R+  L +  +  +FE
Sbjct:   10 MKAEDILHVLRDGIAVLPGGRCRAGQAVIVCP--SREQPVNQDNLRNVFLYLFEVTSKMAREKGFLVVIDMRGKQTWTNVRHILKALSSIESSSTVQVFIIKPEKFWEKQKAQMSLGTWDFEVEMISFESLIKIIDSSHLPKTVGGSYPYDHDEWLELRLDLEKWIWNITEIMEKLESVRREICEGEQPVDVTTANAALKKSQHAKNSIFNVPVEGIETEGNKIATRI---------LKPSKGVKNPDLEATTPYISNLTDSLRLLKGEVAKNWEVRQMELSKVYQQKQFERDAEHMIETLRPYKKACERSMGDVGGCANDVVRLSAEFEQFQIAVRGMEVSVKQVFDKENHLRTIG--ARNQITDHVAARLAEEWHLVKELMERRSAVLHNAKEFFTSAQRYFAEVPRWTAQPGVNPNDVLFNQ----ESLEEAIRKHDAFWAQVEEVYAQAYDDASKVTRALKE-----------ADAEDNVAREHSSRLQR----AHKQLMEKWKERQVLLHHMLAMIAFETDVRLVVDWLEQHGEPYLRRNIHIGENVNQARSFQRNHTNFQRVAANTYGNVQKLHQVYQDVTKSGSKICDVDTMHGLMTDLSAKIEKFTKIENSRELLLRQSVLFHTHYKELTDWYGKMGEKYK-DRRIDLTVPTCDKNKERFVLETDETAQAYAMTIDEGKTLIEMMQRATRVFDVDYSASVAHIQLLISDIEDKNTQISSEWSPRRTLLHIASKFAMFE 722          

HSP 2 Score: 177.178 bits (448), Expect = 9.928e-44
Identity = 149/498 (29.92%), Postives = 233/498 (46.79%), Query Frame = 3
Query: 4239 KKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMM--EKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIH-----LKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIK-KGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHIL-LTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERI---------FSFGPI-YEENQRTRMTSSTSDVARN-----------------------ADNIFYVLDDFTALEISQLSVQRNQRVQLIE----QIGEWASVRTICTNSDIVDDESTKVQGLVPASLLI-----SVSTRRYLVDDKSINGSSMKKWLRDRR 5579
            +K +  + E+IQ+E  Y+ DLE  +  Y K   +   +  IP  L   K  +F NI++I +FH    L E+ +Y+  NQ            PE +G  FI + +   ++Y +Y  NK++ N ++   + + FF  +      G E + N I S  IKPVQRIT+Y + ++ L  +C T    +L EA+EV+  + +++ND IH     LKD K       ++ LG F+  D  T WEPR   K +G++R+VFLFD+ +V  K+       I Y  K   L L+E +I EH+EGD C+F L  G V    + R+ LK  +   K KWV+ +R+     +         +S G +    +   R  +STS    N                       +  ++ V  DF       L+V +  RV+++E       E+  V  +C       D+ TK  GLVPAS++      SV  R    DD + +GS++ K    RR
Sbjct: 1204 RKMLEPMRELIQSERDYIKDLERCVNIYVKEFDQAAKNGTIPT-LNPLKYEIFGNIEKIFKFHNDKLLHELIKYE--NQ------------PEAVGASFIVWIDLLNELYTEYCVNKEQKNHVIATPDAVSFFTGIRER--HGLE-INNEIASLLIKPVQRITRYRLLIEQLMRSC-TDKTNDLKEAYEVVCSVPRKVNDLIHYNCLDLKDFK-------VDELGPFVTQDTLTFWEPRAYFKGRGKERQVFLFDISIVFAKRIEVSPKNIKYVIKGKPLPLSEVSIVEHVEGDTCRFGLRVGTVSS-NDNRIDLKANNHHTKVKWVQKIRDLTAGMLPLGLGVSEAYSVGTLSTARSVSVRSGASTSSGGENRQSQDVESLLRHRYSVHSCDSEQSSEVWIVTADFDGQVEGHLTVHKGDRVEIVEDQATDCAEYVQV-VLC-------DQPTK-HGLVPASIIAPPESGSVPDR---PDDSNASGSTVSKRKSLRR 1662          

HSP 3 Score: 102.449 bits (254), Expect = 4.827e-21
Identity = 86/362 (23.76%), Postives = 161/362 (44.48%), Query Frame = 3
Query: 4224 QEKAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTG--SAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEP-RQIIKKGRDRRVFLFDVCLVLTKKY--NHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEENQRTRMTSSTSDVA 5294
            +E A  KR +++ E+++TE  YV DL + ++ Y       ++ + +P DLV +  ++F+NI  ILEFHK+ FL EI +              C    E  G  F++Y      +YV Y  NK + + ++ +  D F    +     +   K  +    IKPVQRI KY + LKD+    +        L +A +VM  + K  +D + +  ++    D+ L + G  I      + E     ++K +DRR+FLF+   ++        +     Y +KS  ++ +     ++  D  +F + +    P      +   +  E K +W R + E + ++      + +  +   M+S   D++
Sbjct: 1803 EETARFKRSYVLMELVETEQDYVKDLTSVVEGYIG----NLNKMDLPADLVGKDKIIFANIVNILEFHKTNFLKEIEK--------------CSENYEAAGAAFVKYERRLHTLYVTYCQNKPKSDYLLAQ--DDFEAFFADT-KAKLGHKVALCDLLIKPVQRIMKYQLLLKDILKFTERAKDKTDTLKKALQVMHVVPKACDDMMQVGRLQNF--DKSLSAQGKLIHQGTLQISESIAGNVQKPKDRRIFLFEQSAIIADHIPPKKEFGNPTYIFKSQFMVNKMVFEPNVPDDPLRFVIKSS--DPTQPTSFIANAQSQEEKDEWNRKMSELLDQQKRLLAALVDPRRYNDMSSGMGDLS 2139          

HSP 4 Score: 72.0182 bits (175), Expect = 8.251e-12
Identity = 41/134 (30.60%), Postives = 66/134 (49.25%), Query Frame = 3
Query: 3438 YKTSD-QVTSVLRSLEKEYRR--AEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGKSSVQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFIRVKAEADELI 3830
            YKT +  V  +L  LE EY      DWC    +S   D+  Y+ DLLS+H + KE F K C  A R  +  ++Y+ R       +   + K+     ++  ++  +L+ W  +K  L+ C  FI ++A A EL+
Sbjct:  944 YKTYETAVLPILNQLESEYHSPTVTDWCAGCTSSIDADRAAYVADLLSKHMDYKERFGKGCTYALRNGDFLLRYIRRSTVNQSERKRHETKIADMKNNIRERQSNILELWMQKKLLLEGCQSFIFIEASAKELL 1077          
BLAST of Triple functional domain protein vs. Ensembl Celegans
Match: unc-73 (Guanine nucleotide exchange factor UNC-73B [Source:UniProtKB/TrEMBL;Acc:Q7KPP4])

HSP 1 Score: 105.145 bits (261), Expect = 1.691e-22
Identity = 88/369 (23.85%), Postives = 165/369 (44.72%), Query Frame = 3
Query: 4224 QEKAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTG--SAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEP-RQIIKKGRDRRVFLFDVCLVLT------KKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEENQRTRMTSSTSDVARNA 5303
            +E A  KR +++ E+++TE  YV DL + ++ Y       ++ + +P DLV +  ++F+NI  ILEFHK+ FL EI +              C    E  G  F++Y      +YV Y  NK + + ++ +  D F    +     +   K  +    IKPVQRI KY + LKD+    +        L +A +VM  + K  +D + +  ++    D+ L + G  I      + E     ++K +DRR+FLF+   ++       K++ +      Y +KS  ++ +     ++  D  +F + +    P      +   +  E K +W R + E + ++      + +  +   M+S   D++  A
Sbjct:  157 EETARFKRSYVLMELVETEQDYVKDLTSVVEGYIG----NLNKMDLPADLVGKDKIIFANIVNILEFHKTNFLKEIEK--------------CSENYEAAGAAFVKYERRLHTLYVTYCQNKPKSDYLLAQ--DDFEAFFADT-KAKLGHKVALCDLLIKPVQRIMKYQLLLKDILKFTERAKDKTDTLKKALQVMHVVPKACDDMMQVGRLQNF--DKSLSAQGKLIHQGTLQISESIAGNVQKPKDRRIFLFEQSAIIADHIPPKKEFGNPT----YIFKSQFMVNKMVFEPNVPDDPLRFVIKSSD--PTQPTSFIANAQSQEEKDEWNRKMSELLDQQKRLLAALVDPRRYNDMSSGMGDLSLGA 496          
BLAST of Triple functional domain protein vs. Ensembl Celegans
Match: unc-73 (Guanine nucleotide exchange factor UNC-73B [Source:UniProtKB/TrEMBL;Acc:Q7KPP4])

HSP 1 Score: 105.145 bits (261), Expect = 1.691e-22
Identity = 88/369 (23.85%), Postives = 165/369 (44.72%), Query Frame = 3
Query: 4224 QEKAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTG--SAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEP-RQIIKKGRDRRVFLFDVCLVLT------KKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEENQRTRMTSSTSDVARNA 5303
            +E A  KR +++ E+++TE  YV DL + ++ Y       ++ + +P DLV +  ++F+NI  ILEFHK+ FL EI +              C    E  G  F++Y      +YV Y  NK + + ++ +  D F    +     +   K  +    IKPVQRI KY + LKD+    +        L +A +VM  + K  +D + +  ++    D+ L + G  I      + E     ++K +DRR+FLF+   ++       K++ +      Y +KS  ++ +     ++  D  +F + +    P      +   +  E K +W R + E + ++      + +  +   M+S   D++  A
Sbjct:  157 EETARFKRSYVLMELVETEQDYVKDLTSVVEGYIG----NLNKMDLPADLVGKDKIIFANIVNILEFHKTNFLKEIEK--------------CSENYEAAGAAFVKYERRLHTLYVTYCQNKPKSDYLLAQ--DDFEAFFADT-KAKLGHKVALCDLLIKPVQRIMKYQLLLKDILKFTERAKDKTDTLKKALQVMHVVPKACDDMMQVGRLQNF--DKSLSAQGKLIHQGTLQISESIAGNVQKPKDRRIFLFEQSAIIADHIPPKKEFGNPT----YIFKSQFMVNKMVFEPNVPDDPLRFVIKSSD--PTQPTSFIANAQSQEEKDEWNRKMSELLDQQKRLLAALVDPRRYNDMSSGMGDLSLGA 496          
BLAST of Triple functional domain protein vs. Ensembl Fly
Match: trio (gene:FBgn0024277 transcript:FBtr0072645)

HSP 1 Score: 539.65 bits (1389), Expect = 1.328e-155
Identity = 384/1191 (32.24%), Postives = 597/1191 (50.13%), Query Frame = 3
Query:  489 KAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRA-GTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGL--NSQNQTRSSWVTM----------------------NPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQ--METVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHL-------SSPVPKG--------------SHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELV-SQAHDPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAE--MLPLTIEGVEDELRRFH-NEKRNILDAADKVLKEGSTLCSRLVEEDEKNH------FKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFEAD---VASAIDCLKHEVP-TPMSYNFLNDPRLARSMNE--LEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGKSSVQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFI---RVKAEADELIHNFDEAGVSS 3860
            +A+DLLTLL+  +  L G RD+RGGP+LCFPA    D L  EDL  L+ YL  +P +  K L F+V+IDMR  G    +VK ILKVL+E       +V IIKP+ F++KQ+A ++S K+ F+   VS + L++ ++  QLT  F+G   Y +++W + R+ +EDFF  A DM+D+   L + L+R D  E V  ++  ++ H  +R KI + P+  L+ +G KL   +        Q  T S    M                      NPD    + +  + ++ ++  +  L   W   + +L+Q +Q RLFE D  +M +W+   R +F   Y +IG   S A  L  EH++F V   +V   + R+  VA  L +S HYA+  I+T A +LD  WK F   L++R+ VLQLS  FH +AE +  +   W  A      Q  Q     + SL   I T Q L++    A+ EV S  + L   L       + P P G               +     A DYSEG  H   ++H++ +  + +E        RL   L+L +F+EDV QVL WL  HGE FL++ T +G++  +A     +H  FE VA NT  NA+KL+ AADEL  S   DP EI     ELE ++ +F + VE RR  LD+AV F+ H KD+  W  +L+ + +  E  +    +EG+E  L+++  +++ + ++     + +G  L   +   +  ++       +  L ++   K    +L + R+ R DL L+LR FE D   ++  ++    E+    +S ++    +L R  NE   E   AT+        EV+Q+G +L + FE+ G                   EY ++ ++    +L ++  A      KL+  +   + +  + QV++WI   + ML  + + P++L EAEQL+  H++FQ  + + H  AV     A+  I                    + H    +I         I++ V  +WQ+LV  AEE+HKL+ A+ N+YKT++QV SVL SLE+EY+R +DWC     S   D+   +  L+S+H EQKEAFLKAC LARRT+E F+KY  R       K + +  V + +  L+ +E  VL  W  RK  LD+C  F+   R   +A E IHN  EA +SS
Sbjct:    5 RARDLLTLLQERVVFLTGGRDRRGGPLLCFPATPRRDRLKPEDLRRLLSYLISIPSDAAKNLGFTVIIDMRGNGNCSTNVKTILKVLQEHFSANIHNVVIIKPDNFWQKQRASISSHKYKFETTTVSIESLNKIVESHQLTGDFEGQQLYDHQQWTDARLAIEDFFWQAGDMADRIDDLQEDLNRNDFAEDVPLARHAIDHHNEMRKKITKLPIEDLDMQGKKLLAKINAMAPPGGQAPTNSGGPDMDSGPSSAGQQSQPSQQSRSVGGNPDMSAAVNKALRQIELIHTGQEKLLMLWQHKKVKLDQCFQWRLFEQDCEKMFDWILHNRDVFQMSYVEIGHNYSVAKSLQDEHQKFAVASMNVSVNIDRILAVAARLIESQHYAAQHIKTLAQRLDRTWKDFAAGLDERTAVLQLSVLFHHKAEQYCNSVASWAAA-----CQASQPLPSDIQSLETAIRTHQSLYEAMCQAYTEVHSTSKKLLYQLDHLVQVCNQPPPPGVPDHRKNSNNGSFNKYERQNPAADYSEGASHVLAVIHQILSHHRTLEAKWHQERLRLHQTLALRLFQEDVKQVLDWLKNHGEVFLRKNTGIGRNFHKARVYQTSHDNFENVAQNTYSNAQKLLAAADELARSGEADPNEIYSVARELELQVGSFAERVEQRRRRLDMAVIFYTHEKDVTAWIDKLRTDVSTDETRLSQENLEGIERILQQYQRDQQESSVNVCLTTISQGEALLQEMRSLEYADNTGSIAALEATLEKLNKQKVELEELWSARKFRADLILRLRYFERDARLLSVQMEMWSEELQHADLSRDYQKAEQLIRMHNESVTEIQNATY--------EVVQQGQDLLQLFENAGF----ISMADATHTAQARIEYLLDFLREREIDLEEMSEA---KRAKLEQAVQLCQFQNDANQVISWIRNGEAMLVASFVTPNSLQEAEQLRKGHEQFQIAIEKTHTSAVQVKYRADALIN-------------------ANHYDPLSI-------DEISDDVTKKWQQLVTYAEERHKLVTASINFYKTAEQVCSVLDSLEREYKREDDWCDGGGGS---DKAQAIVQLISKHQEQKEAFLKACTLARRTAETFLKYANRSQQCYQYKGNCEGHVKSKLDKLLTQENQVLDYWTLRKKSLDQCQQFVLFERSAKQAIEWIHNTGEAYLSS 1146          

HSP 2 Score: 268.47 bits (685), Expect = 2.245e-71
Identity = 164/456 (35.96%), Postives = 253/456 (55.48%), Query Frame = 3
Query: 4230 KAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMME-KIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIY-------------------------EENQRTRMTSSTSDVARNADNIF------YVLDDFTALEIS-QLSVQRNQRVQLIEQIGEWASVRTIC-TNSDIVDDESTKVQGLVPASLL 5495
            K+A+++  ++ E++QTE  YVNDL T +K + +    G S   +P  L+ ++DV+F NIKEI  FH+ +FL E+ +Y+               +PED+GHCF+ +A+ F  +YV Y  NK   N ++++    FF EL         ++ + + ++ IKPVQRITKY + LKDL + C+  S GE+ E  EVML + K+ ND +HL  ++    D  ++ LG+ +L D F  W+ +QII+KGR+RRVFLF++ L+  K+   + N + YQ+KS ++ T+  ITEHIEGD+ KFA+WTGR P L + R+VLK   LE KQ WV+ LRE MQE  FS   +                           ++ R  + S  S    ++DN        +V+ D+ A   S +LSV + Q+V+++E     A     C    +   D++   +GLVP S+L
Sbjct: 1279 KSARRKEFIMAELMQTERAYVNDLATCIKCFLEEFRAGKS---VPSALIGQEDVIFGNIKEIHHFHQKIFLRELEKYET--------------MPEDVGHCFVTWASKFD-MYVHYCKNKPTSNNLLVQHGGSFFEELQRRL-----EVDHPLPAYLIKPVQRITKYQLLLKDLLSCCEE-SHGEIKEGLEVMLNVPKKANDAMHLSLLENC--DVSVDKLGEVVLQDAFQAWDTKQIIRKGRERRVFLFELYLLFAKEVK-ESNVVKYQFKSKLMTTDMGITEHIEGDETKFAVWTGRSPMLSDCRIVLKATSLETKQIWVKKLREVMQETCFSGTSLTLPKSPAKHSGSSQRSSRDLDEQLTENDHDRCSLASFGSGNTTDSDNKLGNQEATWVVADYIATSGSNELSVSKGQQVEIVEP--PTAGEPDFCLVRLNPQHDDAAVQEGLVPVSVL 1705          

HSP 3 Score: 91.6633 bits (226), Expect = 1.185e-17
Identity = 98/350 (28.00%), Postives = 154/350 (44.00%), Query Frame = 3
Query: 4221 IQEKAA--KKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRK-DVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAG------ELSEAWEVMLEMNKRINDEI----HLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLT---KKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQER 5222
            + +KAA  KKR  +  E++ TE  YV DL   +  Y   I    SDI +P+DL   K  ++F+NIK+I E+H+  FL  +                C   P D+G    R A  F  +Y  Y SNK     I+     +F+ +          + N I    IKPVQRITKY + +K++     T  AG       L EA++ M  + K +ND +     L+D  G      + + G  ++             +K R+ +VFLF   ++     K  N   + IF +Y+SHI L    + E   GD C+F + +   P + E  ++ +    E    W   L + +Q++
Sbjct: 1932 VSDKAAALKKRQCVFAELMSTEEAYVQDLHEIVNGYMTEINNTNSDIPMPEDLKGGKMKLVFNNIKDIYEWHRDFFLRALR--------------NCQKSPADLGPLIKRSATKF-ALYYTYCSNKPLSEYIVSAHYQYFDSIRQK-LGHRLDLSNLI----IKPVQRITKYELLIKEIIKA--TEGAGLYKEVPMLQEAYQQMKVVVKTVNDMMVVLRSLQDFDG-----EITAQGSLLMQGPMNC--VVDAAQKHRELQVFLFQQIIIFADIEKTKNQYASPIF-KYRSHIQLNHMQMKEL--GD-CRFQIRSTD-PKIPEMTIICQAASQENYAGWRDMLNKILQQQ 2247          

HSP 4 Score: 65.0846 bits (157), Expect = 1.278e-9
Identity = 78/367 (21.25%), Postives = 146/367 (39.78%), Query Frame = 3
Query: 1272 LYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQL---GQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFL-KRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGF 2357
            L E    L+   +A R++LEQ  QL  F++D  ++  W+     + +  +     +  +A  L   H QF +          ++   A+ L ++ HY    I   +  +   W+   T  E+R  ++  S +F+  AE   +     E   K+++      G  +   ++ Q I+      QE + A  + C+    LA   +    K ++ S            H    + ++     +V      R K L      ++F     Q + W++  GE +L  R   VG S +  E L   H +F   A  T    + LI  AD LV + H    +I Q    +++R + F+  +++    L+ ++G 
Sbjct:  874 LREREIDLEEMSEAKRAKLEQAVQLCQFQNDANQVISWIRNGEAMLVASF-VTPNSLQEAEQLRKGHEQFQIAIEKTHTSAVQVKYRADALINANHYDPLSIDEISDDVTKKWQQLVTYAEERHKLVTASINFYKTAEQVCSVLDSLEREYKREDDWCDGGGGSDKAQAIVQLISK----HQEQKEAFLKACT----LARRTAETFLKYANRSQQCYQYKGNCEGHVKSKLDKLLTQENQVLDYWTLRKKSLDQCQQFVLFERSAKQAIEWIHNTGEAYLSSRSNLVGISKEETEGLLKEHNEFRSTAKETRERVKLLIQLADSLVEKGHAHASDIKQWVASVDQRYKDFSNRMDSYCEQLEKSLGM 1231          
BLAST of Triple functional domain protein vs. Ensembl Fly
Match: trio (gene:FBgn0024277 transcript:FBtr0072644)

HSP 1 Score: 539.65 bits (1389), Expect = 1.328e-155
Identity = 384/1191 (32.24%), Postives = 597/1191 (50.13%), Query Frame = 3
Query:  489 KAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRA-GTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGL--NSQNQTRSSWVTM----------------------NPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQ--METVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHL-------SSPVPKG--------------SHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELV-SQAHDPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAE--MLPLTIEGVEDELRRFH-NEKRNILDAADKVLKEGSTLCSRLVEEDEKNH------FKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFEAD---VASAIDCLKHEVP-TPMSYNFLNDPRLARSMNE--LEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGKSSVQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFI---RVKAEADELIHNFDEAGVSS 3860
            +A+DLLTLL+  +  L G RD+RGGP+LCFPA    D L  EDL  L+ YL  +P +  K L F+V+IDMR  G    +VK ILKVL+E       +V IIKP+ F++KQ+A ++S K+ F+   VS + L++ ++  QLT  F+G   Y +++W + R+ +EDFF  A DM+D+   L + L+R D  E V  ++  ++ H  +R KI + P+  L+ +G KL   +        Q  T S    M                      NPD    + +  + ++ ++  +  L   W   + +L+Q +Q RLFE D  +M +W+   R +F   Y +IG   S A  L  EH++F V   +V   + R+  VA  L +S HYA+  I+T A +LD  WK F   L++R+ VLQLS  FH +AE +  +   W  A      Q  Q     + SL   I T Q L++    A+ EV S  + L   L       + P P G               +     A DYSEG  H   ++H++ +  + +E        RL   L+L +F+EDV QVL WL  HGE FL++ T +G++  +A     +H  FE VA NT  NA+KL+ AADEL  S   DP EI     ELE ++ +F + VE RR  LD+AV F+ H KD+  W  +L+ + +  E  +    +EG+E  L+++  +++ + ++     + +G  L   +   +  ++       +  L ++   K    +L + R+ R DL L+LR FE D   ++  ++    E+    +S ++    +L R  NE   E   AT+        EV+Q+G +L + FE+ G                   EY ++ ++    +L ++  A      KL+  +   + +  + QV++WI   + ML  + + P++L EAEQL+  H++FQ  + + H  AV     A+  I                    + H    +I         I++ V  +WQ+LV  AEE+HKL+ A+ N+YKT++QV SVL SLE+EY+R +DWC     S   D+   +  L+S+H EQKEAFLKAC LARRT+E F+KY  R       K + +  V + +  L+ +E  VL  W  RK  LD+C  F+   R   +A E IHN  EA +SS
Sbjct:    5 RARDLLTLLQERVVFLTGGRDRRGGPLLCFPATPRRDRLKPEDLRRLLSYLISIPSDAAKNLGFTVIIDMRGNGNCSTNVKTILKVLQEHFSANIHNVVIIKPDNFWQKQRASISSHKYKFETTTVSIESLNKIVESHQLTGDFEGQQLYDHQQWTDARLAIEDFFWQAGDMADRIDDLQEDLNRNDFAEDVPLARHAIDHHNEMRKKITKLPIEDLDMQGKKLLAKINAMAPPGGQAPTNSGGPDMDSGPSSAGQQSQPSQQSRSVGGNPDMSAAVNKALRQIELIHTGQEKLLMLWQHKKVKLDQCFQWRLFEQDCEKMFDWILHNRDVFQMSYVEIGHNYSVAKSLQDEHQKFAVASMNVSVNIDRILAVAARLIESQHYAAQHIKTLAQRLDRTWKDFAAGLDERTAVLQLSVLFHHKAEQYCNSVASWAAA-----CQASQPLPSDIQSLETAIRTHQSLYEAMCQAYTEVHSTSKKLLYQLDHLVQVCNQPPPPGVPDHRKNSNNGSFNKYERQNPAADYSEGASHVLAVIHQILSHHRTLEAKWHQERLRLHQTLALRLFQEDVKQVLDWLKNHGEVFLRKNTGIGRNFHKARVYQTSHDNFENVAQNTYSNAQKLLAAADELARSGEADPNEIYSVARELELQVGSFAERVEQRRRRLDMAVIFYTHEKDVTAWIDKLRTDVSTDETRLSQENLEGIERILQQYQRDQQESSVNVCLTTISQGEALLQEMRSLEYADNTGSIAALEATLEKLNKQKVELEELWSARKFRADLILRLRYFERDARLLSVQMEMWSEELQHADLSRDYQKAEQLIRMHNESVTEIQNATY--------EVVQQGQDLLQLFENAGF----ISMADATHTAQARIEYLLDFLREREIDLEEMSEA---KRAKLEQAVQLCQFQNDANQVISWIRNGEAMLVASFVTPNSLQEAEQLRKGHEQFQIAIEKTHTSAVQVKYRADALIN-------------------ANHYDPLSI-------DEISDDVTKKWQQLVTYAEERHKLVTASINFYKTAEQVCSVLDSLEREYKREDDWCDGGGGS---DKAQAIVQLISKHQEQKEAFLKACTLARRTAETFLKYANRSQQCYQYKGNCEGHVKSKLDKLLTQENQVLDYWTLRKKSLDQCQQFVLFERSAKQAIEWIHNTGEAYLSS 1146          

HSP 2 Score: 268.47 bits (685), Expect = 2.245e-71
Identity = 164/456 (35.96%), Postives = 253/456 (55.48%), Query Frame = 3
Query: 4230 KAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMME-KIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIY-------------------------EENQRTRMTSSTSDVARNADNIF------YVLDDFTALEIS-QLSVQRNQRVQLIEQIGEWASVRTIC-TNSDIVDDESTKVQGLVPASLL 5495
            K+A+++  ++ E++QTE  YVNDL T +K + +    G S   +P  L+ ++DV+F NIKEI  FH+ +FL E+ +Y+               +PED+GHCF+ +A+ F  +YV Y  NK   N ++++    FF EL         ++ + + ++ IKPVQRITKY + LKDL + C+  S GE+ E  EVML + K+ ND +HL  ++    D  ++ LG+ +L D F  W+ +QII+KGR+RRVFLF++ L+  K+   + N + YQ+KS ++ T+  ITEHIEGD+ KFA+WTGR P L + R+VLK   LE KQ WV+ LRE MQE  FS   +                           ++ R  + S  S    ++DN        +V+ D+ A   S +LSV + Q+V+++E     A     C    +   D++   +GLVP S+L
Sbjct: 1279 KSARRKEFIMAELMQTERAYVNDLATCIKCFLEEFRAGKS---VPSALIGQEDVIFGNIKEIHHFHQKIFLRELEKYET--------------MPEDVGHCFVTWASKFD-MYVHYCKNKPTSNNLLVQHGGSFFEELQRRL-----EVDHPLPAYLIKPVQRITKYQLLLKDLLSCCEE-SHGEIKEGLEVMLNVPKKANDAMHLSLLENC--DVSVDKLGEVVLQDAFQAWDTKQIIRKGRERRVFLFELYLLFAKEVK-ESNVVKYQFKSKLMTTDMGITEHIEGDETKFAVWTGRSPMLSDCRIVLKATSLETKQIWVKKLREVMQETCFSGTSLTLPKSPAKHSGSSQRSSRDLDEQLTENDHDRCSLASFGSGNTTDSDNKLGNQEATWVVADYIATSGSNELSVSKGQQVEIVEP--PTAGEPDFCLVRLNPQHDDAAVQEGLVPVSVL 1705          

HSP 3 Score: 91.6633 bits (226), Expect = 1.185e-17
Identity = 98/350 (28.00%), Postives = 154/350 (44.00%), Query Frame = 3
Query: 4221 IQEKAA--KKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRK-DVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAG------ELSEAWEVMLEMNKRINDEI----HLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLT---KKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQER 5222
            + +KAA  KKR  +  E++ TE  YV DL   +  Y   I    SDI +P+DL   K  ++F+NIK+I E+H+  FL  +                C   P D+G    R A  F  +Y  Y SNK     I+     +F+ +          + N I    IKPVQRITKY + +K++     T  AG       L EA++ M  + K +ND +     L+D  G      + + G  ++             +K R+ +VFLF   ++     K  N   + IF +Y+SHI L    + E   GD C+F + +   P + E  ++ +    E    W   L + +Q++
Sbjct: 1932 VSDKAAALKKRQCVFAELMSTEEAYVQDLHEIVNGYMTEINNTNSDIPMPEDLKGGKMKLVFNNIKDIYEWHRDFFLRALR--------------NCQKSPADLGPLIKRSATKF-ALYYTYCSNKPLSEYIVSAHYQYFDSIRQK-LGHRLDLSNLI----IKPVQRITKYELLIKEIIKA--TEGAGLYKEVPMLQEAYQQMKVVVKTVNDMMVVLRSLQDFDG-----EITAQGSLLMQGPMNC--VVDAAQKHRELQVFLFQQIIIFADIEKTKNQYASPIF-KYRSHIQLNHMQMKEL--GD-CRFQIRSTD-PKIPEMTIICQAASQENYAGWRDMLNKILQQQ 2247          

HSP 4 Score: 65.0846 bits (157), Expect = 1.278e-9
Identity = 78/367 (21.25%), Postives = 146/367 (39.78%), Query Frame = 3
Query: 1272 LYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQL---GQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFL-KRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGF 2357
            L E    L+   +A R++LEQ  QL  F++D  ++  W+     + +  +     +  +A  L   H QF +          ++   A+ L ++ HY    I   +  +   W+   T  E+R  ++  S +F+  AE   +     E   K+++      G  +   ++ Q I+      QE + A  + C+    LA   +    K ++ S            H    + ++     +V      R K L      ++F     Q + W++  GE +L  R   VG S +  E L   H +F   A  T    + LI  AD LV + H    +I Q    +++R + F+  +++    L+ ++G 
Sbjct:  874 LREREIDLEEMSEAKRAKLEQAVQLCQFQNDANQVISWIRNGEAMLVASF-VTPNSLQEAEQLRKGHEQFQIAIEKTHTSAVQVKYRADALINANHYDPLSIDEISDDVTKKWQQLVTYAEERHKLVTASINFYKTAEQVCSVLDSLEREYKREDDWCDGGGGSDKAQAIVQLISK----HQEQKEAFLKACT----LARRTAETFLKYANRSQQCYQYKGNCEGHVKSKLDKLLTQENQVLDYWTLRKKSLDQCQQFVLFERSAKQAIEWIHNTGEAYLSSRSNLVGISKEETEGLLKEHNEFRSTAKETRERVKLLIQLADSLVEKGHAHASDIKQWVASVDQRYKDFSNRMDSYCEQLEKSLGM 1231          
BLAST of Triple functional domain protein vs. Ensembl Fly
Match: CG30440 (gene:FBgn0050440 transcript:FBtr0086076)

HSP 1 Score: 129.798 bits (325), Expect = 1.723e-29
Identity = 106/342 (30.99%), Postives = 168/342 (49.12%), Query Frame = 3
Query: 4218 QIQEKAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKID---FFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSA-GELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVW-EPRQIIK---KGRDRRVFLFDVCLVLTKKYNHDD-NKIFYQYKSHILLTECNITEHIEGDQCKFALW-TGRVPPLGEYRLVLKGKDLEIKQKWVRALRETM 5213
            Q  E    +R H++ E+ +TE  YVN++ + LK YY  +    SD   P  L  + +VLF N+ EI  FH  VFL ++           EN   C  + E +  CF++  + F ++Y  Y  N     ++    +D   FF E    C  G    K  + ++ +KPVQRITKY + LKDL    D  S   EL  A + ML + K +ND +H   I G   D  L   G+ ++ D F VW E ++ I+   K + R +FL+   L+L K+ +    NK  YQ+KS + +++  +TE + GD  +F +W  GR     +    L+   + +K+ WV  ++  +
Sbjct:  610 QDPEMQRHRRGHILKELFETEKIYVNEIASILKGYYDRLK---SDESAPASLQGKANVLFGNLNEIYSFHNDVFLKDL-----------EN---CISVTERVALCFVKRRDKFYQLYSFYCQNIQRSEKLRETLVDTHMFFKE----CQIGLGH-KLPLGAYLLKPVQRITKYQLLLKDLLLFTDNDSCRNELKNALDCMLIVLKCVNDSMHQISITGFSGD--LAKQGELLMQDSFQVWIESKKDIRLRMKPKRRHIFLYQKSLLLCKQTSKSGYNKSSYQFKSDVKMSQIGLTESVSGDAKRFEVWLKGR-----QEVYTLQASTIGVKEMWVAEIKRVL 922          
BLAST of Triple functional domain protein vs. Ensembl Fly
Match: Pura (gene:FBgn0035802 transcript:FBtr0089849)

HSP 1 Score: 97.0561 bits (240), Expect = 1.926e-19
Identity = 93/333 (27.93%), Postives = 152/333 (45.65%), Query Frame = 3
Query: 4230 KAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDT--GSA--------GELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIF--YQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWV 5192
            K  K  + ++ EMI TE  YV  L   ++ Y   I E + +  IPQ L  +++V+F NI++I EFH S FL E+ +Y        E N      P  +G  F+   + F  +Y  Y  NK + + ++ E    F +        + Q K  + S+ +KPVQR+ KY + L+ L   C    G+A         EL  A E++    +  ND + +  ++    D  ++  G  +  ++F VW+ R    K   R+VFLF+  ++ +K     D+K    Y YK+ I  ++  +T H      KF +W  +  P   + L    +D  IK  W 
Sbjct:  869 KIQKTLLLIMREMIGTERDYVRSLYYVIENY---IDELLRE-DIPQPLRGQRNVIFGNIEKIFEFHNSHFLGELERY--------ERN------PLKVGAAFLEMESKF-YLYALYNKNKPKSDTLLSEYGSSFFKPKQM----QLQDKLDLASYLLKPVQRMGKYALLLQQLVKACKGVEGAALQEIAADVEELQRAEEMVKFQLRHGNDLLAMDSLRDC--DVNVKEQGRLLRQNEFLVWQGRG--GKKTLRQVFLFEELVLFSKARRFPDHKNLDIYIYKNSIKTSDIGLTAHTGDSATKFEIWFRKRKPDDTWMLQCMSED--IKNAWT 1172          
BLAST of Triple functional domain protein vs. Ensembl Fly
Match: Pura (gene:FBgn0035802 transcript:FBtr0089850)

HSP 1 Score: 97.4413 bits (241), Expect = 2.078e-19
Identity = 93/333 (27.93%), Postives = 152/333 (45.65%), Query Frame = 3
Query: 4230 KAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDT--GSA--------GELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIF--YQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWV 5192
            K  K  + ++ EMI TE  YV  L   ++ Y   I E + +  IPQ L  +++V+F NI++I EFH S FL E+ +Y        E N      P  +G  F+   + F  +Y  Y  NK + + ++ E    F +        + Q K  + S+ +KPVQR+ KY + L+ L   C    G+A         EL  A E++    +  ND + +  ++    D  ++  G  +  ++F VW+ R    K   R+VFLF+  ++ +K     D+K    Y YK+ I  ++  +T H      KF +W  +  P   + L    +D  IK  W 
Sbjct: 1345 KIQKTLLLIMREMIGTERDYVRSLYYVIENY---IDELLRE-DIPQPLRGQRNVIFGNIEKIFEFHNSHFLGELERY--------ERN------PLKVGAAFLEMESKF-YLYALYNKNKPKSDTLLSEYGSSFFKPKQM----QLQDKLDLASYLLKPVQRMGKYALLLQQLVKACKGVEGAALQEIAADVEELQRAEEMVKFQLRHGNDLLAMDSLRDC--DVNVKEQGRLLRQNEFLVWQGRG--GKKTLRQVFLFEELVLFSKARRFPDHKNLDIYIYKNSIKTSDIGLTAHTGDSATKFEIWFRKRKPDDTWMLQCMSED--IKNAWT 1648          
BLAST of Triple functional domain protein vs. Ensembl Zebrafish
Match: trioa (trio Rho guanine nucleotide exchange factor a [Source:NCBI gene;Acc:557667])

HSP 1 Score: 649.818 bits (1675), Expect = 0.000e+0
Identity = 397/1159 (34.25%), Postives = 638/1159 (55.05%), Query Frame = 3
Query:  486 LKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQT-------RSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRLVE----------EDEKNHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFE---ADVASAIDCLKHEVPTPMSYNF------LNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGKSS----VQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFI---RVKAEADELIHNFDEAGVSS 3860
            +KA ++L +LK  +A L G RDKRGGPVL FP+ ++ D +  EDL  L+ YL  +P E+V K  F+V++DMR G+ W S+KP+LK+L+E    C     IIKP+ F++KQ+    SSKF F+  +VS + L + +D SQLT  F+G+L Y++EEWIEIR+  EDF   A  +  +   +++ + RKD+P+ +  ++R +E+H +++ ++I+APV  ++ EG +L   ++   +  N+T       R      N D Q L+P++   +++L+  R +L   W   + +L+Q +QLRLFE D  +M +W+   + LFL  Y +IG     A +L  +H  F +NC +V   ++R+  V N L ++GHYAS QI+  + +L+ +WK+F  AL++RS +L++SA+FH + + +++N   W  A  + ++     E  ++++ +    Q L++    A+ EV  DG+AL   L  P+  GS  SL A+ +Y++   H   ++HEV    +++E +  HR  RL  RL L +F++DV QVL W+  HGE FL + T VGKSL RA  L   H  FEEVA NT  NA+KL+ AA++L      DPEEI Q   +LE RIQ F + VE R+  LD++V FH H K+L+ W  +L++     ++   ++E V+D ++RF  +++  L     V+KEG  L  +L +              NH + +L Q+   +    +L  ER+++L+L LQLR+FE    D+ S +D    E+   M+  F      L + RL    ++   +       I  G+E++Q  +E+    ++ GV           + V D  E+  E+ Q L        +A ++    L+  +  R L+ + +QVL WI   + ML    +  S+L EAEQLQ EH++FQ  + + H  A+     AE  +Q   + +                             ++ AE VA  WQ+L+   E++ KL+ A+  +YKTS+QV SVL SLE+EY+R EDWC          +  ++  ++S+H EQKEAFLKAC LARR ++ F+KY+ R     PG  S     +++V   + +L+ +E  VL  W  RK RLD+C  ++   R   +A E IH+  E  +S+
Sbjct:   60 MKAMEVLPILKEKVAFLSGGRDKRGGPVLTFPSRTNHDRIRHEDLRRLIAYLAGIPSEDVCKHGFTVIVDMR-GSKWDSIKPLLKILQESFPCCIHIALIIKPDNFWQKQRTNFGSSKFEFETTMVSLEGLSKVVDPSQLTADFEGSLDYNHEEWIEIRVAFEDFTGNARHLLARLEEMHETVTRKDLPQDLDGARRMIEEHAALKKRVIKAPVEEVDNEGQRLLQRIQSSESYANRTVPVPPGQREGQGQPNADTQGLVPRITALLEKLHSTRQNLHQSWHIRKLQLDQCFQLRLFEQDAEKMFDWIMHNKGLFLAGYTEIGNNHPHAMELQTQHNHFAMNCMNVYVNINRIMSVGNRLLEAGHYASQQIKQISGQLEQEWKAFAAALDERSALLEMSATFHQKCDQYMSNVDSWCKACGEVDLPSELQELEDAIHHH----QGLYEHITAAYSEVSQDGKALLDKLQRPLTPGSADSLTASANYTKAVNHVLDIIHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYQAAHQLEDRIQDFVRRVEQRKVLLDMSVAFHTHVKELWTWLEELQKEL-LDDVYAESVEAVQDLIKRFGQQQQTTLQFTVNVIKEGEDLIQQLRDLAISSNKTPHNSSINHIESVLQQLDEAQAQMEELFQERKIKLELFLQLRIFERDAIDIISDLDSWNEELSQQMN-EFDTEDLTLAEQRLQHHADKALTMNNLAFHVIHQGQELLQYVNEV----QASGVELLCDRDVDMATRVQDLLEFLHEKQQELD-------VAAEQHRRHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEALLQANHYDM--------------------------DMIRDCAENVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNCESDHVTPMISKHLEQKEAFLKACTLARRNADVFLKYMHRNSVSMPGMLSHVKAPEQQVKNILNELLQRENRVLHFWTMRKRRLDQCQQYVVFERSAKQALEWIHDTGEFYLST 1174          

HSP 2 Score: 276.174 bits (705), Expect = 1.958e-73
Identity = 154/470 (32.77%), Postives = 255/470 (54.26%), Query Frame = 3
Query: 4224 QEKAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKID-FFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEE------------------------------------NQRTRMTSSTSDVARNADNIFYVLDDFTALEISQLSVQRNQRVQLIEQI---GEWASVRTICTNSDIVDDESTKVQGLVPASLLISVSTR 5513
            + K+A+++  ++ E+IQTE  YV DL   + TY   +  G+ +I  P  +V ++ ++F N++++ EFH ++FL E+ +Y+               LPED+GHCF+ +A+ F+ +YV Y  NK +  Q+++E    +F+E+         ++ N+I S+ IKPVQRITKY + LK+L   C+ G  GE+ +  EVML + KR ND +HL  ++G  E+  +ES G+ IL + F VW+P+ +I+KGR+R +FLF++ L+ +K+    + +  Y YKS +  +E  +TEH+EGD CKFALW GR  P  + ++VLK   +E KQ W++ +RE +QER        +E                                      RT   +  SD       +  V+ DF A   ++L+++R Q V+++E++    +W  VRT         D S  ++GLVP ++L    +R
Sbjct: 1296 KRKSARRKDFIMAELIQTEKAYVRDLRECMDTYLWEMTSGVEEI--PPGIVNKEHIIFGNMQDLYEFHHNIFLKELEKYEQ--------------LPEDVGHCFVTWADKFQ-MYVNYCKNKPDSTQLILEHAGGYFDEIQQ-----RHRLANSISSYLIKPVQRITKYQLLLKELLTCCEEGK-GEIKDGLEVMLSVPKRANDAMHLSMLEGFDEN--IESQGELILQEAFQVWDPKTLIRKGRERHLFLFEMSLIFSKEVKDSNGRSKYIYKSKLFTSELGVTEHVEGDPCKFALWVGRT-PTSDNKIVLKASGIENKQDWIKHIREVIQERTVHLKGALKEPIHIPKASTAKHKGRRDGEDLDSQGDGSSQPDTISLASRTSQNTLDSDKLSGGCELTVVIHDFMAGNSNELTIRRGQTVEVLERLHDKPDWCLVRTT--------DRSPALEGLVPCAMLCIAHSR 1731          

HSP 3 Score: 125.946 bits (315), Expect = 5.991e-28
Identity = 95/334 (28.44%), Postives = 164/334 (49.10%), Query Frame = 3
Query: 4239 KKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKD---LCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPR-QIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIF----YQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQ 5216
            KKR +++ E+I+TE  YV DL   ++ Y   + E      +P D+  +  ++F NI++I ++HK  FL E+ +              C   P+ +G  F+++      +Y+ Y  NK +   I+ E ID + E +        Q+ + +    IKPVQRI KY + LKD         T S  EL +A EVM  + KR ND +++  ++G   D  + + G  +L D F V EP   ++ + ++RRVFLF+  ++ ++    D  + F    Y YK  I +    + + ++GD CKFAL T R     +   +L      ++Q W+  + + ++
Sbjct: 1978 KKRHYVLLELIETERDYVRDLSLVVEGYMARMRED----GVPDDMKGKDKIVFGNIQQIYDWHKDFFLGELEK--------------CLEDPDRLGPLFLKHERRL-HMYIVYCQNKPKSEHIVSEYIDTYFEDLKQRLGHRLQITDLL----IKPVQRIMKYQLLLKDFLKFSKKIGTDSI-ELEKAVEVMCIVPKRCNDMMNVGRLQGF--DGKIVAQGRLLLQDTFMVAEPEGGLLNRMKERRVFLFEQIVIFSEPL--DKKRGFSMPGYLYKYSIKVNCLGLEDSVDGDPCKFAL-TSRTSNSSKDAFILHSSHPGVRQVWMLQISQILE 2282          

HSP 4 Score: 60.077 bits (144), Expect = 5.572e-8
Identity = 31/129 (24.03%), Postives = 60/129 (46.51%), Query Frame = 3
Query: 1248 QVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALE 1634
            QVK  + +L +    + H W   + RL+Q  Q  +FE    +  EW++     +L+ +   G +     +L  EH  F +     +E+V  L  +A+   D GH  +A+I+     +D  ++ F+  ++
Sbjct: 1118 QVKNILNELLQRENRVLHFWTMRKRRLDQCQQYVVFERSAKQALEWIHDTGEFYLSTHTSTGSSIHHTQELLKEHEDFHITAKQTKERVKLLIQLADGFCDKGHSHAAEIKKWVTAVDKRYRDFSLRMD 1246          
BLAST of Triple functional domain protein vs. Ensembl Zebrafish
Match: trioa (trio Rho guanine nucleotide exchange factor a [Source:NCBI gene;Acc:557667])

HSP 1 Score: 649.047 bits (1673), Expect = 0.000e+0
Identity = 397/1159 (34.25%), Postives = 638/1159 (55.05%), Query Frame = 3
Query:  486 LKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQT-------RSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRLVE----------EDEKNHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFE---ADVASAIDCLKHEVPTPMSYNF------LNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGKSS----VQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFI---RVKAEADELIHNFDEAGVSS 3860
            +KA ++L +LK  +A L G RDKRGGPVL FP+ ++ D +  EDL  L+ YL  +P E+V K  F+V++DMR G+ W S+KP+LK+L+E    C     IIKP+ F++KQ+    SSKF F+  +VS + L + +D SQLT  F+G+L Y++EEWIEIR+  EDF   A  +  +   +++ + RKD+P+ +  ++R +E+H +++ ++I+APV  ++ EG +L   ++   +  N+T       R      N D Q L+P++   +++L+  R +L   W   + +L+Q +QLRLFE D  +M +W+   + LFL  Y +IG     A +L  +H  F +NC +V   ++R+  V N L ++GHYAS QI+  + +L+ +WK+F  AL++RS +L++SA+FH + + +++N   W  A  + ++     E  ++++ +    Q L++    A+ EV  DG+AL   L  P+  GS  SL A+ +Y++   H   ++HEV    +++E +  HR  RL  RL L +F++DV QVL W+  HGE FL + T VGKSL RA  L   H  FEEVA NT  NA+KL+ AA++L      DPEEI Q   +LE RIQ F + VE R+  LD++V FH H K+L+ W  +L++     ++   ++E V+D ++RF  +++  L     V+KEG  L  +L +              NH + +L Q+   +    +L  ER+++L+L LQLR+FE    D+ S +D    E+   M+  F      L + RL    ++   +       I  G+E++Q  +E+    ++ GV           + V D  E+  E+ Q L        +A ++    L+  +  R L+ + +QVL WI   + ML    +  S+L EAEQLQ EH++FQ  + + H  A+     AE  +Q   + +                             ++ AE VA  WQ+L+   E++ KL+ A+  +YKTS+QV SVL SLE+EY+R EDWC          +  ++  ++S+H EQKEAFLKAC LARR ++ F+KY+ R     PG  S     +++V   + +L+ +E  VL  W  RK RLD+C  ++   R   +A E IH+  E  +S+
Sbjct:   48 MKAMEVLPILKEKVAFLSGGRDKRGGPVLTFPSRTNHDRIRHEDLRRLIAYLAGIPSEDVCKHGFTVIVDMR-GSKWDSIKPLLKILQESFPCCIHIALIIKPDNFWQKQRTNFGSSKFEFETTMVSLEGLSKVVDPSQLTADFEGSLDYNHEEWIEIRVAFEDFTGNARHLLARLEEMHETVTRKDLPQDLDGARRMIEEHAALKKRVIKAPVEEVDNEGQRLLQRIQSSESYANRTVPVPPGQREGQGQPNADTQGLVPRITALLEKLHSTRQNLHQSWHIRKLQLDQCFQLRLFEQDAEKMFDWIMHNKGLFLAGYTEIGNNHPHAMELQTQHNHFAMNCMNVYVNINRIMSVGNRLLEAGHYASQQIKQISGQLEQEWKAFAAALDERSALLEMSATFHQKCDQYMSNVDSWCKACGEVDLPSELQELEDAIHHH----QGLYEHITAAYSEVSQDGKALLDKLQRPLTPGSADSLTASANYTKAVNHVLDIIHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYQAAHQLEDRIQDFVRRVEQRKVLLDMSVAFHTHVKELWTWLEELQKEL-LDDVYAESVEAVQDLIKRFGQQQQTTLQFTVNVIKEGEDLIQQLRDLAISSNKTPHNSSINHIESVLQQLDEAQAQMEELFQERKIKLELFLQLRIFERDAIDIISDLDSWNEELSQQMN-EFDTEDLTLAEQRLQHHADKALTMNNLAFHVIHQGQELLQYVNEV----QASGVELLCDRDVDMATRVQDLLEFLHEKQQELD-------VAAEQHRRHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEALLQANHYDM--------------------------DMIRDCAENVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNCESDHVTPMISKHLEQKEAFLKACTLARRNADVFLKYMHRNSVSMPGMLSHVKAPEQQVKNILNELLQRENRVLHFWTMRKRRLDQCQQYVVFERSAKQALEWIHDTGEFYLST 1162          

HSP 2 Score: 275.789 bits (704), Expect = 2.019e-73
Identity = 154/470 (32.77%), Postives = 255/470 (54.26%), Query Frame = 3
Query: 4224 QEKAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKID-FFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEE------------------------------------NQRTRMTSSTSDVARNADNIFYVLDDFTALEISQLSVQRNQRVQLIEQI---GEWASVRTICTNSDIVDDESTKVQGLVPASLLISVSTR 5513
            + K+A+++  ++ E+IQTE  YV DL   + TY   +  G+ +I  P  +V ++ ++F N++++ EFH ++FL E+ +Y+               LPED+GHCF+ +A+ F+ +YV Y  NK +  Q+++E    +F+E+         ++ N+I S+ IKPVQRITKY + LK+L   C+ G  GE+ +  EVML + KR ND +HL  ++G  E+  +ES G+ IL + F VW+P+ +I+KGR+R +FLF++ L+ +K+    + +  Y YKS +  +E  +TEH+EGD CKFALW GR  P  + ++VLK   +E KQ W++ +RE +QER        +E                                      RT   +  SD       +  V+ DF A   ++L+++R Q V+++E++    +W  VRT         D S  ++GLVP ++L    +R
Sbjct: 1284 KRKSARRKDFIMAELIQTEKAYVRDLRECMDTYLWEMTSGVEEI--PPGIVNKEHIIFGNMQDLYEFHHNIFLKELEKYEQ--------------LPEDVGHCFVTWADKFQ-MYVNYCKNKPDSTQLILEHAGGYFDEIQQ-----RHRLANSISSYLIKPVQRITKYQLLLKELLTCCEEGK-GEIKDGLEVMLSVPKRANDAMHLSMLEGFDEN--IESQGELILQEAFQVWDPKTLIRKGRERHLFLFEMSLIFSKEVKDSNGRSKYIYKSKLFTSELGVTEHVEGDPCKFALWVGRT-PTSDNKIVLKASGIENKQDWIKHIREVIQERTVHLKGALKEPIHIPKASTAKHKGRRDGEDLDSQGDGSSQPDTISLASRTSQNTLDSDKLSGGCELTVVIHDFMAGNSNELTIRRGQTVEVLERLHDKPDWCLVRTT--------DRSPALEGLVPCAMLCIAHSR 1719          

HSP 3 Score: 125.946 bits (315), Expect = 6.295e-28
Identity = 96/334 (28.74%), Postives = 162/334 (48.50%), Query Frame = 3
Query: 4239 KKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKD---LCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPR-QIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIF----YQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQ 5216
            KKR +++ E+I+TE  YV DL   ++ Y   + E      +P D+  +  ++F NI++I ++HK  FL E+ +              C   P+ +G  F+++      +Y+ Y  NK +   I+ E ID + E +        Q    I    IKPVQRI KY + LKD         T S  EL +A EVM  + KR ND +++  ++G   D  + + G  +L D F V EP   ++ + ++RRVFLF+  ++ ++    D  + F    Y YK  I +    + + ++GD CKFAL T R     +   +L      ++Q W+  + + ++
Sbjct: 1966 KKRHYVLLELIETERDYVRDLSLVVEGYMARMRED----GVPDDMKGKDKIVFGNIQQIYDWHKDFFLGELEK--------------CLEDPDRLGPLFLKHERRL-HMYIVYCQNKPKSEHIVSEYIDTYFEDLKQRLGHRLQ----ITDLLIKPVQRIMKYQLLLKDFLKFSKKIGTDSI-ELEKAVEVMCIVPKRCNDMMNVGRLQGF--DGKIVAQGRLLLQDTFMVAEPEGGLLNRMKERRVFLFEQIVIFSEPL--DKKRGFSMPGYLYKYSIKVNCLGLEDSVDGDPCKFAL-TSRTSNSSKDAFILHSSHPGVRQVWMLQISQILE 2270          

HSP 4 Score: 60.077 bits (144), Expect = 5.386e-8
Identity = 31/129 (24.03%), Postives = 60/129 (46.51%), Query Frame = 3
Query: 1248 QVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALE 1634
            QVK  + +L +    + H W   + RL+Q  Q  +FE    +  EW++     +L+ +   G +     +L  EH  F +     +E+V  L  +A+   D GH  +A+I+     +D  ++ F+  ++
Sbjct: 1106 QVKNILNELLQRENRVLHFWTMRKRRLDQCQQYVVFERSAKQALEWIHDTGEFYLSTHTSTGSSIHHTQELLKEHEDFHITAKQTKERVKLLIQLADGFCDKGHSHAAEIKKWVTAVDKRYRDFSLRMD 1234          
BLAST of Triple functional domain protein vs. Ensembl Zebrafish
Match: kalrna (kalirin RhoGEF kinase a [Source:ZFIN;Acc:ZDB-GENE-100921-4])

HSP 1 Score: 645.195 bits (1663), Expect = 0.000e+0
Identity = 397/1154 (34.40%), Postives = 631/1154 (54.68%), Query Frame = 3
Query:  486 LKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRY--GLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRLVEEDEKN----------HFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFE---ADVASAIDCLKHEVPTPMSYNFLNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESV---GVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPI---------LNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGKSS----VQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFIRVKAEADELIHNFDEAG 3851
            +KA D+L +L+  IA + G RDKRGGP+L FPA S+ D +  EDL  LV YL+ +P E+V K  F+V+IDMR G+ W  +KP+LK L+E          IIKP+ F++KQK    S+KFTF+  +VS + L + +D SQLT  F+G+L Y++EEW+E+R+ LE+F   A  +  +   L + L +K+ P  V  S+R +++H  ++ K+++APV  L+ EG +L   +R   G + +N      ++ + D+Q ++P++   + +L+  R HL   W   + +L+Q +QLRLFE D  +M +W++  + LFL  + +IG +   A +L  +H  F +N  +    ++R+  VA+ L+++GHYA+ QI+  + +LD +WKSF  AL++RS +L +SA FH ++E FL+    W     +     G    +  L   I   Q L+++   A+ EV  DG+AL   L  P+  G+  SL A  +YS+       ++HEV    +R+E +  HR  RL  RL L +F++DV QV+ W+  HGE FL + T VGKSL RA  L   H  FEEVA NT  NA+KL+ AA++L      DPEEI +    LE RIQ F + VE R+  LD++V FH HTK+L+ W   L++     E+   +++ V++ +++F  ++   L+A   V+KEG  L  +L +    +          H + +L Q++  +    +L  ER+++LD+ LQLR+FE    +V + +D    ++   M+     +P LA     L+      +A      EV+Q+G +L +    V   G+           + V +  E+  E+   L        M+ +    +L+  +  R L+ + +QVL WI   + ML  + +  S+L+EAEQLQ EH++FQ           L + H  A+     AE+ +Q   F   PE+                         ++ AE VA  WQ+L+   E++ KL+ A+  +YKTS+QV SVL SLE+EYRR EDWC          +  ++  L+S+H EQKEAFLKAC LARR +E F+KY+ R    + G SS     +++V A + +L+ +E  VL  W  +K RLD+C  ++  +  A + +   +EAG
Sbjct:    9 IKASDVLPVLREKIAFVSGGRDKRGGPILTFPARSNHDRIKQEDLRRLVTYLSTVPSEDVCKRGFTVIIDMR-GSKWELIKPLLKTLQEAFPAEICVALIIKPDNFWQKQKTNFGSAKFTFETSMVSVEGLTKLVDPSQLTDDFEGSLEYNHEEWLELRVALEEFLASAVHLLSRLEDLQETLAKKEFPVDVEASRRLIDEHTQLKKKVMKAPVEELDHEGQRLLQCIRSSDGFSGRN-----CISGSADFQSVVPKIASLLDKLHSTRQHLHQMWHLRKLKLDQCFQLRLFEQDAEKMFDWISHNKELFLQSHTEIGVSYQHAVELQTQHNHFAMNSMNAYVNINRIMSVASRLSEAGHYAAQQIKQISTQLDQEWKSFAAALDERSTILAMSAVFHQKSEQFLSGVETWCKMCSEG----GLPSEMQDLESAIHHHQTLYEQVTQAYTEVSQDGKALLDVLQRPLSPGNAESLTATANYSKAVHCILDVVHEVLHHQRRLENIWQHRKVRLHQRLQLCVFQQDVQQVIDWIENHGEAFLSKHTGVGKSLHRARALQKRHDDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYKAARHLEVRIQDFVRRVEQRKLLLDMSVSFHTHTKELWTWMEDLQKEL-LEEVCSDSVDSVQELIKQFQQQQTATLEATLNVIKEGEDLMQQLRDSAMSSNKMPHTSSIAHIEGVLQQLEEAQGHMEELFHERKIKLDIFLQLRIFEQYTIEVTAELDAWNEDLVRQMNEYTGEEPSLAE--QRLQRHAERKLAMTNMTYEVMQQGQDLHQYIMEVQASGIELTGEKEVDLATQVQELLEFLHEKQHELD-------MSAEHTQKRLEQCVQLRHLQAEVKQVLGWIRNGESMLDASMVNASSLSEAEQLQREHEQFQLAIESLFHANSLQKTHQSALQVQQKAEIMLQAGHFD--PEA------------------------IRSCAEKVAVHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYRRDEDWCGAHDKLGSSSETDHVLPLISKHLEQKEAFLKACTLARRNAEVFLKYIHRNNVSSQGSSSNTRGPEQQVKAILNELLQRENRVLHFWTMKKRRLDQCQQYVVFERNAKQALEWIEEAG 1116          

HSP 2 Score: 281.952 bits (720), Expect = 2.433e-75
Identity = 163/470 (34.68%), Postives = 252/470 (53.62%), Query Frame = 3
Query: 4230 KAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKI-DFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEE--------------------------------------NQRTRMTSSTSDVARNADNIFYVLDDFTALEISQLSVQRNQRVQLIEQIGE---WASVRTICTNSDIVDDESTKVQGLVPASLLISVSTR 5513
            K+A+K+  +I E++QTE  YV DL   L+TY   +  G+ +I  P  +  ++ ++F NI+EI +FH ++FL E+  Y+               LPED+GHCF+ +A+ F  IYV Y  NK + +Q++++    FF+E+          + N+I S+ IKPVQRITKY + LK+L + C+ G  GE+ +  EVML + KR ND +H+  ++G   D  L+  G+ IL D F VW+P+ +I+KGRDR +FLF++ LV +K+      +  Y +K+ +L +E  +TEH+EGD CKFALW GR P   + + VLK   +E+KQ+W++ +RE +QERI       +E                                        RT   +  SD       +  VL DFTA   S+LS+Q  Q V+L+E+  +   W  VRT         +++   +GLVP+S L    +R
Sbjct: 1243 KSARKKEFIIAELLQTEKAYVRDLHECLETYLWEMTNGVEEI--PPGIANKEHIIFGNIQEIYDFHNNIFLKELINYEQ--------------LPEDVGHCFVTWADKFN-IYVTYCKNKPDSSQLILDHAGSFFDEIQK-----RHSLTNSISSYLIKPVQRITKYQLLLKELLSCCEEGK-GEIKDGLEVMLSVPKRANDAMHVSMLEGF--DANLDVQGELILQDTFQVWDPKSLIRKGRDRHLFLFEISLVFSKEIKDSAGRSKYIFKNKLLTSELGVTEHVEGDPCKFALWVGRTPS-SDNKTVLKASSIEVKQEWIKNIREVIQERIIHLKGALKEPIHIPKTPAKPRNNSKRDAGEDADSQGDGSSQPDTISIASRTSQNTVDSDKLSGGCELTVVLQDFTASSSSELSIQTGQTVELLERPSDRPGWCLVRTT--------EKTPPQEGLVPSSALCISHSR 1678          

HSP 3 Score: 120.168 bits (300), Expect = 2.993e-26
Identity = 88/331 (26.59%), Postives = 158/331 (47.73%), Query Frame = 3
Query: 4230 KAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGS--AGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWE-PRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETM 5213
            KA + R+ ++ E+IQTE  YV DL   ++ + K I E      +P ++  +  ++F NI +I ++HK  F+ E+ +              C    E +   F ++      +YV Y  NK +   I+ E   +F  +     S     + +I  F IKP+QRITKY + LKD+            ++  A ++M ++ K  ND ++L  ++G   +  L S G  +  + F V E    ++ + ++RRVFLF+  ++ ++      +   YQ+K  I ++  ++ EH+E D CKF L           R  L+  + +IKQ WV+ + + +
Sbjct: 1893 KALRGRMFVVKELIQTEKDYVKDLGIVVEGFMKRIEEK----GVPDNMKGKDKIVFGNIHQIYDWHKDFFVGELEK--------------CLEDHEKLPELFCKHERRLH-MYVVYCQNKPKSEFIVAEYDSYFEGIQQDINS-----RLSISDFLIKPIQRITKYQLLLKDVLKYSTKAGLDCQDIENAVDLMSQVPKLCNDMMNLGRLQGY--EGKLTSQGKLLQQETFFVTEQDSGVLSRSKERRVFLFEQIVIFSELLRKGSSTPGYQFKKSIKVSFLDLEEHVENDPCKFVLSCRG----SAERFTLQAANTDIKQVWVQHITQLL 2193          

HSP 4 Score: 57.3806 bits (137), Expect = 3.945e-7
Identity = 33/143 (23.08%), Postives = 67/143 (46.85%), Query Frame = 3
Query: 1248 QVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALE----DRSNVLQLSA 1664
            QVK  + +L +    + H W   + RL+Q  Q  +FE +  +  EW+ +   ++L  +  IG +  +   L  E+ +F ++    +E+V  L  +A+   + GH     ++     +D  ++ F+  +     D  NVL +S+
Sbjct: 1066 QVKAILNELLQRENRVLHFWTMKKRRLDQCQQYVVFERNAKQALEWIEEAGEVYLATHTCIGDSMEKTQGLLKEYEEFCISAKQTKEKVKMLIQLADNFVEKGHMHVTDLKKCLTAVDKRYRDFSMRMGKYRCDLENVLGISS 1208          
BLAST of Triple functional domain protein vs. Ensembl Zebrafish
Match: kalrna (kalirin RhoGEF kinase a [Source:ZFIN;Acc:ZDB-GENE-100921-4])

HSP 1 Score: 644.425 bits (1661), Expect = 0.000e+0
Identity = 396/1152 (34.38%), Postives = 631/1152 (54.77%), Query Frame = 3
Query:  486 LKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRLVEEDEKN----------HFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFE---ADVASAIDCLKHEVPTPMSYNFLNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESV---GVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPI---------LNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGKSS----VQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFIRVKAEADELIHNFDEAG 3851
            +KA D+L +L+  IA + G RDKRGGP+L FPA S+ D +  EDL  LV YL+ +P E+V K  F+V+IDMR G+ W  +KP+LK L+E          IIKP+ F++KQK    S+KFTF+  +VS + L + +D SQLT  F+G+L Y++EEW+E+R+ LE+F   A  +  +   L + L +K+ P  V  S+R +++H  ++ K+++APV  L+ EG +L   +R   +S   +  + ++ + D+Q ++P++   + +L+  R HL   W   + +L+Q +QLRLFE D  +M +W++  + LFL  + +IG +   A +L  +H  F +N  +    ++R+  VA+ L+++GHYA+ QI+  + +LD +WKSF  AL++RS +L +SA FH ++E FL+    W     +     G    +  L   I   Q L+++   A+ EV  DG+AL   L  P+  G+  SL A  +YS+       ++HEV    +R+E +  HR  RL  RL L +F++DV QV+ W+  HGE FL + T VGKSL RA  L   H  FEEVA NT  NA+KL+ AA++L      DPEEI +    LE RIQ F + VE R+  LD++V FH HTK+L+ W   L++     E+   +++ V++ +++F  ++   L+A   V+KEG  L  +L +    +          H + +L Q++  +    +L  ER+++LD+ LQLR+FE    +V + +D    ++   M+     +P LA     L+      +A      EV+Q+G +L +    V   G+           + V +  E+  E+   L        M+ +    +L+  +  R L+ + +QVL WI   + ML  + +  S+L+EAEQLQ EH++FQ           L + H  A+     AE+ +Q   F   PE+                         ++ AE VA  WQ+L+   E++ KL+ A+  +YKTS+QV SVL SLE+EYRR EDWC          +  ++  L+S+H EQKEAFLKAC LARR +E F+KY+ R    + G SS     +++V A + +L+ +E  VL  W  +K RLD+C  ++  +  A + +   +EAG
Sbjct:   31 IKASDVLPVLREKIAFVSGGRDKRGGPILTFPARSNHDRIKQEDLRRLVTYLSTVPSEDVCKRGFTVIIDMR-GSKWELIKPLLKTLQEAFPAEICVALIIKPDNFWQKQKTNFGSAKFTFETSMVSVEGLTKLVDPSQLTDDFEGSLEYNHEEWLELRVALEEFLASAVHLLSRLEDLQETLAKKEFPVDVEASRRLIDEHTQLKKKVMKAPVEELDHEGQRLLQCIR---SSDGFSGRNCISGSADFQSVVPKIASLLDKLHSTRQHLHQMWHLRKLKLDQCFQLRLFEQDAEKMFDWISHNKELFLQSHTEIGVSYQHAVELQTQHNHFAMNSMNAYVNINRIMSVASRLSEAGHYAAQQIKQISTQLDQEWKSFAAALDERSTILAMSAVFHQKSEQFLSGVETWCKMCSEG----GLPSEMQDLESAIHHHQTLYEQVTQAYTEVSQDGKALLDVLQRPLSPGNAESLTATANYSKAVHCILDVVHEVLHHQRRLENIWQHRKVRLHQRLQLCVFQQDVQQVIDWIENHGEAFLSKHTGVGKSLHRARALQKRHDDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYKAARHLEVRIQDFVRRVEQRKLLLDMSVSFHTHTKELWTWMEDLQKE-LLEEVCSDSVDSVQELIKQFQQQQTATLEATLNVIKEGEDLMQQLRDSAMSSNKMPHTSSIAHIEGVLQQLEEAQGHMEELFHERKIKLDIFLQLRIFEQYTIEVTAELDAWNEDLVRQMNEYTGEEPSLAE--QRLQRHAERKLAMTNMTYEVMQQGQDLHQYIMEVQASGIELTGEKEVDLATQVQELLEFLHEKQHELD-------MSAEHTQKRLEQCVQLRHLQAEVKQVLGWIRNGESMLDASMVNASSLSEAEQLQREHEQFQLAIESLFHANSLQKTHQSALQVQQKAEIMLQAGHF--DPEA------------------------IRSCAEKVAVHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYRRDEDWCGAHDKLGSSSETDHVLPLISKHLEQKEAFLKACTLARRNAEVFLKYIHRNNVSSQGSSSNTRGPEQQVKAILNELLQRENRVLHFWTMKKRRLDQCQQYVVFERNAKQALEWIEEAG 1138          

HSP 2 Score: 264.233 bits (674), Expect = 2.751e-70
Identity = 134/342 (39.18%), Postives = 209/342 (61.11%), Query Frame = 3
Query: 4230 KAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKI-DFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEE 5252
            K+A+K+  +I E++QTE  YV DL   L+TY   +  G+ +I  P  +  ++ ++F NI+EI +FH ++FL E+  Y+               LPED+GHCF+ +A+ F  IYV Y  NK + +Q++++    FF+E+          + N+I S+ IKPVQRITKY + LK+L + C+ G  GE+ +  EVML + KR ND +H+  ++G   D  L+  G+ IL D F VW+P+ +I+KGRDR +FLF++ LV +K+      +  Y +K+ +L +E  +TEH+EGD CKFALW GR P   + + VLK   +E+KQ+W++ +RE +QERI       +E
Sbjct: 1265 KSARKKEFIIAELLQTEKAYVRDLHECLETYLWEMTNGVEEI--PPGIANKEHIIFGNIQEIYDFHNNIFLKELINYEQ--------------LPEDVGHCFVTWADKFN-IYVTYCKNKPDSSQLILDHAGSFFDEIQK-----RHSLTNSISSYLIKPVQRITKYQLLLKELLSCCEEGK-GEIKDGLEVMLSVPKRANDAMHVSMLEGF--DANLDVQGELILQDTFQVWDPKSLIRKGRDRHLFLFEISLVFSKEIKDSAGRSKYIFKNKLLTSELGVTEHVEGDPCKFALWVGRTPS-SDNKTVLKASSIEVKQEWIKNIREVIQERIIHLKGALKE 1580          

HSP 3 Score: 56.225 bits (134), Expect = 7.914e-7
Identity = 33/143 (23.08%), Postives = 67/143 (46.85%), Query Frame = 3
Query: 1248 QVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALE----DRSNVLQLSA 1664
            QVK  + +L +    + H W   + RL+Q  Q  +FE +  +  EW+ +   ++L  +  IG +  +   L  E+ +F ++    +E+V  L  +A+   + GH     ++     +D  ++ F+  +     D  NVL +S+
Sbjct: 1088 QVKAILNELLQRENRVLHFWTMKKRRLDQCQQYVVFERNAKQALEWIEEAGEVYLATHTCIGDSMEKTQGLLKEYEEFCISAKQTKEKVKMLIQLADNFVEKGHMHVTDLKKCLTAVDKRYRDFSMRMGKYRCDLENVLGISS 1230          
BLAST of Triple functional domain protein vs. Ensembl Zebrafish
Match: triob (trio Rho guanine nucleotide exchange factor b [Source:ZFIN;Acc:ZDB-GENE-030616-399])

HSP 1 Score: 636.721 bits (1641), Expect = 0.000e+0
Identity = 400/1158 (34.54%), Postives = 625/1158 (53.97%), Query Frame = 3
Query:  486 LKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMET-VNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRLVEE----------DEKNHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFE---ADVASAIDCLKHEVPTPMSYNFLNDPRLAR-----------SMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGK----SSVQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFI---RVKAEADELIHNFDEAGVSS 3860
            +KA ++L +LK  +A L G RD+RGGPVL FPA S+ D +  EDL  L+ YL  +P E V +  F+V++DMR G+ W S+KP+LK+L+E    C     IIKP+ F++KQ+    SSKF F+  +VS + L + +D SQLT  F+G+L Y +EEWIE+R+  EDF + A  +  +   L   L ++++P  +  S+R +E+H S++ K+ +APV  L+ EG  L   ++     +            D Q L P+V+  + +L+  R HL   W   + +L+Q +QLRLF+ D  +M +W+   + LFLT Y +IG       +L  +H  F +NC +V   +SR+  V N L +SGHYA+ QIQ  + +L+ +WK+F  AL++RS +L++SA+FH + + +++N   W  A  +     G++ + +  L   I   Q L++    A+ EV  DG+AL   L  P+  GS  SL ++ +YS+   H   ++HEV    +++E +  HR  RL  RL L +F++DV QVL W+  HGE FL + T VGKSL RA  L   H  FEEVA NT  NA+KL+ AA++L      DPEEI Q   +LE RIQ F + VE R+  LD++V FH H+K+L+ W  +L++     ++   ++E V++ ++RF  +++  L     V+KEG  L  +L +               H + +L Q+   +    +L  ER+++L+L LQLR+FE    DV S ++    E+   M+     D  LA            +MN L     TF   I  G+E++Q  +E+    ++ GV           + V D  ++  E+ Q L         A ++    L+  +  R L+ + +QVL WI   + ML    +  S+L EAEQLQ EH++FQ  + + H  A+     AE  +Q   + +                             ++ AE VA  WQ+L+   E++ KL+ A+  +YKTS+QV SVL SLE+EY+R EDWC          +  ++  ++S+H EQKEAFLKAC LARR ++ F+KYL R     PG      + +++V   + +L+ +E  VL  W  RK RLD+C  ++   R   +A E IH+  E  +S+
Sbjct:    8 MKAIEVLPILKEKVAFLSGGRDRRGGPVLTFPARSNHDRIRQEDLRRLIAYLAGIPSEEVSRHGFTVIVDMR-GSKWDSIKPLLKILQESFPSCIHVALIIKPDNFWQKQRTNFGSSKFEFETIMVSLEGLTKVVDPSQLTPDFEGSLDYDHEEWIEVRVAFEDFTSNAARILARLEELQDMLSQRELPSDLDGSRRAMEEHASLKKKVTKAPVEELDTEGQHLLQRIQCADKGRG-----------DIQGLAPKVQALLDKLHGTRQHLHQAWHLRKLKLDQCFQLRLFQQDAEKMFDWIVHNKGLFLTTYTEIGANHQHVMELQTQHNHFAMNCMNVYVNISRIMSVGNRLLESGHYATQQIQQISGQLEQEWKAFAAALDERSTLLEMSANFHQKTDQYMSNMDSWCKACGE-----GELPSELQDLEDTIHHHQGLYEHITAAYSEVSQDGKALLDKLQRPLTPGSADSLTSSANYSKAVHHVLDIIHEVLHHQRQLENIWQHRKLRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYQAAHQLEDRIQDFVRRVEQRKVLLDMSVAFHTHSKELWTWLEELQKE-LLDDVYAESVEAVQELIKRFGQQQQTTLQVTVNVIKEGEDLIQQLRDSAISSNKTPHNSSMAHIESVLQQLDEAQAQMEELFQERKIKLELFLQLRIFERDAIDVISDLESWNEELSQQMNEFDTEDLTLAEQRLQHHADKALTMNNL-----TF-HVIHQGQELLQYVTEV----QASGVELLCDRDVDMATRVQDLLDFLHEKQQELD-------AAAEQHRRHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEALLQANHYDM--------------------------DMIRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGTDKLGPNSESDHVTPMVSKHLEQKEAFLKACTLARRNADVFLKYLHRNSVNMPGMLAHVKAPEQQVKNILNELLQRENRVLHFWTMRKRRLDQCQQYVVFERSAKQALEWIHDTGEFYLST 1104          

HSP 2 Score: 251.136 bits (640), Expect = 7.682e-66
Identity = 150/464 (32.33%), Postives = 251/464 (54.09%), Query Frame = 3
Query: 4224 QEKAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKID-FFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLK-----GKDLEIKQ---KWVRALRETMQER---------------IFSFGPIYEENQRTRMTSSTSDVARNA-------------DNIFYVLDDFTALEISQLSVQRNQRVQLIEQI---GEWASVRTICTNSDIVDDESTKVQGLVPASLL 5495
            + K+A+++  ++ E+IQTE  YV DL   + TY   ++ G+ +I  P  +V ++ ++F N++++ EFH ++FL E+ +Y+               LPED+GHCF+ +A+ F+ +YV Y  NK +  Q+++E    +F+E+         ++ N+I S+ IKPVQRITKY + LK+L   C+ G  GE+ +  EVML + KR ND +HL  ++G  E+  +ES G+ IL + F VW+P+ +I+KGR+R +FLF++ L+ +K     + +  Y YKS ++ +E  +TEH+EGD CKFALW GR  P  + ++VLK     G +  + +   +  R LR   +                   S  P+    Q + + + +  VA                  +  V+ DF A   ++L+V+R Q V+L+E+     +W  VRT         D S   +GLVP+++L
Sbjct: 1226 KRKSARRKEFIMAELIQTEKAYVRDLRECMDTYLWEMSSGVEEI--PPGIVNKEHIIFGNMQDLYEFHHNIFLKELEKYEQ--------------LPEDVGHCFVTWADKFQ-MYVNYCKNKPDSTQLILEHAGPYFDEIQQ-----RHRLANSISSYLIKPVQRITKYQLLLKELLTCCEEGK-GEIKDGLEVMLSVPKRANDAMHLSMLEGFDEN--IESQGELILQESFQVWDPKTLIRKGRERHLFLFEMSLIFSKDVKDSNGRSKYLYKSKLMTSELGVTEHVEGDPCKFALWVGRT-PTSDNKIVLKKQSTLGYNFTLNKHSTEITRMLRLKAKTHKHINLPPAPLNLGTLCPSLPPLSSSCQASLLQTDSISVAMRGCVSSLWSLSLSGGSELTVVIHDFMASNGAELTVRRGQTVELLERPQDKPDWCLVRTT--------DRSPAQEGLVPSAML 1655          

HSP 3 Score: 114.775 bits (286), Expect = 1.604e-24
Identity = 97/360 (26.94%), Postives = 167/360 (46.39%), Query Frame = 3
Query: 4239 KKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAG----ELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWE-PRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIF----YQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEENQRTRMTSSTSDV 5291
            K+R +++ E+++TE  YV DL   ++ Y   + E      +P D+  +  ++F NI +I ++HK  FL E+ +              C   P+ +   F+R       +Y+ Y  NK +   I+ E ID + E +        Q+ + +    IKPVQRI KY + LKDL     T  AG    +L +A EVM  + KR ND +++  ++G   D  + + G  +L D F V +    ++ + ++RR+FLF+  ++ ++    D  K F    Y +K+ I ++   + E  + D CKF L T R         VL   +  + Q W+  +   +            ENQR  + + TS +
Sbjct: 1905 KRRHYVLLELVETERDYVRDLGAVVEGYMSRMKEE----GVPDDMKGKDKIVFGNIHQIFDWHKDFFLAELEK--------------CLEDPDRLAPLFVRQERRL-HMYIVYCQNKPKSEHIVSEYIDTYFEDLKQRLGHRLQITDLL----IKPVQRIMKYQLLLKDLLKF--TKKAGLDTVDLEKAVEVMCVVPKRCNDMMNVGRLQGF--DGKIVAQGRLLLQDTFMVSDQDGGLLSRLKERRIFLFEQIVIFSEPL--DKKKGFSMPGYLFKNSIKVSWLGLEESPDNDPCKFIL-TSRSSAGSLEHYVLHSSNRVVCQTWIHQISSIL------------ENQRNFLNALTSPI 2222          

HSP 4 Score: 81.6481 bits (200), Expect = 1.495e-14
Identity = 92/417 (22.06%), Postives = 172/417 (41.25%), Query Frame = 3
Query: 1263 VQQLYEYRAHLQHKWDAG----RSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETV--NSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGF----HNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNE 2480
            VQ L ++    Q + DA     R  LEQ  QLR  + ++ ++  W+     + L        +  +A  L  EH QF        +   ++   A  L  + HY    I+  A K+   W+     +EDR  ++  S +F+  +E   +     E   K++    G  + +  NS + ++T +     E + A  + C+  R  A      + + S              +   ++++E+     RV      R +RL      ++F     Q L W+++ GE +L   TS G ++   ++L   H +F+  A  T    + LI  AD    + H    EI +    +++R + F+  ++  R+ L+ A+G     +  +KDL     QL       +++P +  G E +LR  ++E
Sbjct:  818 VQDLLDFLHEKQQELDAAAEQHRRHLEQCVQLRHLQAEVKQVLGWIRNGESM-LNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEALLQANHYDMDMIRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGTDKLGPNSESDHVTPMVSKHLEQKEAFLKACTLARRNADVFLKYLHRNSVNMPGMLAHVKAPEQQVKNILNELLQRENRVLHFWTMRKRRLDQCQQYVVFERSAKQALEWIHDTGEFYLSTHTSTGSTIHHTQELLKEHEEFQITAKQTKERVKLLIQLADGFCEKGHAHASEIQKWVASVDKRYRDFSLRMDKYRSCLEKALGLSTDSNKASKDL-----QL-------DIIPASAPGAEVKLRDVNHE 1221          

HSP 5 Score: 61.2326 bits (147), Expect = 2.381e-8
Identity = 32/136 (23.53%), Postives = 64/136 (47.06%), Query Frame = 3
Query: 1248 QVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQ 1655
            QVK  + +L +    + H W   + RL+Q  Q  +FE    +  EW++     +L+ +   G T     +L  EH +F +     +E+V  L  +A+   + GH  +++IQ     +D  ++ F+  ++   + L+
Sbjct: 1048 QVKNILNELLQRENRVLHFWTMRKRRLDQCQQYVVFERSAKQALEWIHDTGEFYLSTHTSTGSTIHHTQELLKEHEEFQITAKQTKERVKLLIQLADGFCEKGHAHASEIQKWVASVDKRYRDFSLRMDKYRSCLE 1183          
BLAST of Triple functional domain protein vs. Ensembl Xenopus
Match: not (notochord homeobox [Source:Xenbase;Acc:XB-GENE-478518])

HSP 1 Score: 663.3 bits (1710), Expect = 0.000e+0
Identity = 408/1152 (35.42%), Postives = 628/1152 (54.51%), Query Frame = 3
Query:  486 LKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRLVEE----------DEKNHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFE---ADVASAIDCLKHEVPTPMSYNF------LNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGK----SSVQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFI---RVKAEADELIHNFDEAGVSS 3860
            LKA ++L +LK  +A L G RDKRGGPVL FPA S+ D +  EDL  L+ YL  +P E V K  F+V++DMR G+ W S+KP+LK+L+E    C     IIKP+ F++KQ+    SSKF F+  +VS + L + +D SQLT  F+G L Y++EEWIEIR+  EDF   A  M  +   L + L  K++P+ +  ++  +E+H  ++ ++I+AP+  L+ EG KL   L+   +S +  + +  + N D Q L+P+V   + +L+  R HL   W   + +L+Q +QLRLFE D  +M +W+   + LFLT Y DIG   + A +L  +H  F +NC +V   +SR+  VAN L +SGHYAS QI+  A +L+ +WK+F  AL++RS +L +SA FH +AE ++ N   W  A  + ++       +  L   I   Q +++   +A+ EV  DG++L   L  P+  GS  SL A+ +YS+   H    +HEV    +++E +  HR  RL  RL L +F++DV QVL W+  HGE FL + T VGKSL RA  L   H  FEEVA NT  NA+KL+ AA++L      DPEEI Q   +LE RIQ F + VE R+  LD++V FH+H K+L+ W   L++     ++   ++E V+D ++RF  +++  L     V+KEG  L  +L +              NH + +L Q+   +    +L  ER+++L+L LQLR+FE    D+ S ++    E+   M+ +F      L + RL    ++   +       I  G+E++Q  +E+    ++ GV           + V D  E+  E+ Q L        +A ++    L+  +  R L+ + +QVL WI   + ML    +  S+L EAEQLQ EH++FQ  + + H  A+     AE  +Q   + +                             ++ AE VA  WQ+L+   E++ KL+ A+  +YKTS+QV SVL SLE+EY+R EDWC          +  ++  ++S+H EQKEAFLKAC LARR ++ F+KYL R     PG      + +++V   + +L  +E  VL  W  RK RLD C  ++   R   +A E I +  E  +S+
Sbjct:    8 LKAMEVLPILKEKVAYLSGGRDKRGGPVLTFPARSNHDRIRQEDLRRLISYLACIPSEEVCKRGFTVIVDMR-GSKWDSIKPLLKILQESFPCCIHVALIIKPDNFWQKQRTNFGSSKFEFETSMVSLEGLTKVVDPSQLTPEFEGCLEYNHEEWIEIRVAFEDFINNATHMLSRLEELQEMLAIKELPQDLEGARNMIEEHSQMKKRVIKAPIEDLDLEGQKL---LQTIQSSDSFPKKNSSSGNADLQNLLPKVSTMLDRLHSTRQHLHQMWHMRKVKLDQCFQLRLFEQDAEKMFDWITHNKGLFLTSYTDIGTRNNHAMELQTQHNHFAMNCMNVYVNISRIMSVANRLVESGHYASQQIKQIANQLEQEWKAFAAALDERSTLLDMSAMFHQKAEQYMGNVDSWCKACGEVDLP----SELQDLEDAIHHHQGIYEHITLAYSEVSQDGKSLLDKLQRPLTPGSSDSLTASANYSKAVHHVLDAIHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYQAAHQLEDRIQDFVRRVEQRKVLLDMSVSFHSHVKELWTWLEDLQKEL-LDDVYAESVEAVQDLIKRFGQQQQTTLQFTVNVIKEGEDLIQQLRDSAISSNKTPHNSSINHIETVLQQLDEAQSQMEELFQERKIKLELFLQLRIFERDAIDIISDLESWNDELSQQMN-DFDTEDLTLAEQRLQHHADKALTMNNLTFDVIHQGQELLQYVNEV----QNSGVELLCDRDVDMATRVQDLLEFLHEKQQELD-------LAAEQHRKHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEAMLQANHYDM--------------------------DMIRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAFLKACTLARRNADVFLKYLHRNSVNMPGMVTHVKAPEQQVKNILNELFQRENRVLHYWTLRKRRLDHCQQYVVFERSAKQALEWIQDNGEFYIST 1112          

HSP 2 Score: 263.462 bits (672), Expect = 1.920e-69
Identity = 149/442 (33.71%), Postives = 250/442 (56.56%), Query Frame = 3
Query: 4224 QEKAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKID-FFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEENQRTRMTSSTSDVAR--------NADNIFYVLDDFTALEISQLSVQRNQRVQLIEQ---IGEWASVRTICTNSDIVDDESTKVQGLVPASLLISVSTR 5513
            + K+A+++  ++ E+IQTE  YV DL   + TY   +  G+ +I  P  +V ++ ++F N++EI EFH ++FL E+ +Y+               LPED+GHCF+ +A+ F+ +YV Y  NK +  Q+++E+   +F+E+         ++ N+I S+ IKPVQRITKY + LK+L   C+ G  GE+ +  EVML + KR ND +HL  ++G  E+  +ES G+ IL + F VW+P+ +I+KGR+R +FLF++ LV +K+      +  Y YKS +  +E  +TEH+EGD CKFALW GR P   + ++VLK + L + +  +  + ++    + S    +     +R++   S   +            +  V+ DFTA   ++L+++R Q V+++E+     +W  VRT         D S   +GLVP+S L    +R
Sbjct: 1233 KRKSARRKEFIMAELIQTEKAYVRDLRECMDTYLWEMTSGVEEI--PPGIVNKEHIIFGNMQEIYEFHNNIFLKELEKYEQ--------------LPEDVGHCFVTWADKFQ-MYVSYCKNKPDSTQLILEQAGTYFDEIQQ-----RHELVNSISSYLIKPVQRITKYQLLLKELLTCCEEGK-GEIKDGLEVMLSVPKRANDAMHLSMLEGFDEN--IESQGELILQESFQVWDPKTLIRKGRERHLFLFEMSLVFSKEVKDSSGRSKYIYKSKLFTSELGVTEHVEGDPCKFALWVGRTPT-SDNKIVLKVRILSVAENLISVINKSCT--VLSNQQCFNPLSASRISHFGSPQCQTFCKHSLSGGCELTVVIHDFTACNSNELTIKRGQTVEVLERHHDRPDWCLVRTT--------DRSPAAEGLVPSSSLCIAHSR 1638          

HSP 3 Score: 117.087 bits (292), Expect = 4.283e-25
Identity = 91/358 (25.42%), Postives = 168/358 (46.93%), Query Frame = 3
Query: 4239 KKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGS--AGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWE-PRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIF----YQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEENQRTRMTSSTSDV 5291
            K+R +++ E+++TE  YV DL   ++ Y   + E      +P D+  +  ++F N+ +I E+H+  FL E+ +              C   PE +   F+++      +Y+ Y  NK +   I+ E ID + E +        Q+ + +    IKP+QRI KY + LKD             EL  A EVM  + KR ND +++  ++G   D  + + G  +L D F V E    ++ + ++RRVFLF+  ++ ++    D  K +    + +K++I ++  ++ E ++ D CKFAL +        +  VL      ++Q W+  + + +            ENQR  + + TS +
Sbjct: 1884 KRRHYVLQELVETERDYVRDLGYVVEGYMALMKED----GVPDDMKGKDKIVFGNLHQIYEWHRDFFLGELER--------------CLDEPERLASLFVKHERRL-HMYIVYCQNKPKSEHIVSEYIDTYFEDLKQRLGHRLQLTDLL----IKPIQRIMKYQLLLKDFLKYSKKACIDVAELERAVEVMCIVPKRCNDMMNVGRLQGF--DGKIVAQGKLLLQDTFLVTEQDAGLLPRCKERRVFLFEQIVIFSEPL--DKKKGYSTPGFLFKNNIKVSCLSLEECVDSDPCKFALLSRSADSTEMF--VLHSSSPGVRQLWIHEINQIL------------ENQRNFLNALTSPI 2200          

HSP 4 Score: 84.7297 bits (208), Expect = 2.742e-15
Identity = 82/372 (22.04%), Postives = 153/372 (41.13%), Query Frame = 3
Query: 1263 VQQLYEYRAHLQHKWDAG----RSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETV--NSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGF 2357
            VQ L E+    Q + D      R  LEQ  QLR  + ++ ++  W+     + L        +  +A  L  EH QF        +   ++   A  +  + HY    I+  A K+   W+     +EDR  ++  S +F+  +E   +     E   K++    G  + +  NS   ++T +     E + A  + C+  R  A      + + S              +   ++++E++    RV      R +RL      ++F     Q L W+ ++GE ++   TS G ++Q  ++L   H +F+  A  T    + LI  AD    + H    EI +  T +++R + F+  +E  R +L+ A+G 
Sbjct:  826 VQDLLEFLHEKQQELDLAAEQHRKHLEQCVQLRHLQAEVKQVLGWIRNGESM-LNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEAMLQANHYDMDMIRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAFLKACTLARRNADVFLKYLHRNSVNMPGMVTHVKAPEQQVKNILNELFQRENRVLHYWTLRKRRLDHCQQYVVFERSAKQALEWIQDNGEFYISTHTSTGSTIQHTQELLKEHEEFQITAKQTKERVKLLIQLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRMEKYRTSLEKALGI 1196          

HSP 5 Score: 61.2326 bits (147), Expect = 3.248e-8
Identity = 30/129 (23.26%), Postives = 60/129 (46.51%), Query Frame = 3
Query: 1248 QVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALE 1634
            QVK  + +L++    + H W   + RL+   Q  +FE    +  EW+      +++ +   G T     +L  EH +F +     +E+V  L  +A+   + GH  +A+I+     +D  ++ F+  +E
Sbjct: 1056 QVKNILNELFQRENRVLHYWTLRKRRLDHCQQYVVFERSAKQALEWIQDNGEFYISTHTSTGSTIQHTQELLKEHEEFQITAKQTKERVKLLIQLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRME 1184          
BLAST of Triple functional domain protein vs. Ensembl Xenopus
Match: not (notochord homeobox [Source:Xenbase;Acc:XB-GENE-478518])

HSP 1 Score: 662.144 bits (1707), Expect = 0.000e+0
Identity = 408/1152 (35.42%), Postives = 628/1152 (54.51%), Query Frame = 3
Query:  486 LKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRLVEE----------DEKNHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFE---ADVASAIDCLKHEVPTPMSYNF------LNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGK----SSVQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFI---RVKAEADELIHNFDEAGVSS 3860
            LKA ++L +LK  +A L G RDKRGGPVL FPA S+ D +  EDL  L+ YL  +P E V K  F+V++DMR G+ W S+KP+LK+L+E    C     IIKP+ F++KQ+    SSKF F+  +VS + L + +D SQLT  F+G L Y++EEWIEIR+  EDF   A  M  +   L + L  K++P+ +  ++  +E+H  ++ ++I+AP+  L+ EG KL   L+   +S +  + +  + N D Q L+P+V   + +L+  R HL   W   + +L+Q +QLRLFE D  +M +W+   + LFLT Y DIG   + A +L  +H  F +NC +V   +SR+  VAN L +SGHYAS QI+  A +L+ +WK+F  AL++RS +L +SA FH +AE ++ N   W  A  + ++       +  L   I   Q +++   +A+ EV  DG++L   L  P+  GS  SL A+ +YS+   H    +HEV    +++E +  HR  RL  RL L +F++DV QVL W+  HGE FL + T VGKSL RA  L   H  FEEVA NT  NA+KL+ AA++L      DPEEI Q   +LE RIQ F + VE R+  LD++V FH+H K+L+ W   L++     ++   ++E V+D ++RF  +++  L     V+KEG  L  +L +              NH + +L Q+   +    +L  ER+++L+L LQLR+FE    D+ S ++    E+   M+ +F      L + RL    ++   +       I  G+E++Q  +E+    ++ GV           + V D  E+  E+ Q L        +A ++    L+  +  R L+ + +QVL WI   + ML    +  S+L EAEQLQ EH++FQ  + + H  A+     AE  +Q   + +                             ++ AE VA  WQ+L+   E++ KL+ A+  +YKTS+QV SVL SLE+EY+R EDWC          +  ++  ++S+H EQKEAFLKAC LARR ++ F+KYL R     PG      + +++V   + +L  +E  VL  W  RK RLD C  ++   R   +A E I +  E  +S+
Sbjct:   23 LKAMEVLPILKEKVAYLSGGRDKRGGPVLTFPARSNHDRIRQEDLRRLISYLACIPSEEVCKRGFTVIVDMR-GSKWDSIKPLLKILQESFPCCIHVALIIKPDNFWQKQRTNFGSSKFEFETSMVSLEGLTKVVDPSQLTPEFEGCLEYNHEEWIEIRVAFEDFINNATHMLSRLEELQEMLAIKELPQDLEGARNMIEEHSQMKKRVIKAPIEDLDLEGQKL---LQTIQSSDSFPKKNSSSGNADLQNLLPKVSTMLDRLHSTRQHLHQMWHMRKVKLDQCFQLRLFEQDAEKMFDWITHNKGLFLTSYTDIGTRNNHAMELQTQHNHFAMNCMNVYVNISRIMSVANRLVESGHYASQQIKQIANQLEQEWKAFAAALDERSTLLDMSAMFHQKAEQYMGNVDSWCKACGEVDLP----SELQDLEDAIHHHQGIYEHITLAYSEVSQDGKSLLDKLQRPLTPGSSDSLTASANYSKAVHHVLDAIHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYQAAHQLEDRIQDFVRRVEQRKVLLDMSVSFHSHVKELWTWLEDLQKEL-LDDVYAESVEAVQDLIKRFGQQQQTTLQFTVNVIKEGEDLIQQLRDSAISSNKTPHNSSINHIETVLQQLDEAQSQMEELFQERKIKLELFLQLRIFERDAIDIISDLESWNDELSQQMN-DFDTEDLTLAEQRLQHHADKALTMNNLTFDVIHQGQELLQYVNEV----QNSGVELLCDRDVDMATRVQDLLEFLHEKQQELD-------LAAEQHRKHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEAMLQANHYDM--------------------------DMIRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAFLKACTLARRNADVFLKYLHRNSVNMPGMVTHVKAPEQQVKNILNELFQRENRVLHYWTLRKRRLDHCQQYVVFERSAKQALEWIQDNGEFYIST 1127          

HSP 2 Score: 278.87 bits (712), Expect = 3.570e-74
Identity = 159/472 (33.69%), Postives = 255/472 (54.03%), Query Frame = 3
Query: 4224 QEKAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKID-FFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEE--------------------------------------NQRTRMTSSTSDVARNADNIFYVLDDFTALEISQLSVQRNQRVQLIEQ---IGEWASVRTICTNSDIVDDESTKVQGLVPASLLISVSTR 5513
            + K+A+++  ++ E+IQTE  YV DL   + TY   +  G+ +I  P  +V ++ ++F N++EI EFH ++FL E+ +Y+               LPED+GHCF+ +A+ F+ +YV Y  NK +  Q+++E+   +F+E+         ++ N+I S+ IKPVQRITKY + LK+L   C+ G  GE+ +  EVML + KR ND +HL  ++G  E+  +ES G+ IL + F VW+P+ +I+KGR+R +FLF++ LV +K+      +  Y YKS +  +E  +TEH+EGD CKFALW GR  P  + ++VLKG  +E KQ W++ +RE +Q+R        +E                                        RT   +  SD       +  V+ DFTA   ++L+++R Q V+++E+     +W  VRT         D S   +GLVP+S L    +R
Sbjct: 1248 KRKSARRKEFIMAELIQTEKAYVRDLRECMDTYLWEMTSGVEEI--PPGIVNKEHIIFGNMQEIYEFHNNIFLKELEKYEQ--------------LPEDVGHCFVTWADKFQ-MYVSYCKNKPDSTQLILEQAGTYFDEIQQ-----RHELVNSISSYLIKPVQRITKYQLLLKELLTCCEEGK-GEIKDGLEVMLSVPKRANDAMHLSMLEGFDEN--IESQGELILQESFQVWDPKTLIRKGRERHLFLFEMSLVFSKEVKDSSGRSKYIYKSKLFTSELGVTEHVEGDPCKFALWVGRT-PTSDNKIVLKGSSIENKQDWIKHIREVIQDRTIHLRGALKEPIHIPKTAAATKQKPAKRDGEDLDSQGDGSSQPDTISIASRTSQNTLDSDKLSGGCELTVVIHDFTACNSNELTIKRGQTVEVLERHHDRPDWCLVRTT--------DRSPAAEGLVPSSSLCIAHSR 1685          

HSP 3 Score: 116.701 bits (291), Expect = 5.623e-25
Identity = 91/358 (25.42%), Postives = 168/358 (46.93%), Query Frame = 3
Query: 4239 KKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGS--AGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWE-PRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIF----YQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEENQRTRMTSSTSDV 5291
            K+R +++ E+++TE  YV DL   ++ Y   + E      +P D+  +  ++F N+ +I E+H+  FL E+ +              C   PE +   F+++      +Y+ Y  NK +   I+ E ID + E +        Q+ + +    IKP+QRI KY + LKD             EL  A EVM  + KR ND +++  ++G   D  + + G  +L D F V E    ++ + ++RRVFLF+  ++ ++    D  K +    + +K++I ++  ++ E ++ D CKFAL +        +  VL      ++Q W+  + + +            ENQR  + + TS +
Sbjct: 1931 KRRHYVLQELVETERDYVRDLGYVVEGYMALMKED----GVPDDMKGKDKIVFGNLHQIYEWHRDFFLGELER--------------CLDEPERLASLFVKHERRL-HMYIVYCQNKPKSEHIVSEYIDTYFEDLKQRLGHRLQLTDLL----IKPIQRIMKYQLLLKDFLKYSKKACIDVAELERAVEVMCIVPKRCNDMMNVGRLQGF--DGKIVAQGKLLLQDTFLVTEQDAGLLPRCKERRVFLFEQIVIFSEPL--DKKKGYSTPGFLFKNNIKVSCLSLEECVDSDPCKFALLSRSADSTEMF--VLHSSSPGVRQLWIHEINQIL------------ENQRNFLNALTSPI 2247          

HSP 4 Score: 84.3445 bits (207), Expect = 3.844e-15
Identity = 82/372 (22.04%), Postives = 153/372 (41.13%), Query Frame = 3
Query: 1263 VQQLYEYRAHLQHKWDAG----RSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETV--NSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGF 2357
            VQ L E+    Q + D      R  LEQ  QLR  + ++ ++  W+     + L        +  +A  L  EH QF        +   ++   A  +  + HY    I+  A K+   W+     +EDR  ++  S +F+  +E   +     E   K++    G  + +  NS   ++T +     E + A  + C+  R  A      + + S              +   ++++E++    RV      R +RL      ++F     Q L W+ ++GE ++   TS G ++Q  ++L   H +F+  A  T    + LI  AD    + H    EI +  T +++R + F+  +E  R +L+ A+G 
Sbjct:  841 VQDLLEFLHEKQQELDLAAEQHRKHLEQCVQLRHLQAEVKQVLGWIRNGESM-LNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEAMLQANHYDMDMIRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAFLKACTLARRNADVFLKYLHRNSVNMPGMVTHVKAPEQQVKNILNELFQRENRVLHYWTLRKRRLDHCQQYVVFERSAKQALEWIQDNGEFYISTHTSTGSTIQHTQELLKEHEEFQITAKQTKERVKLLIQLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRMEKYRTSLEKALGI 1211          

HSP 5 Score: 61.2326 bits (147), Expect = 3.879e-8
Identity = 30/129 (23.26%), Postives = 60/129 (46.51%), Query Frame = 3
Query: 1248 QVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALE 1634
            QVK  + +L++    + H W   + RL+   Q  +FE    +  EW+      +++ +   G T     +L  EH +F +     +E+V  L  +A+   + GH  +A+I+     +D  ++ F+  +E
Sbjct: 1071 QVKNILNELFQRENRVLHYWTLRKRRLDHCQQYVVFERSAKQALEWIQDNGEFYISTHTSTGSTIQHTQELLKEHEEFQITAKQTKERVKLLIQLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRME 1199          
BLAST of Triple functional domain protein vs. Ensembl Xenopus
Match: not (notochord homeobox [Source:Xenbase;Acc:XB-GENE-478518])

HSP 1 Score: 662.144 bits (1707), Expect = 0.000e+0
Identity = 408/1152 (35.42%), Postives = 628/1152 (54.51%), Query Frame = 3
Query:  486 LKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRLVEE----------DEKNHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFE---ADVASAIDCLKHEVPTPMSYNF------LNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGK----SSVQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFI---RVKAEADELIHNFDEAGVSS 3860
            LKA ++L +LK  +A L G RDKRGGPVL FPA S+ D +  EDL  L+ YL  +P E V K  F+V++DMR G+ W S+KP+LK+L+E    C     IIKP+ F++KQ+    SSKF F+  +VS + L + +D SQLT  F+G L Y++EEWIEIR+  EDF   A  M  +   L + L  K++P+ +  ++  +E+H  ++ ++I+AP+  L+ EG KL   L+   +S +  + +  + N D Q L+P+V   + +L+  R HL   W   + +L+Q +QLRLFE D  +M +W+   + LFLT Y DIG   + A +L  +H  F +NC +V   +SR+  VAN L +SGHYAS QI+  A +L+ +WK+F  AL++RS +L +SA FH +AE ++ N   W  A  + ++       +  L   I   Q +++   +A+ EV  DG++L   L  P+  GS  SL A+ +YS+   H    +HEV    +++E +  HR  RL  RL L +F++DV QVL W+  HGE FL + T VGKSL RA  L   H  FEEVA NT  NA+KL+ AA++L      DPEEI Q   +LE RIQ F + VE R+  LD++V FH+H K+L+ W   L++     ++   ++E V+D ++RF  +++  L     V+KEG  L  +L +              NH + +L Q+   +    +L  ER+++L+L LQLR+FE    D+ S ++    E+   M+ +F      L + RL    ++   +       I  G+E++Q  +E+    ++ GV           + V D  E+  E+ Q L        +A ++    L+  +  R L+ + +QVL WI   + ML    +  S+L EAEQLQ EH++FQ  + + H  A+     AE  +Q   + +                             ++ AE VA  WQ+L+   E++ KL+ A+  +YKTS+QV SVL SLE+EY+R EDWC          +  ++  ++S+H EQKEAFLKAC LARR ++ F+KYL R     PG      + +++V   + +L  +E  VL  W  RK RLD C  ++   R   +A E I +  E  +S+
Sbjct:   55 LKAMEVLPILKEKVAYLSGGRDKRGGPVLTFPARSNHDRIRQEDLRRLISYLACIPSEEVCKRGFTVIVDMR-GSKWDSIKPLLKILQESFPCCIHVALIIKPDNFWQKQRTNFGSSKFEFETSMVSLEGLTKVVDPSQLTPEFEGCLEYNHEEWIEIRVAFEDFINNATHMLSRLEELQEMLAIKELPQDLEGARNMIEEHSQMKKRVIKAPIEDLDLEGQKL---LQTIQSSDSFPKKNSSSGNADLQNLLPKVSTMLDRLHSTRQHLHQMWHMRKVKLDQCFQLRLFEQDAEKMFDWITHNKGLFLTSYTDIGTRNNHAMELQTQHNHFAMNCMNVYVNISRIMSVANRLVESGHYASQQIKQIANQLEQEWKAFAAALDERSTLLDMSAMFHQKAEQYMGNVDSWCKACGEVDLP----SELQDLEDAIHHHQGIYEHITLAYSEVSQDGKSLLDKLQRPLTPGSSDSLTASANYSKAVHHVLDAIHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYQAAHQLEDRIQDFVRRVEQRKVLLDMSVSFHSHVKELWTWLEDLQKEL-LDDVYAESVEAVQDLIKRFGQQQQTTLQFTVNVIKEGEDLIQQLRDSAISSNKTPHNSSINHIETVLQQLDEAQSQMEELFQERKIKLELFLQLRIFERDAIDIISDLESWNDELSQQMN-DFDTEDLTLAEQRLQHHADKALTMNNLTFDVIHQGQELLQYVNEV----QNSGVELLCDRDVDMATRVQDLLEFLHEKQQELD-------LAAEQHRKHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEAMLQANHYDM--------------------------DMIRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAFLKACTLARRNADVFLKYLHRNSVNMPGMVTHVKAPEQQVKNILNELFQRENRVLHYWTLRKRRLDHCQQYVVFERSAKQALEWIQDNGEFYIST 1159          

HSP 2 Score: 279.641 bits (714), Expect = 2.285e-74
Identity = 159/472 (33.69%), Postives = 255/472 (54.03%), Query Frame = 3
Query: 4224 QEKAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKID-FFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEE--------------------------------------NQRTRMTSSTSDVARNADNIFYVLDDFTALEISQLSVQRNQRVQLIEQ---IGEWASVRTICTNSDIVDDESTKVQGLVPASLLISVSTR 5513
            + K+A+++  ++ E+IQTE  YV DL   + TY   +  G+ +I  P  +V ++ ++F N++EI EFH ++FL E+ +Y+               LPED+GHCF+ +A+ F+ +YV Y  NK +  Q+++E+   +F+E+         ++ N+I S+ IKPVQRITKY + LK+L   C+ G  GE+ +  EVML + KR ND +HL  ++G  E+  +ES G+ IL + F VW+P+ +I+KGR+R +FLF++ LV +K+      +  Y YKS +  +E  +TEH+EGD CKFALW GR  P  + ++VLKG  +E KQ W++ +RE +Q+R        +E                                        RT   +  SD       +  V+ DFTA   ++L+++R Q V+++E+     +W  VRT         D S   +GLVP+S L    +R
Sbjct: 1280 KRKSARRKEFIMAELIQTEKAYVRDLRECMDTYLWEMTSGVEEI--PPGIVNKEHIIFGNMQEIYEFHNNIFLKELEKYEQ--------------LPEDVGHCFVTWADKFQ-MYVSYCKNKPDSTQLILEQAGTYFDEIQQ-----RHELVNSISSYLIKPVQRITKYQLLLKELLTCCEEGK-GEIKDGLEVMLSVPKRANDAMHLSMLEGFDEN--IESQGELILQESFQVWDPKTLIRKGRERHLFLFEMSLVFSKEVKDSSGRSKYIYKSKLFTSELGVTEHVEGDPCKFALWVGRT-PTSDNKIVLKGSSIENKQDWIKHIREVIQDRTIHLRGALKEPIHIPKTAAATKQKPAKRDGEDLDSQGDGSSQPDTISIASRTSQNTLDSDKLSGGCELTVVIHDFTACNSNELTIKRGQTVEVLERHHDRPDWCLVRTT--------DRSPAAEGLVPSSSLCIAHSR 1717          

HSP 3 Score: 116.701 bits (291), Expect = 5.521e-25
Identity = 91/358 (25.42%), Postives = 168/358 (46.93%), Query Frame = 3
Query: 4239 KKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTG--SAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWE-PRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIF----YQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEENQRTRMTSSTSDV 5291
            K+R +++ E+++TE  YV DL   ++ Y   + E      +P D+  +  ++F N+ +I E+H+  FL E+ +              C   PE +   F+++      +Y+ Y  NK +   I+ E ID + E +        Q+ + +    IKP+QRI KY + LKD             EL  A EVM  + KR ND +++  ++G   D  + + G  +L D F V E    ++ + ++RRVFLF+  ++ ++    D  K +    + +K++I ++  ++ E ++ D CKFAL +        +  VL      ++Q W+  + + +            ENQR  + + TS +
Sbjct: 1963 KRRHYVLQELVETERDYVRDLGYVVEGYMALMKED----GVPDDMKGKDKIVFGNLHQIYEWHRDFFLGELER--------------CLDEPERLASLFVKHERRL-HMYIVYCQNKPKSEHIVSEYIDTYFEDLKQRLGHRLQLTDLL----IKPIQRIMKYQLLLKDFLKYSKKACIDVAELERAVEVMCIVPKRCNDMMNVGRLQGF--DGKIVAQGKLLLQDTFLVTEQDAGLLPRCKERRVFLFEQIVIFSEPL--DKKKGYSTPGFLFKNNIKVSCLSLEECVDSDPCKFALLSRSADSTEMF--VLHSSSPGVRQLWIHEINQIL------------ENQRNFLNALTSPI 2279          

HSP 4 Score: 83.9593 bits (206), Expect = 4.804e-15
Identity = 82/372 (22.04%), Postives = 153/372 (41.13%), Query Frame = 3
Query: 1263 VQQLYEYRAHLQHKWDAG----RSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETV--NSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGF 2357
            VQ L E+    Q + D      R  LEQ  QLR  + ++ ++  W+     + L        +  +A  L  EH QF        +   ++   A  +  + HY    I+  A K+   W+     +EDR  ++  S +F+  +E   +     E   K++    G  + +  NS   ++T +     E + A  + C+  R  A      + + S              +   ++++E++    RV      R +RL      ++F     Q L W+ ++GE ++   TS G ++Q  ++L   H +F+  A  T    + LI  AD    + H    EI +  T +++R + F+  +E  R +L+ A+G 
Sbjct:  873 VQDLLEFLHEKQQELDLAAEQHRKHLEQCVQLRHLQAEVKQVLGWIRNGESM-LNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEAMLQANHYDMDMIRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAFLKACTLARRNADVFLKYLHRNSVNMPGMVTHVKAPEQQVKNILNELFQRENRVLHYWTLRKRRLDHCQQYVVFERSAKQALEWIQDNGEFYISTHTSTGSTIQHTQELLKEHEEFQITAKQTKERVKLLIQLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRMEKYRTSLEKALGI 1243          

HSP 5 Score: 60.8474 bits (146), Expect = 4.161e-8
Identity = 30/129 (23.26%), Postives = 60/129 (46.51%), Query Frame = 3
Query: 1248 QVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALE 1634
            QVK  + +L++    + H W   + RL+   Q  +FE    +  EW+      +++ +   G T     +L  EH +F +     +E+V  L  +A+   + GH  +A+I+     +D  ++ F+  +E
Sbjct: 1103 QVKNILNELFQRENRVLHYWTLRKRRLDHCQQYVVFERSAKQALEWIQDNGEFYISTHTSTGSTIQHTQELLKEHEEFQITAKQTKERVKLLIQLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRME 1231          
BLAST of Triple functional domain protein vs. Ensembl Xenopus
Match: not (notochord homeobox [Source:Xenbase;Acc:XB-GENE-478518])

HSP 1 Score: 661.374 bits (1705), Expect = 0.000e+0
Identity = 408/1152 (35.42%), Postives = 628/1152 (54.51%), Query Frame = 3
Query:  486 LKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRLVEE----------DEKNHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFE---ADVASAIDCLKHEVPTPMSYNF------LNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGK----SSVQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFI---RVKAEADELIHNFDEAGVSS 3860
            LKA ++L +LK  +A L G RDKRGGPVL FPA S+ D +  EDL  L+ YL  +P E V K  F+V++DMR G+ W S+KP+LK+L+E    C     IIKP+ F++KQ+    SSKF F+  +VS + L + +D SQLT  F+G L Y++EEWIEIR+  EDF   A  M  +   L + L  K++P+ +  ++  +E+H  ++ ++I+AP+  L+ EG KL   L+   +S +  + +  + N D Q L+P+V   + +L+  R HL   W   + +L+Q +QLRLFE D  +M +W+   + LFLT Y DIG   + A +L  +H  F +NC +V   +SR+  VAN L +SGHYAS QI+  A +L+ +WK+F  AL++RS +L +SA FH +AE ++ N   W  A  + ++       +  L   I   Q +++   +A+ EV  DG++L   L  P+  GS  SL A+ +YS+   H    +HEV    +++E +  HR  RL  RL L +F++DV QVL W+  HGE FL + T VGKSL RA  L   H  FEEVA NT  NA+KL+ AA++L      DPEEI Q   +LE RIQ F + VE R+  LD++V FH+H K+L+ W   L++     ++   ++E V+D ++RF  +++  L     V+KEG  L  +L +              NH + +L Q+   +    +L  ER+++L+L LQLR+FE    D+ S ++    E+   M+ +F      L + RL    ++   +       I  G+E++Q  +E+    ++ GV           + V D  E+  E+ Q L        +A ++    L+  +  R L+ + +QVL WI   + ML    +  S+L EAEQLQ EH++FQ  + + H  A+     AE  +Q   + +                             ++ AE VA  WQ+L+   E++ KL+ A+  +YKTS+QV SVL SLE+EY+R EDWC          +  ++  ++S+H EQKEAFLKAC LARR ++ F+KYL R     PG      + +++V   + +L  +E  VL  W  RK RLD C  ++   R   +A E I +  E  +S+
Sbjct:   22 LKAMEVLPILKEKVAYLSGGRDKRGGPVLTFPARSNHDRIRQEDLRRLISYLACIPSEEVCKRGFTVIVDMR-GSKWDSIKPLLKILQESFPCCIHVALIIKPDNFWQKQRTNFGSSKFEFETSMVSLEGLTKVVDPSQLTPEFEGCLEYNHEEWIEIRVAFEDFINNATHMLSRLEELQEMLAIKELPQDLEGARNMIEEHSQMKKRVIKAPIEDLDLEGQKL---LQTIQSSDSFPKKNSSSGNADLQNLLPKVSTMLDRLHSTRQHLHQMWHMRKVKLDQCFQLRLFEQDAEKMFDWITHNKGLFLTSYTDIGTRNNHAMELQTQHNHFAMNCMNVYVNISRIMSVANRLVESGHYASQQIKQIANQLEQEWKAFAAALDERSTLLDMSAMFHQKAEQYMGNVDSWCKACGEVDLP----SELQDLEDAIHHHQGIYEHITLAYSEVSQDGKSLLDKLQRPLTPGSSDSLTASANYSKAVHHVLDAIHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYQAAHQLEDRIQDFVRRVEQRKVLLDMSVSFHSHVKELWTWLEDLQKEL-LDDVYAESVEAVQDLIKRFGQQQQTTLQFTVNVIKEGEDLIQQLRDSAISSNKTPHNSSINHIETVLQQLDEAQSQMEELFQERKIKLELFLQLRIFERDAIDIISDLESWNDELSQQMN-DFDTEDLTLAEQRLQHHADKALTMNNLTFDVIHQGQELLQYVNEV----QNSGVELLCDRDVDMATRVQDLLEFLHEKQQELD-------LAAEQHRKHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEAMLQANHYDM--------------------------DMIRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAFLKACTLARRNADVFLKYLHRNSVNMPGMVTHVKAPEQQVKNILNELFQRENRVLHYWTLRKRRLDHCQQYVVFERSAKQALEWIQDNGEFYIST 1126          

HSP 2 Score: 279.256 bits (713), Expect = 2.846e-74
Identity = 159/472 (33.69%), Postives = 255/472 (54.03%), Query Frame = 3
Query: 4224 QEKAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKID-FFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEE--------------------------------------NQRTRMTSSTSDVARNADNIFYVLDDFTALEISQLSVQRNQRVQLIEQ---IGEWASVRTICTNSDIVDDESTKVQGLVPASLLISVSTR 5513
            + K+A+++  ++ E+IQTE  YV DL   + TY   +  G+ +I  P  +V ++ ++F N++EI EFH ++FL E+ +Y+               LPED+GHCF+ +A+ F+ +YV Y  NK +  Q+++E+   +F+E+         ++ N+I S+ IKPVQRITKY + LK+L   C+ G  GE+ +  EVML + KR ND +HL  ++G  E+  +ES G+ IL + F VW+P+ +I+KGR+R +FLF++ LV +K+      +  Y YKS +  +E  +TEH+EGD CKFALW GR  P  + ++VLKG  +E KQ W++ +RE +Q+R        +E                                        RT   +  SD       +  V+ DFTA   ++L+++R Q V+++E+     +W  VRT         D S   +GLVP+S L    +R
Sbjct: 1247 KRKSARRKEFIMAELIQTEKAYVRDLRECMDTYLWEMTSGVEEI--PPGIVNKEHIIFGNMQEIYEFHNNIFLKELEKYEQ--------------LPEDVGHCFVTWADKFQ-MYVSYCKNKPDSTQLILEQAGTYFDEIQQ-----RHELVNSISSYLIKPVQRITKYQLLLKELLTCCEEGK-GEIKDGLEVMLSVPKRANDAMHLSMLEGFDEN--IESQGELILQESFQVWDPKTLIRKGRERHLFLFEMSLVFSKEVKDSSGRSKYIYKSKLFTSELGVTEHVEGDPCKFALWVGRT-PTSDNKIVLKGSSIENKQDWIKHIREVIQDRTIHLRGALKEPIHIPKTAAATKQKPAKRDGEDLDSQGDGSSQPDTISIASRTSQNTLDSDKLSGGCELTVVIHDFTACNSNELTIKRGQTVEVLERHHDRPDWCLVRTT--------DRSPAAEGLVPSSSLCIAHSR 1684          

HSP 3 Score: 116.701 bits (291), Expect = 5.942e-25
Identity = 91/358 (25.42%), Postives = 168/358 (46.93%), Query Frame = 3
Query: 4239 KKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTG--SAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWE-PRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIF----YQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEENQRTRMTSSTSDV 5291
            K+R +++ E+++TE  YV DL   ++ Y   + E      +P D+  +  ++F N+ +I E+H+  FL E+ +              C   PE +   F+++      +Y+ Y  NK +   I+ E ID + E +        Q+ + +    IKP+QRI KY + LKD             EL  A EVM  + KR ND +++  ++G   D  + + G  +L D F V E    ++ + ++RRVFLF+  ++ ++    D  K +    + +K++I ++  ++ E ++ D CKFAL +        +  VL      ++Q W+  + + +            ENQR  + + TS +
Sbjct: 1930 KRRHYVLQELVETERDYVRDLGYVVEGYMALMKED----GVPDDMKGKDKIVFGNLHQIYEWHRDFFLGELER--------------CLDEPERLASLFVKHERRL-HMYIVYCQNKPKSEHIVSEYIDTYFEDLKQRLGHRLQLTDLL----IKPIQRIMKYQLLLKDFLKYSKKACIDVAELERAVEVMCIVPKRCNDMMNVGRLQGF--DGKIVAQGKLLLQDTFLVTEQDAGLLPRCKERRVFLFEQIVIFSEPL--DKKKGYSTPGFLFKNNIKVSCLSLEECVDSDPCKFALLSRSADSTEMF--VLHSSSPGVRQLWIHEINQIL------------ENQRNFLNALTSPI 2246          

HSP 4 Score: 83.9593 bits (206), Expect = 4.523e-15
Identity = 82/372 (22.04%), Postives = 153/372 (41.13%), Query Frame = 3
Query: 1263 VQQLYEYRAHLQHKWDAG----RSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETV--NSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGF 2357
            VQ L E+    Q + D      R  LEQ  QLR  + ++ ++  W+     + L        +  +A  L  EH QF        +   ++   A  +  + HY    I+  A K+   W+     +EDR  ++  S +F+  +E   +     E   K++    G  + +  NS   ++T +     E + A  + C+  R  A      + + S              +   ++++E++    RV      R +RL      ++F     Q L W+ ++GE ++   TS G ++Q  ++L   H +F+  A  T    + LI  AD    + H    EI +  T +++R + F+  +E  R +L+ A+G 
Sbjct:  840 VQDLLEFLHEKQQELDLAAEQHRKHLEQCVQLRHLQAEVKQVLGWIRNGESM-LNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEAMLQANHYDMDMIRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAFLKACTLARRNADVFLKYLHRNSVNMPGMVTHVKAPEQQVKNILNELFQRENRVLHYWTLRKRRLDHCQQYVVFERSAKQALEWIQDNGEFYISTHTSTGSTIQHTQELLKEHEEFQITAKQTKERVKLLIQLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRMEKYRTSLEKALGI 1210          

HSP 5 Score: 60.8474 bits (146), Expect = 4.157e-8
Identity = 30/129 (23.26%), Postives = 60/129 (46.51%), Query Frame = 3
Query: 1248 QVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALE 1634
            QVK  + +L++    + H W   + RL+   Q  +FE    +  EW+      +++ +   G T     +L  EH +F +     +E+V  L  +A+   + GH  +A+I+     +D  ++ F+  +E
Sbjct: 1070 QVKNILNELFQRENRVLHYWTLRKRRLDHCQQYVVFERSAKQALEWIQDNGEFYISTHTSTGSTIQHTQELLKEHEEFQITAKQTKERVKLLIQLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRME 1198          
BLAST of Triple functional domain protein vs. Ensembl Xenopus
Match: not (notochord homeobox [Source:Xenbase;Acc:XB-GENE-478518])

HSP 1 Score: 657.522 bits (1695), Expect = 0.000e+0
Identity = 405/1148 (35.28%), Postives = 624/1148 (54.36%), Query Frame = 3
Query:  498 DLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRLVEE----------DEKNHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFE---ADVASAIDCLKHEVPTPMSYNF------LNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGK----SSVQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFI---RVKAEADELIHNFDEAGVSS 3860
            ++L +LK  +A L G RDKRGGPVL FPA S+ D +  EDL  L+ YL  +P E V K  F+V++DMR G+ W S+KP+LK+L+E    C     IIKP+ F++KQ+    SSKF F+  +VS + L + +D SQLT  F+G L Y++EEWIEIR+  EDF   A  M  +   L + L  K++P+ +  ++  +E+H  ++ ++I+AP+  L+ EG KL   L+   +S +  + +  + N D Q L+P+V   + +L+  R HL   W   + +L+Q +QLRLFE D  +M +W+   + LFLT Y DIG   + A +L  +H  F +NC +V   +SR+  VAN L +SGHYAS QI+  A +L+ +WK+F  AL++RS +L +SA FH +AE ++ N   W  A  + ++       +  L   I   Q +++   +A+ EV  DG++L   L  P+  GS  SL A+ +YS+   H    +HEV    +++E +  HR  RL  RL L +F++DV QVL W+  HGE FL + T VGKSL RA  L   H  FEEVA NT  NA+KL+ AA++L      DPEEI Q   +LE RIQ F + VE R+  LD++V FH+H K+L+ W   L++     ++   ++E V+D ++RF  +++  L     V+KEG  L  +L +              NH + +L Q+   +    +L  ER+++L+L LQLR+FE    D+ S ++    E+   M+ +F      L + RL    ++   +       I  G+E++Q  +E+  +    GV           + V D  E+  E+ Q L        +A ++    L+  +  R L+ + +QVL WI   + ML    +  S+L EAEQLQ EH++FQ  + + H  A+     AE  +Q   + +                             ++ AE VA  WQ+L+   E++ KL+ A+  +YKTS+QV SVL SLE+EY+R EDWC          +  ++  ++S+H EQKEAFLKAC LARR ++ F+KYL R     PG      + +++V   + +L  +E  VL  W  RK RLD C  ++   R   +A E I +  E  +S+
Sbjct:    2 EVLPILKEKVAYLSGGRDKRGGPVLTFPARSNHDRIRQEDLRRLISYLACIPSEEVCKRGFTVIVDMR-GSKWDSIKPLLKILQESFPCCIHVALIIKPDNFWQKQRTNFGSSKFEFETSMVSLEGLTKVVDPSQLTPEFEGCLEYNHEEWIEIRVAFEDFINNATHMLSRLEELQEMLAIKELPQDLEGARNMIEEHSQMKKRVIKAPIEDLDLEGQKL---LQTIQSSDSFPKKNSSSGNADLQNLLPKVSTMLDRLHSTRQHLHQMWHMRKVKLDQCFQLRLFEQDAEKMFDWITHNKGLFLTSYTDIGTRNNHAMELQTQHNHFAMNCMNVYVNISRIMSVANRLVESGHYASQQIKQIANQLEQEWKAFAAALDERSTLLDMSAMFHQKAEQYMGNVDSWCKACGEVDLP----SELQDLEDAIHHHQGIYEHITLAYSEVSQDGKSLLDKLQRPLTPGSSDSLTASANYSKAVHHVLDAIHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYQAAHQLEDRIQDFVRRVEQRKVLLDMSVSFHSHVKELWTWLEDLQKE-LLDDVYAESVEAVQDLIKRFGQQQQTTLQFTVNVIKEGEDLIQQLRDSAISSNKTPHNSSINHIETVLQQLDEAQSQMEELFQERKIKLELFLQLRIFERDAIDIISDLESWNDELSQQMN-DFDTEDLTLAEQRLQHHADKALTMNNLTFDVIHQGQELLQYVNEVQNS----GVELLCDRDVDMATRVQDLLEFLHEKQQELD-------LAAEQHRKHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEAMLQANHYDMDM--------------------------IRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAFLKACTLARRNADVFLKYLHRNSVNMPGMVTHVKAPEQQVKNILNELFQRENRVLHYWTLRKRRLDHCQQYVVFERSAKQALEWIQDNGEFYIST 1102          

HSP 2 Score: 199.519 bits (506), Expect = 2.344e-50
Identity = 103/278 (37.05%), Postives = 171/278 (61.51%), Query Frame = 3
Query: 4230 KAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKID-FFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLT 5060
            K+A+++  ++ E+IQTE  YV DL   + TY   +  G+ +I  P  +V ++ ++F N++EI EFH ++FL E+ +Y+               LPED+GHCF+ +A+ F+ +YV Y  NK +  Q+++E+   +F+E+         ++ N+I S+ IKPVQRITKY + LK+L   C+ G  GE+ +  EVML + KR ND +HL  ++G  E+  +ES G+ IL + F VW+P+ +I+KGR+R +FLF++ LV +K+      +  Y YKS + ++
Sbjct: 1225 KSARRKEFIMAELIQTEKAYVRDLRECMDTYLWEMTSGVEEI--PPGIVNKEHIIFGNMQEIYEFHNNIFLKELEKYEQ--------------LPEDVGHCFVTWADKFQ-MYVSYCKNKPDSTQLILEQAGTYFDEIQQ-----RHELVNSISSYLIKPVQRITKYQLLLKELLTCCEEGK-GEIKDGLEVMLSVPKRANDAMHLSMLEGFDEN--IESQGELILQESFQVWDPKTLIRKGRERHLFLFEMSLVFSKEVKDSSGRSKYIYKSKLFVS 1477          

HSP 3 Score: 81.6481 bits (200), Expect = 1.849e-14
Identity = 82/372 (22.04%), Postives = 153/372 (41.13%), Query Frame = 3
Query: 1263 VQQLYEYRAHLQHKWDAG----RSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETV--NSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGF 2357
            VQ L E+    Q + D      R  LEQ  QLR  + ++ ++  W+     + L        +  +A  L  EH QF        +   ++   A  +  + HY    I+  A K+   W+     +EDR  ++  S +F+  +E   +     E   K++    G  + +  NS   ++T +     E + A  + C+  R  A      + + S              +   ++++E++    RV      R +RL      ++F     Q L W+ ++GE ++   TS G ++Q  ++L   H +F+  A  T    + LI  AD    + H    EI +  T +++R + F+  +E  R +L+ A+G 
Sbjct:  816 VQDLLEFLHEKQQELDLAAEQHRKHLEQCVQLRHLQAEVKQVLGWIRNGESM-LNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEAMLQANHYDMDMIRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAFLKACTLARRNADVFLKYLHRNSVNMPGMVTHVKAPEQQVKNILNELFQRENRVLHYWTLRKRRLDHCQQYVVFERSAKQALEWIQDNGEFYISTHTSTGSTIQHTQELLKEHEEFQITAKQTKERVKLLIQLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRMEKYRTSLEKALGI 1186          

HSP 4 Score: 59.6918 bits (143), Expect = 9.850e-8
Identity = 30/129 (23.26%), Postives = 60/129 (46.51%), Query Frame = 3
Query: 1248 QVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALE 1634
            QVK  + +L++    + H W   + RL+   Q  +FE    +  EW+      +++ +   G T     +L  EH +F +     +E+V  L  +A+   + GH  +A+I+     +D  ++ F+  +E
Sbjct: 1046 QVKNILNELFQRENRVLHYWTLRKRRLDHCQQYVVFERSAKQALEWIQDNGEFYISTHTSTGSTIQHTQELLKEHEEFQITAKQTKERVKLLIQLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRME 1174          
BLAST of Triple functional domain protein vs. Ensembl Mouse
Match: Trio (triple functional domain (PTPRF interacting) [Source:MGI Symbol;Acc:MGI:1927230])

HSP 1 Score: 659.062 bits (1699), Expect = 0.000e+0
Identity = 401/1152 (34.81%), Postives = 632/1152 (54.86%), Query Frame = 3
Query:  486 LKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRLVEE----------DEKNHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFE---ADVASAIDCLKHEVPTPMSYNF------LNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGK----SSVQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFI---RVKAEADELIHNFDEAGVSS 3860
            +KA D+L +LK  +A L G RDKRGGP+L FPA S+ D +  EDL  L+ YL  +P E V K  F+V++DMR G+ W S+KP+LK+L+E    C     IIKP+ F++KQ+    SSKF F+  +VS + L + +D SQLT  FDG L Y++EEWIEIR+  E++ + A  M  +   L   L +K++P+ +  ++  +++H  ++ K+I+AP+  L+ EG KL   L+   +S +  + +  + N D Q L+P+V   + +L+  R HL   W   + +L+Q +QLRLFE D  +M +W+   + LFL  Y +IG +   A +L  +H  F +NC +V   ++R+  VAN L +SGHYAS QI+  A +L+ +WK+F  AL++RS +L +S+ FH +AE +++N   W  A  + ++       +  L   I   Q +++   +A+ EV  DG++L   L  P+  GS  SL A+ +YS+   H   ++HEV    +++E +  HR  RL  RL L +F++DV QVL W+  HGE FL + T VGKSL RA  L   H  FEEVA NT  NA+KL+ AA++L      DPEEI Q   +LE RIQ F + VE R+  LD++V FH H K+L+ W  +L++     ++   ++E V+D ++RF  +++  L     V+KEG  L  +L +              NH + +L Q+   +    +L  ER+++L+L LQLR+FE    D+ S ++    E+   M+ +F      + + RL    ++   +       I  G++++Q  +E+    ++ GV           + V D  E+  E+ Q L        +A ++    L+  +  R L+ + +QVL WI   + ML    +  S+L EAEQLQ EH++FQ  + + H  A+     AE  +Q   + +                             ++ AE VA  WQ+L+   E++ KL+ A+  +YKTS+QV SVL SLE+EY+R EDWC          +  ++  ++S+H EQKEAFLKAC LARR ++ F+KYL R     PG      + +++V   + +L  +E  VL  W  RK RLD+C  ++   R   +A E IH+  E  +S+
Sbjct:   60 MKAMDVLPILKEKVAYLSGGRDKRGGPILTFPARSNHDRIRQEDLRRLISYLACIPSEEVCKRGFTVIVDMR-GSKWDSIKPLLKILQESFPCCIHIALIIKPDNFWQKQRTNFGSSKFEFETNMVSLEGLTKVVDPSQLTPEFDGCLEYNHEEWIEIRVAFEEYISNAAHMLSRLEELQDVLAKKELPQDLEGARNMIDEHSQLKKKVIKAPIEDLDLEGQKL---LQRIQSSDSFPKKNSGSGNADLQNLLPKVSTMLDRLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAEKMFDWITHNKGLFLNSYTEIGTSHPHAMELQTQHNHFAMNCMNVYVNINRIMSVANRLVESGHYASQQIKQIANQLEQEWKAFAAALDERSTLLDMSSIFHQKAEKYMSNVDSWCKACGEVDLP----SELQDLEDAIHHHQGIYEHITLAYSEVSQDGKSLLDKLQRPLTPGSSDSLTASANYSKAVHHVLDVIHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYQAAHQLEDRIQDFVRRVEQRKILLDMSVSFHTHVKELWTWLEELQKEL-LDDVYAESVEAVQDLIKRFGQQQQTTLQVTVNVIKEGEDLIQQLRDSAISSNKTPHNSSINHIETVLQQLDEAQSQMEELFQERKIKLELFLQLRIFERDAIDIISDLESWNDELSQQMN-DFDTEDLTIAEQRLQHHADKALTMNNLTFDVIHQGQDLLQYVNEV----QASGVELLCDRDVDMATRVQDLLEFLHEKQQELD-------LAAEQHRKHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEAMLQANHYDM--------------------------DMIRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAFLKACTLARRNADVFLKYLHRNSVSMPGMVTHIKAPEQQVKNILNELFQRENRVLHYWTMRKRRLDQCQQYVVFERSAKQALEWIHDNGEFYLST 1164          

HSP 2 Score: 274.633 bits (701), Expect = 5.005e-73
Identity = 158/471 (33.55%), Postives = 250/471 (53.08%), Query Frame = 3
Query: 4224 QEKAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKI-DFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEE-------------------------------------NQRTRMTSSTSDVARNADNIFYVLDDFTALEISQLSVQRNQRVQLIEQI---GEWASVRTICTNSDIVDDESTKVQGLVPASLLISVSTR 5513
            + K+A+++  ++ E+IQTE  YV DL   + TY   +  G+ +I  P  +V ++ ++F N++EI EFH ++FL E+ +Y+               LPED+GHCF+ +A+ F+ +YV Y  NK +  Q+++E    +F+E+          + N+I S+ IKPVQRITKY + LK+L   C+ G  GE+ +  EVML + KR ND +HL  ++G  E+  +ES G+ IL + F VW+P+ +I+KGR+R +FLF++ LV +K+      +  Y YKS +  +E  +TEH+EGD CKFALW GR  P  + ++VLK   +E KQ W++ +RE +QER        +E                                       RT   +  SD       +  V+ DFTA   ++L+++R Q V+++E+     +W  VRT         D S   +GLVP   L    +R
Sbjct: 1286 KRKSARRKEFIMAELIQTEKAYVRDLRECMDTYLWEMTSGVEEI--PPGIVNKELIIFGNMQEIYEFHNNIFLKELEKYEQ--------------LPEDVGHCFVTWADKFQ-MYVTYCKNKPDSTQLILEHAGSYFDEIQQ-----RHGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGK-GEIKDGLEVMLSVPKRANDAMHLSMLEGFDEN--IESQGELILQESFQVWDPKTLIRKGRERHLFLFEMSLVFSKEVKDSSGRSKYLYKSKLFTSELGVTEHVEGDPCKFALWVGRT-PTSDNKIVLKASSIENKQDWIKHIREVIQERTVHLRGALKEPIHIPKTAPAARQKGRRDGEDLDSQGDGSSQPDTISIASRTSQNTLDSDKLSGGCELTVVIHDFTACNSNELTIRRGQTVEVLERPHDKPDWCLVRTT--------DRSPAAEGLVPCGSLCIAHSR 1722          

HSP 3 Score: 127.487 bits (319), Expect = 2.528e-28
Identity = 99/358 (27.65%), Postives = 171/358 (47.77%), Query Frame = 3
Query: 4239 KKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGS--AGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWE-PRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIF----YQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEENQRTRMTSSTSDV 5291
            K+R +++ E+++TE  YV DL   ++ Y   + E      +P D+  +  ++F NI +I ++H+  FL E+ +              C   PE +G  F+++      +Y+ Y  NK +   I+ E ID F E +        Q+ + +    IKPVQRI KY + LKD        S    EL +A EVM  + KR ND +++  ++G   D  + + G  +L D F V +    ++ + ++RRVFLF+  ++ ++    D  K F    + +K+ I ++   + E++E D CKFAL T R     E   VL      ++Q W+  + + +            ENQR  + + TS +
Sbjct: 1968 KRRHYVLQELVETERDYVRDLGCVVEGYMALMKED----GVPDDMKGKDKIVFGNIHQIYDWHRDFFLGELEK--------------CLEDPEKLGSLFVKHERRL-HMYIVYCQNKPKSEHIVSEYIDTFFEDLKQRLGHRLQLTDLL----IKPVQRIMKYQLLLKDFLKYSKKASLDTSELEKAVEVMCIVPKRCNDMMNVGRLQGF--DGKIVAQGKLLLQDTFLVTDQDAGLLPRCKERRVFLFEQIVIFSEPL--DKKKGFSMPGFLFKNSIKVSCLCLEENVESDPCKFAL-TSRTGDAVET-FVLHSSSPSVRQTWIHEINQIL------------ENQRNFLNALTSPI 2284          

HSP 4 Score: 88.1965 bits (217), Expect = 1.964e-16
Identity = 91/408 (22.30%), Postives = 169/408 (41.42%), Query Frame = 3
Query: 1263 VQQLYEYRAHLQHKWDAG----RSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETV--NSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELR 2465
            VQ L E+    Q + D      R  LEQ  QLR  + ++ ++  W+     + L        +  +A  L  EH QF        +   ++   A  +  + HY    I+  A K+   W+     +EDR  ++  S +F+  +E   +     E   K++    G  + +  NS   ++T +     E + A  + C+  R  A      + + S +            +   ++++E++    RV      R +RL      ++F     Q L W++++GE +L   TS G S+Q  ++L   H +F+  A  T    + LI  AD    + H    EI +  T +++R + F+  +E  R +L+ A+G  + +    K            +++P +I G E +LR
Sbjct:  878 VQDLLEFLHEKQQELDLAAEQHRKHLEQCVQLRHLQAEVKQVLGWIRNGESM-LNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEAMLQANHYDMDMIRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAFLKACTLARRNADVFLKYLHRNSVSMPGMVTHIKAPEQQVKNILNELFQRENRVLHYWTMRKRRLDQCQQYVVFERSAKQALEWIHDNGEFYLSTHTSTGSSIQHTQELLKEHEEFQITAKQTKERVKLLIQLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRMEKYRTSLEKALGISSDSNKSSKSLQ--------LDIIPASIPGSEVKLR 1276          

HSP 5 Score: 63.1586 bits (152), Expect = 6.142e-9
Identity = 31/129 (24.03%), Postives = 62/129 (48.06%), Query Frame = 3
Query: 1248 QVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALE 1634
            QVK  + +L++    + H W   + RL+Q  Q  +FE    +  EW++     +L+ +   G +     +L  EH +F +     +E+V  L  +A+   + GH  +A+I+     +D  ++ F+  +E
Sbjct: 1108 QVKNILNELFQRENRVLHYWTMRKRRLDQCQQYVVFERSAKQALEWIHDNGEFYLSTHTSTGSSIQHTQELLKEHEEFQITAKQTKERVKLLIQLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRME 1236          
BLAST of Triple functional domain protein vs. Ensembl Mouse
Match: Trio (triple functional domain (PTPRF interacting) [Source:MGI Symbol;Acc:MGI:1927230])

HSP 1 Score: 658.677 bits (1698), Expect = 0.000e+0
Identity = 401/1152 (34.81%), Postives = 632/1152 (54.86%), Query Frame = 3
Query:  486 LKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRLVEE----------DEKNHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFE---ADVASAIDCLKHEVPTPMSYNF------LNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGK----SSVQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFI---RVKAEADELIHNFDEAGVSS 3860
            +KA D+L +LK  +A L G RDKRGGP+L FPA S+ D +  EDL  L+ YL  +P E V K  F+V++DMR G+ W S+KP+LK+L+E    C     IIKP+ F++KQ+    SSKF F+  +VS + L + +D SQLT  FDG L Y++EEWIEIR+  E++ + A  M  +   L   L +K++P+ +  ++  +++H  ++ K+I+AP+  L+ EG KL   L+   +S +  + +  + N D Q L+P+V   + +L+  R HL   W   + +L+Q +QLRLFE D  +M +W+   + LFL  Y +IG +   A +L  +H  F +NC +V   ++R+  VAN L +SGHYAS QI+  A +L+ +WK+F  AL++RS +L +S+ FH +AE +++N   W  A  + ++       +  L   I   Q +++   +A+ EV  DG++L   L  P+  GS  SL A+ +YS+   H   ++HEV    +++E +  HR  RL  RL L +F++DV QVL W+  HGE FL + T VGKSL RA  L   H  FEEVA NT  NA+KL+ AA++L      DPEEI Q   +LE RIQ F + VE R+  LD++V FH H K+L+ W  +L++     ++   ++E V+D ++RF  +++  L     V+KEG  L  +L +              NH + +L Q+   +    +L  ER+++L+L LQLR+FE    D+ S ++    E+   M+ +F      + + RL    ++   +       I  G++++Q  +E+    ++ GV           + V D  E+  E+ Q L        +A ++    L+  +  R L+ + +QVL WI   + ML    +  S+L EAEQLQ EH++FQ  + + H  A+     AE  +Q   + +                             ++ AE VA  WQ+L+   E++ KL+ A+  +YKTS+QV SVL SLE+EY+R EDWC          +  ++  ++S+H EQKEAFLKAC LARR ++ F+KYL R     PG      + +++V   + +L  +E  VL  W  RK RLD+C  ++   R   +A E IH+  E  +S+
Sbjct:    1 MKAMDVLPILKEKVAYLSGGRDKRGGPILTFPARSNHDRIRQEDLRRLISYLACIPSEEVCKRGFTVIVDMR-GSKWDSIKPLLKILQESFPCCIHIALIIKPDNFWQKQRTNFGSSKFEFETNMVSLEGLTKVVDPSQLTPEFDGCLEYNHEEWIEIRVAFEEYISNAAHMLSRLEELQDVLAKKELPQDLEGARNMIDEHSQLKKKVIKAPIEDLDLEGQKL---LQRIQSSDSFPKKNSGSGNADLQNLLPKVSTMLDRLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAEKMFDWITHNKGLFLNSYTEIGTSHPHAMELQTQHNHFAMNCMNVYVNINRIMSVANRLVESGHYASQQIKQIANQLEQEWKAFAAALDERSTLLDMSSIFHQKAEKYMSNVDSWCKACGEVDLP----SELQDLEDAIHHHQGIYEHITLAYSEVSQDGKSLLDKLQRPLTPGSSDSLTASANYSKAVHHVLDVIHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYQAAHQLEDRIQDFVRRVEQRKILLDMSVSFHTHVKELWTWLEELQKE-LLDDVYAESVEAVQDLIKRFGQQQQTTLQVTVNVIKEGEDLIQQLRDSAISSNKTPHNSSINHIETVLQQLDEAQSQMEELFQERKIKLELFLQLRIFERDAIDIISDLESWNDELSQQMN-DFDTEDLTIAEQRLQHHADKALTMNNLTFDVIHQGQDLLQYVNEV----QASGVELLCDRDVDMATRVQDLLEFLHEKQQELD-------LAAEQHRKHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEAMLQANHYDMDM--------------------------IRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAFLKACTLARRNADVFLKYLHRNSVSMPGMVTHIKAPEQQVKNILNELFQRENRVLHYWTMRKRRLDQCQQYVVFERSAKQALEWIHDNGEFYLST 1105          

HSP 2 Score: 275.018 bits (702), Expect = 2.109e-73
Identity = 158/469 (33.69%), Postives = 249/469 (53.09%), Query Frame = 3
Query: 4230 KAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKI-DFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEE-------------------------------------NQRTRMTSSTSDVARNADNIFYVLDDFTALEISQLSVQRNQRVQLIEQI---GEWASVRTICTNSDIVDDESTKVQGLVPASLLISVSTR 5513
            K+A+++  ++ E+IQTE  YV DL   + TY   +  G+ +I  P  +V ++ ++F N++EI EFH ++FL E+ +Y+               LPED+GHCF+ +A+ F+ +YV Y  NK +  Q+++E    +F+E+          + N+I S+ IKPVQRITKY + LK+L   C+ G  GE+ +  EVML + KR ND +HL  ++G  E+  +ES G+ IL + F VW+P+ +I+KGR+R +FLF++ LV +K+      +  Y YKS +  +E  +TEH+EGD CKFALW GR P   + ++VLK   +E KQ W++ +RE +QER        +E                                       RT   +  SD       +  V+ DFTA   ++L+++R Q V+++E+     +W  VRT         D S   +GLVP   L    +R
Sbjct: 1229 KSARRKEFIMAELIQTEKAYVRDLRECMDTYLWEMTSGVEEI--PPGIVNKELIIFGNMQEIYEFHNNIFLKELEKYEQ--------------LPEDVGHCFVTWADKFQ-MYVTYCKNKPDSTQLILEHAGSYFDEIQQ-----RHGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGK-GEIKDGLEVMLSVPKRANDAMHLSMLEGFDEN--IESQGELILQESFQVWDPKTLIRKGRERHLFLFEMSLVFSKEVKDSSGRSKYLYKSKLFTSELGVTEHVEGDPCKFALWVGRTPT-SDNKIVLKASSIENKQDWIKHIREVIQERTVHLRGALKEPIHIPKTAPAARQKGRRDGEDLDSQGDGSSQPDTISIASRTSQNTLDSDKLSGGCELTVVIHDFTACNSNELTIRRGQTVEVLERPHDKPDWCLVRTT--------DRSPAAEGLVPCGSLCIAHSR 1663          

HSP 3 Score: 86.2705 bits (212), Expect = 5.817e-16
Identity = 86/393 (21.88%), Postives = 167/393 (42.49%), Query Frame = 3
Query: 1191 NQTRSSWVTMNPDYQ-QLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETV--NSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGF 2357
            N+ ++S V +  D    +  +V+  ++ L+E +  L    +  R  LEQ  QLR  + ++ ++  W+     + L        +  +A  L  EH QF        +   ++   A  +  + HY    I+  A K+   W+     +EDR  ++  S +F+  +E   +     E   K++    G  + +  NS   ++T +     E + A  + C+  R  A      + + S +            +   ++++E++    RV      R +RL      ++F     Q L W++++GE +L   TS G S+Q  ++L   H +F+  A  T    + LI  AD    + H    EI +  T +++R + F+  +E  R +L+ A+G 
Sbjct:  798 NEVQASGVELLCDRDVDMATRVQDLLEFLHEKQQELDLAAEQHRKHLEQCVQLRHLQAEVKQVLGWIRNGESM-LNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEAMLQANHYDMDMIRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAFLKACTLARRNADVFLKYLHRNSVSMPGMVTHIKAPEQQVKNILNELFQRENRVLHYWTMRKRRLDQCQQYVVFERSAKQALEWIHDNGEFYLSTHTSTGSSIQHTQELLKEHEEFQITAKQTKERVKLLIQLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRMEKYRTSLEKALGI 1189          
BLAST of Triple functional domain protein vs. Ensembl Mouse
Match: Kalrn (kalirin, RhoGEF kinase [Source:MGI Symbol;Acc:MGI:2685385])

HSP 1 Score: 649.047 bits (1673), Expect = 0.000e+0
Identity = 408/1155 (35.32%), Postives = 628/1155 (54.37%), Query Frame = 3
Query:  486 LKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRY--GLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRL------------VEEDEKNHFKV-----------LLMQVQSDKETATDLLTERQVRLDLCLQLRLFE---ADVASAIDCLKHEVPTPMSYNFLNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGKSS----VQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFIRVKAEADELIHNFDEAG 3851
            LKA D+L +LK  +A + G RDKRGGP+L FPA S+ D +  EDL  LV YL  +P E+V K  F+V+IDMR G+ W  +KP+LK L+E          IIKP+ F++KQK    SSKF F+  +VS + L + +D SQLT+ FDG+L Y++EEWIE+R+ LE+FF  A  +  +   L + L RK+ P  V  S+R +++H  ++ K+++APV  L+ EG +L   +R   G + +N      +  + D+Q L+P++   + +L+  R HL   W   + +L+Q +QLRLFE D  +M +W++  + LFL  + +IG +   A DL  +H  F +N  +    ++R+  VA+ L+++GHYAS QI+  + +LD +WKSF  AL++RS +L +SA FH +AE FL+    W     +     G    +  L   I   Q L+++   A+ EV  DG+AL   L  P+  G+  SL A  +YS+       ++HEV    +R+E++  HR  RL  RL L +F++DV QVL W+  HGE FL + T VGKSL RA  L   H  FEEVA NT  NA+KL+ AA++L      DPEEI +    LE RIQ F + VE R+  LD++V FH HTK+L+ W   L++     ++   +++ V++ +++F  ++   LDA   V+KEG  L  +L              +   ++ K            +L Q+   +    +L  ER+++LD+ LQLR+FE    +V + +D    ++   M  N  N   L  +   L+  T   +A      EVIQ+G +L +    V     A G        +D A    E ++ L  +  +L +  ++ + +L+  L  R L+ + +QVL WI   + ML  + +  S+L+EAEQLQ EH++FQ  + + H  A+     AE  +Q                   + H     I       +  AE VA  WQ+L+   E++ KL+ A+  +YKTS+QV SVL SLE+EYRR EDWC          ++ ++  LLS+H EQKEAFLKAC LARR +E F+KY+ R     P  +S     +++V A + +L+ +E  VL  W  +K RLD+C  ++  +  A + +    E G
Sbjct:    8 LKASDVLPILKEKVAFVSGGRDKRGGPILTFPARSNHDRIRQEDLRKLVTYLASVPSEDVCKRGFTVIIDMR-GSKWDLIKPLLKTLQEAFPAEIHVALIIKPDNFWQKQKTNFGSSKFIFETSMVSVEGLTKLVDPSQLTEEFDGSLDYNHEEWIELRLSLEEFFNSAVHLLSRLEDLQEMLARKEFPVDVEGSRRLIDEHTQLKKKVLKAPVEELDREGQRLLQCIRCSDGFSGRN-----CIPGSADFQSLVPKITSLLDKLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAEKMFDWISHNKELFLQSHTEIGVSYQHALDLQTQHNHFAMNSMNAYVNINRIMSVASRLSEAGHYASQQIKQISTQLDQEWKSFAAALDERSTILAMSAVFHQKAEQFLSGVDAWCKMCSEG----GLPSEMQDLELAIHHHQSLYEQVTQAYTEVSQDGKALLDVLQRPLSPGNSESLTATANYSKAVHQVLDVVHEVLHHQRRLESIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHDDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYKAARHLEVRIQDFVRRVEQRKLLLDMSVSFHTHTKELWTWMEDLQKE-VLEDVCADSVDAVQELIKQFQQQQTATLDATLNVIKEGEDLIQQLRSAPPSLGEPTEARDSAMSNNKTPHSSSISHIESVLQQLDDAQVQMEELFHERKIKLDIFLQLRIFEQYTIEVTAELDAWNEDLLRQM--NDFNTEDLTLAEQRLQRHTERKLAMNNMTFEVIQQGQDLHQYIMEV----QASGIELICEKDLDLAAQVQELLEFLHEKQHELELNAEQTHKRLEQCLQLRHLQAEVKQVLGWIRNGESMLNASLVNASSLSEAEQLQREHEQFQLAIEKTHQSALQVQQKAEALLQ-------------------AGHYDADAI-------RECAEKVALHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYRRDEDWCGGRDKLGPAAEMDHVIPLLSKHLEQKEAFLKACTLARRNAEVFLKYIHRNNVSMPSVASHTRGPEQQVKAILSELLQRENRVLHFWTLKKRRLDQCQQYVVFERSAKQALDWIQETG 1119          

HSP 2 Score: 282.722 bits (722), Expect = 1.515e-75
Identity = 165/470 (35.11%), Postives = 256/470 (54.47%), Query Frame = 3
Query: 4230 KAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKID-FFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSF-GPIYEENQ-------------------------------------RTRMTSSTSDVARNADNIFYVLDDFTALEISQLSVQRNQRVQLIEQIGE---WASVRTICTNSDIVDDESTKVQGLVPASLLISVSTR 5513
            K+A+K+  ++ E++QTE  YV DL   L+TY   +  G+ +I  P  ++ ++ ++F NI+EI +FH ++FL E+ +Y+               LPED+GHCF+ +A+ F+ +YV Y  NK + NQ+++E    FF+E+          + N+I S+ IKPVQR+TKY + LK+L   C+ G  GEL +  EVML + K+ ND +H+  ++G  E+  L+  G+ IL D F VW+P+ +I+KGR+R +FLF++ LV +K+         Y YK+ +L +E  +TEH+EGD CKFALW+GR P   + + VLK  ++E KQ+W++ +RE +QERI    G + E  Q                                     RT   +  SD       +  VL DF+A   S+LS+Q  Q V+L+E+  E   W  VRT         + S   +GLVP+S L    +R
Sbjct: 1246 KSARKKEFIMAELLQTEKAYVRDLHECLETYLWEMTSGVEEI--PPGILNKEHIIFGNIQEIYDFHNNIFLKELEKYEQ--------------LPEDVGHCFVTWADKFQ-MYVTYCKNKPDSNQLILEHAGTFFDEIQQ-----RHGLANSISSYLIKPVQRVTKYQLLLKELLTCCEEGK-GELKDGLEVMLSVPKKANDAMHVSMLEGFDEN--LDVQGELILQDAFQVWDPKSLIRKGRERHLFLFEISLVFSKEIKDSSGHTKYVYKNKLLTSELGVTEHVEGDPCKFALWSGRTPS-SDNKTVLKASNIETKQEWIKNIREVIQERIIHLKGALKEPIQLPKTPAKLRNNSKRDGVEDGDSQGDGSSQPDTISIASRTSQNTVESDKLSGGCELTVVLQDFSAGHSSELSIQVGQTVELLERPSERPGWCLVRTT--------ERSPPQEGLVPSSALCISHSR 1681          

HSP 3 Score: 131.724 bits (330), Expect = 1.210e-29
Identity = 92/333 (27.63%), Postives = 165/333 (49.55%), Query Frame = 3
Query: 4230 KAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPED-IGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGS--AGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIK-KGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQ 5216
            KA + R+ ++NE++QTE  YV DL   ++ + K I E      +P+D+  ++ ++F NI +I ++HK  FL E+ +               C   +D +   FI++      IYV Y  NK     I+ E   +F E+       E   + T+  F IKP+QRITKY + LKD     +       ++ +A E+M  + KR ND ++L  ++G   +  L + G  +  D F V E    ++ + ++RRVFLF+  ++ ++          Y +K  I +    + ++++GD CKFAL           R++L+  + +I+Q WV+ + + ++
Sbjct: 1892 KALRGRMFVLNELVQTEKDYVKDLGIVVEGFMKRIEEK----GVPEDMRGKEKIVFGNIHQIYDWHKDFFLAELEK---------------CIQEQDRLAQLFIKHERKLH-IYVWYCQNKPRSEYIVAEYDAYFEEVKQ-----EINQRLTLSDFLIKPIQRITKYQLLLKDFLRYSEKAGLECSDIEKAVELMCLVPKRCNDMMNLGRLQGF--EGTLTAQGKLLQQDTFYVIELDAGMQSRTKERRVFLFEQIVIFSELLRKGSLTPGYMFKRSIKMNYLVLEDNVDGDPCKFALMNRETSE----RVILQAANSDIQQAWVQDINQVLE 2193          

HSP 4 Score: 68.5514 bits (166), Expect = 1.535e-10
Identity = 83/385 (21.56%), Postives = 165/385 (42.86%), Query Frame = 3
Query: 1239 LIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQ--YITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEG-RKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNH-TKDL 2378
            L  QV++ ++ L+E +  L+   +    RLEQ  QLR  + ++ ++  W+     +      +   + S+A  L  EH QF +      +   ++   A  L  +GHY +  I+  A K+   W+     +EDR  ++  S +F+  +E   +     E   ++     G  + +    +  ++  L     E + A  + C+  R  A      + + ++ S+ +   ++ G  +    ++ E+     RV      + +RL      ++F     Q L W+ E GE +L   TS G++ +  ++L   + +F   A  T    + LI  AD  V + H    EI +  T +++  + F+  +   R +L+ A+G +    KDL
Sbjct:  835 LAAQVQELLEFLHEKQHELELNAEQTHKRLEQCLQLRHLQAEVKQVLGWIRNGESMLNASLVN-ASSLSEAEQLQREHEQFQLAIEKTHQSALQVQQKAEALLQAGHYDADAIRECAEKVALHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYRRDEDWCGGRDKLGPAAEMDHVIPLLSKHLEQKEAFLKACTLARRNAEVFLKYIHR-NNVSMPSVASHTRGPEQQVKAILSELLQRENRVLHFWTLKKRRLDQCQQYVVFERSAKQALDWIQETGEYYLSTHTSTGETTEETQELLKEYGEFRVPAKQTKEKVKLLIQLADSFVEKGHIHATEIRKWVTTVDKHYRDFSLRMGKYRYSLEKALGVNTEDNKDL 1217          
BLAST of Triple functional domain protein vs. Ensembl Mouse
Match: Kalrn (kalirin, RhoGEF kinase [Source:MGI Symbol;Acc:MGI:2685385])

HSP 1 Score: 648.662 bits (1672), Expect = 0.000e+0
Identity = 408/1155 (35.32%), Postives = 628/1155 (54.37%), Query Frame = 3
Query:  486 LKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRY--GLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRL------------VEEDEKNHFKV-----------LLMQVQSDKETATDLLTERQVRLDLCLQLRLFE---ADVASAIDCLKHEVPTPMSYNFLNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGKSS----VQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFIRVKAEADELIHNFDEAG 3851
            LKA D+L +LK  +A + G RDKRGGP+L FPA S+ D +  EDL  LV YL  +P E+V K  F+V+IDMR G+ W  +KP+LK L+E          IIKP+ F++KQK    SSKF F+  +VS + L + +D SQLT+ FDG+L Y++EEWIE+R+ LE+FF  A  +  +   L + L RK+ P  V  S+R +++H  ++ K+++APV  L+ EG +L   +R   G + +N      +  + D+Q L+P++   + +L+  R HL   W   + +L+Q +QLRLFE D  +M +W++  + LFL  + +IG +   A DL  +H  F +N  +    ++R+  VA+ L+++GHYAS QI+  + +LD +WKSF  AL++RS +L +SA FH +AE FL+    W     +     G    +  L   I   Q L+++   A+ EV  DG+AL   L  P+  G+  SL A  +YS+       ++HEV    +R+E++  HR  RL  RL L +F++DV QVL W+  HGE FL + T VGKSL RA  L   H  FEEVA NT  NA+KL+ AA++L      DPEEI +    LE RIQ F + VE R+  LD++V FH HTK+L+ W   L++     ++   +++ V++ +++F  ++   LDA   V+KEG  L  +L              +   ++ K            +L Q+   +    +L  ER+++LD+ LQLR+FE    +V + +D    ++   M  N  N   L  +   L+  T   +A      EVIQ+G +L +    V     A G        +D A    E ++ L  +  +L +  ++ + +L+  L  R L+ + +QVL WI   + ML  + +  S+L+EAEQLQ EH++FQ  + + H  A+     AE  +Q                   + H     I       +  AE VA  WQ+L+   E++ KL+ A+  +YKTS+QV SVL SLE+EYRR EDWC          ++ ++  LLS+H EQKEAFLKAC LARR +E F+KY+ R     P  +S     +++V A + +L+ +E  VL  W  +K RLD+C  ++  +  A + +    E G
Sbjct:   12 LKASDVLPILKEKVAFVSGGRDKRGGPILTFPARSNHDRIRQEDLRKLVTYLASVPSEDVCKRGFTVIIDMR-GSKWDLIKPLLKTLQEAFPAEIHVALIIKPDNFWQKQKTNFGSSKFIFETSMVSVEGLTKLVDPSQLTEEFDGSLDYNHEEWIELRLSLEEFFNSAVHLLSRLEDLQEMLARKEFPVDVEGSRRLIDEHTQLKKKVLKAPVEELDREGQRLLQCIRCSDGFSGRN-----CIPGSADFQSLVPKITSLLDKLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAEKMFDWISHNKELFLQSHTEIGVSYQHALDLQTQHNHFAMNSMNAYVNINRIMSVASRLSEAGHYASQQIKQISTQLDQEWKSFAAALDERSTILAMSAVFHQKAEQFLSGVDAWCKMCSEG----GLPSEMQDLELAIHHHQSLYEQVTQAYTEVSQDGKALLDVLQRPLSPGNSESLTATANYSKAVHQVLDVVHEVLHHQRRLESIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHDDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYKAARHLEVRIQDFVRRVEQRKLLLDMSVSFHTHTKELWTWMEDLQKE-VLEDVCADSVDAVQELIKQFQQQQTATLDATLNVIKEGEDLIQQLRSAPPSLGEPTEARDSAMSNNKTPHSSSISHIESVLQQLDDAQVQMEELFHERKIKLDIFLQLRIFEQYTIEVTAELDAWNEDLLRQM--NDFNTEDLTLAEQRLQRHTERKLAMNNMTFEVIQQGQDLHQYIMEVQ----ASGIELICEKDLDLAAQVQELLEFLHEKQHELELNAEQTHKRLEQCLQLRHLQAEVKQVLGWIRNGESMLNASLVNASSLSEAEQLQREHEQFQLAIEKTHQSALQVQQKAEALLQ-------------------AGHYDADAI-------RECAEKVALHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYRRDEDWCGGRDKLGPAAEMDHVIPLLSKHLEQKEAFLKACTLARRNAEVFLKYIHRNNVSMPSVASHTRGPEQQVKAILSELLQRENRVLHFWTLKKRRLDQCQQYVVFERSAKQALDWIQETG 1123          

HSP 2 Score: 282.722 bits (722), Expect = 2.046e-75
Identity = 165/470 (35.11%), Postives = 256/470 (54.47%), Query Frame = 3
Query: 4230 KAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKID-FFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSF-GPIYEENQ-------------------------------------RTRMTSSTSDVARNADNIFYVLDDFTALEISQLSVQRNQRVQLIEQIGE---WASVRTICTNSDIVDDESTKVQGLVPASLLISVSTR 5513
            K+A+K+  ++ E++QTE  YV DL   L+TY   +  G+ +I  P  ++ ++ ++F NI+EI +FH ++FL E+ +Y+               LPED+GHCF+ +A+ F+ +YV Y  NK + NQ+++E    FF+E+          + N+I S+ IKPVQR+TKY + LK+L   C+ G  GEL +  EVML + K+ ND +H+  ++G  E+  L+  G+ IL D F VW+P+ +I+KGR+R +FLF++ LV +K+         Y YK+ +L +E  +TEH+EGD CKFALW+GR P   + + VLK  ++E KQ+W++ +RE +QERI    G + E  Q                                     RT   +  SD       +  VL DF+A   S+LS+Q  Q V+L+E+  E   W  VRT         + S   +GLVP+S L    +R
Sbjct: 1250 KSARKKEFIMAELLQTEKAYVRDLHECLETYLWEMTSGVEEI--PPGILNKEHIIFGNIQEIYDFHNNIFLKELEKYEQ--------------LPEDVGHCFVTWADKFQ-MYVTYCKNKPDSNQLILEHAGTFFDEIQQ-----RHGLANSISSYLIKPVQRVTKYQLLLKELLTCCEEGK-GELKDGLEVMLSVPKKANDAMHVSMLEGFDEN--LDVQGELILQDAFQVWDPKSLIRKGRERHLFLFEISLVFSKEIKDSSGHTKYVYKNKLLTSELGVTEHVEGDPCKFALWSGRTPS-SDNKTVLKASNIETKQEWIKNIREVIQERIIHLKGALKEPIQLPKTPAKLRNNSKRDGVEDGDSQGDGSSQPDTISIASRTSQNTVESDKLSGGCELTVVLQDFSAGHSSELSIQVGQTVELLERPSERPGWCLVRTT--------ERSPPQEGLVPSSALCISHSR 1685          

HSP 3 Score: 131.724 bits (330), Expect = 1.313e-29
Identity = 92/333 (27.63%), Postives = 165/333 (49.55%), Query Frame = 3
Query: 4230 KAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPED-IGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGS--AGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIK-KGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQ 5216
            KA + R+ ++NE++QTE  YV DL   ++ + K I E      +P+D+  ++ ++F NI +I ++HK  FL E+ +               C   +D +   FI++      IYV Y  NK     I+ E   +F E+       E   + T+  F IKP+QRITKY + LKD     +       ++ +A E+M  + KR ND ++L  ++G   +  L + G  +  D F V E    ++ + ++RRVFLF+  ++ ++          Y +K  I +    + ++++GD CKFAL           R++L+  + +I+Q WV+ + + ++
Sbjct: 1896 KALRGRMFVLNELVQTEKDYVKDLGIVVEGFMKRIEEK----GVPEDMRGKEKIVFGNIHQIYDWHKDFFLAELEK---------------CIQEQDRLAQLFIKHERKLH-IYVWYCQNKPRSEYIVAEYDAYFEEVKQ-----EINQRLTLSDFLIKPIQRITKYQLLLKDFLRYSEKAGLECSDIEKAVELMCLVPKRCNDMMNLGRLQGF--EGTLTAQGKLLQQDTFYVIELDAGMQSRTKERRVFLFEQIVIFSELLRKGSLTPGYMFKRSIKMNYLVLEDNVDGDPCKFALMNRET----SERVILQAANSDIQQAWVQDINQVLE 2197          

HSP 4 Score: 68.9366 bits (167), Expect = 1.257e-10
Identity = 83/385 (21.56%), Postives = 165/385 (42.86%), Query Frame = 3
Query: 1239 LIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQ--YITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEG-RKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNH-TKDL 2378
            L  QV++ ++ L+E +  L+   +    RLEQ  QLR  + ++ ++  W+     +      +   + S+A  L  EH QF +      +   ++   A  L  +GHY +  I+  A K+   W+     +EDR  ++  S +F+  +E   +     E   ++     G  + +    +  ++  L     E + A  + C+  R  A      + + ++ S+ +   ++ G  +    ++ E+     RV      + +RL      ++F     Q L W+ E GE +L   TS G++ +  ++L   + +F   A  T    + LI  AD  V + H    EI +  T +++  + F+  +   R +L+ A+G +    KDL
Sbjct:  839 LAAQVQELLEFLHEKQHELELNAEQTHKRLEQCLQLRHLQAEVKQVLGWIRNGESMLNASLVN-ASSLSEAEQLQREHEQFQLAIEKTHQSALQVQQKAEALLQAGHYDADAIRECAEKVALHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYRRDEDWCGGRDKLGPAAEMDHVIPLLSKHLEQKEAFLKACTLARRNAEVFLKYIHR-NNVSMPSVASHTRGPEQQVKAILSELLQRENRVLHFWTLKKRRLDQCQQYVVFERSAKQALDWIQETGEYYLSTHTSTGETTEETQELLKEYGEFRVPAKQTKEKVKLLIQLADSFVEKGHIHATEIRKWVTTVDKHYRDFSLRMGKYRYSLEKALGVNTEDNKDL 1221          
BLAST of Triple functional domain protein vs. Ensembl Mouse
Match: Kalrn (kalirin, RhoGEF kinase [Source:MGI Symbol;Acc:MGI:2685385])

HSP 1 Score: 647.121 bits (1668), Expect = 0.000e+0
Identity = 408/1155 (35.32%), Postives = 628/1155 (54.37%), Query Frame = 3
Query:  486 LKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRY--GLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRL------------VEEDEKNHFKV-----------LLMQVQSDKETATDLLTERQVRLDLCLQLRLFE---ADVASAIDCLKHEVPTPMSYNFLNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGKSS----VQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFIRVKAEADELIHNFDEAG 3851
            LKA D+L +LK  +A + G RDKRGGP+L FPA S+ D +  EDL  LV YL  +P E+V K  F+V+IDMR G+ W  +KP+LK L+E          IIKP+ F++KQK    SSKF F+  +VS + L + +D SQLT+ FDG+L Y++EEWIE+R+ LE+FF  A  +  +   L + L RK+ P  V  S+R +++H  ++ K+++APV  L+ EG +L   +R   G + +N      +  + D+Q L+P++   + +L+  R HL   W   + +L+Q +QLRLFE D  +M +W++  + LFL  + +IG +   A DL  +H  F +N  +    ++R+  VA+ L+++GHYAS QI+  + +LD +WKSF  AL++RS +L +SA FH +AE FL+    W     +     G    +  L   I   Q L+++   A+ EV  DG+AL   L  P+  G+  SL A  +YS+       ++HEV    +R+E++  HR  RL  RL L +F++DV QVL W+  HGE FL + T VGKSL RA  L   H  FEEVA NT  NA+KL+ AA++L      DPEEI +    LE RIQ F + VE R+  LD++V FH HTK+L+ W   L++     ++   +++ V++ +++F  ++   LDA   V+KEG  L  +L              +   ++ K            +L Q+   +    +L  ER+++LD+ LQLR+FE    +V + +D    ++   M  N  N   L  +   L+  T   +A      EVIQ+G +L +    V     A G        +D A    E ++ L  +  +L +  ++ + +L+  L  R L+ + +QVL WI   + ML  + +  S+L+EAEQLQ EH++FQ  + + H  A+     AE  +Q                   + H     I       +  AE VA  WQ+L+   E++ KL+ A+  +YKTS+QV SVL SLE+EYRR EDWC          ++ ++  LLS+H EQKEAFLKAC LARR +E F+KY+ R     P  +S     +++V A + +L+ +E  VL  W  +K RLD+C  ++  +  A + +    E G
Sbjct:   30 LKASDVLPILKEKVAFVSGGRDKRGGPILTFPARSNHDRIRQEDLRKLVTYLASVPSEDVCKRGFTVIIDMR-GSKWDLIKPLLKTLQEAFPAEIHVALIIKPDNFWQKQKTNFGSSKFIFETSMVSVEGLTKLVDPSQLTEEFDGSLDYNHEEWIELRLSLEEFFNSAVHLLSRLEDLQEMLARKEFPVDVEGSRRLIDEHTQLKKKVLKAPVEELDREGQRLLQCIRCSDGFSGRN-----CIPGSADFQSLVPKITSLLDKLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAEKMFDWISHNKELFLQSHTEIGVSYQHALDLQTQHNHFAMNSMNAYVNINRIMSVASRLSEAGHYASQQIKQISTQLDQEWKSFAAALDERSTILAMSAVFHQKAEQFLSGVDAWCKMCSEG----GLPSEMQDLELAIHHHQSLYEQVTQAYTEVSQDGKALLDVLQRPLSPGNSESLTATANYSKAVHQVLDVVHEVLHHQRRLESIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHDDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYKAARHLEVRIQDFVRRVEQRKLLLDMSVSFHTHTKELWTWMEDLQKE-VLEDVCADSVDAVQELIKQFQQQQTATLDATLNVIKEGEDLIQQLRSAPPSLGEPTEARDSAMSNNKTPHSSSISHIESVLQQLDDAQVQMEELFHERKIKLDIFLQLRIFEQYTIEVTAELDAWNEDLLRQM--NDFNTEDLTLAEQRLQRHTERKLAMNNMTFEVIQQGQDLHQYIMEV----QASGIELICEKDLDLAAQVQELLEFLHEKQHELELNAEQTHKRLEQCLQLRHLQAEVKQVLGWIRNGESMLNASLVNASSLSEAEQLQREHEQFQLAIEKTHQSALQVQQKAEALLQ-------------------AGHYDADAI-------RECAEKVALHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYRRDEDWCGGRDKLGPAAEMDHVIPLLSKHLEQKEAFLKACTLARRNAEVFLKYIHRNNVSMPSVASHTRGPEQQVKAILSELLQRENRVLHFWTLKKRRLDQCQQYVVFERSAKQALDWIQETG 1141          

HSP 2 Score: 265.003 bits (676), Expect = 2.018e-70
Identity = 133/342 (38.89%), Postives = 212/342 (61.99%), Query Frame = 3
Query: 4230 KAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKID-FFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEE 5252
            K+A+K+  ++ E++QTE  YV DL   L+TY   +  G+ +I  P  ++ ++ ++F NI+EI +FH ++FL E+ +Y+               LPED+GHCF+ +A+ F+ +YV Y  NK + NQ+++E    FF+E+          + N+I S+ IKPVQR+TKY + LK+L   C+ G  GEL +  EVML + K+ ND +H+  ++G  E+  L+  G+ IL D F VW+P+ +I+KGR+R +FLF++ LV +K+         Y YK+ +L +E  +TEH+EGD CKFALW+GR P   + + VLK  ++E KQ+W++ +RE +QERI       +E
Sbjct: 1268 KSARKKEFIMAELLQTEKAYVRDLHECLETYLWEMTSGVEEI--PPGILNKEHIIFGNIQEIYDFHNNIFLKELEKYEQ--------------LPEDVGHCFVTWADKFQ-MYVTYCKNKPDSNQLILEHAGTFFDEIQQ-----RHGLANSISSYLIKPVQRVTKYQLLLKELLTCCEEGK-GELKDGLEVMLSVPKKANDAMHVSMLEGFDEN--LDVQGELILQDAFQVWDPKSLIRKGRERHLFLFEISLVFSKEIKDSSGHTKYVYKNKLLTSELGVTEHVEGDPCKFALWSGRTPS-SDNKTVLKASNIETKQEWIKNIREVIQERIIHLKGALKE 1583          

HSP 3 Score: 65.855 bits (159), Expect = 8.954e-10
Identity = 83/385 (21.56%), Postives = 165/385 (42.86%), Query Frame = 3
Query: 1239 LIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQ--YITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEG-RKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNH-TKDL 2378
            L  QV++ ++ L+E +  L+   +    RLEQ  QLR  + ++ ++  W+     +      +   + S+A  L  EH QF +      +   ++   A  L  +GHY +  I+  A K+   W+     +EDR  ++  S +F+  +E   +     E   ++     G  + +    +  ++  L     E + A  + C+  R  A      + + ++ S+ +   ++ G  +    ++ E+     RV      + +RL      ++F     Q L W+ E GE +L   TS G++ +  ++L   + +F   A  T    + LI  AD  V + H    EI +  T +++  + F+  +   R +L+ A+G +    KDL
Sbjct:  857 LAAQVQELLEFLHEKQHELELNAEQTHKRLEQCLQLRHLQAEVKQVLGWIRNGESMLNASLVN-ASSLSEAEQLQREHEQFQLAIEKTHQSALQVQQKAEALLQAGHYDADAIRECAEKVALHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYRRDEDWCGGRDKLGPAAEMDHVIPLLSKHLEQKEAFLKACTLARRNAEVFLKYIHR-NNVSMPSVASHTRGPEQQVKAILSELLQRENRVLHFWTLKKRRLDQCQQYVVFERSAKQALDWIQETGEYYLSTHTSTGETTEETQELLKEYGEFRVPAKQTKEKVKLLIQLADSFVEKGHIHATEIRKWVTTVDKHYRDFSLRMGKYRYSLEKALGVNTEDNKDL 1239          
BLAST of Triple functional domain protein vs. UniProt/SwissProt
Match: sp|O75962|TRIO_HUMAN (Triple functional domain protein OS=Homo sapiens OX=9606 GN=TRIO PE=1 SV=2)

HSP 1 Score: 662.914 bits (1709), Expect = 0.000e+0
Identity = 403/1152 (34.98%), Postives = 633/1152 (54.95%), Query Frame = 3
Query:  486 LKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRLVEE----------DEKNHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFE---ADVASAIDCLKHEVPTPMSYNF------LNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGK----SSVQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFI---RVKAEADELIHNFDEAGVSS 3860
            +KA D+L +LK  +A L G RDKRGGP+L FPA S+ D +  EDL  L+ YL  +P E V K  F+V++DMR G+ W S+KP+LK+L+E    C     IIKP+ F++KQ+    SSKF F+  +VS + L + +D SQLT  FDG L Y++EEWIEIR+  ED+ + A  M  +   L   L +K++P+ +  ++  +E+H  ++ K+I+AP+  L+ EG KL   L+   +S++  + +  + N D Q L+P+V   + +L+  R HL   W   + +L+Q +QLRLFE D  +M +W+   + LFL  Y +IG +   A +L  +H  F +NC +V   ++R+  VAN L +SGHYAS QI+  A +L+ +WK+F  AL++RS +L +S+ FH +AE +++N   W  A  + ++       +  L   I   Q +++   +A+ EV  DG++L   L  P+  GS  SL A+ +YS+   H   ++HEV    +++E +  HR  RL  RL L +F++DV QVL W+  HGE FL + T VGKSL RA  L   H  FEEVA NT  NA+KL+ AA++L      DPEEI Q   +LE RIQ F + VE R+  LD++V FH H K+L+ W  +L++     ++   ++E V+D ++RF  +++  L     V+KEG  L  +L +              NH + +L Q+   +    +L  ER+++L+L LQLR+FE    D+ S ++    E+   M+ +F      + + RL    ++   +       I  G++++Q  +E+    ++ GV           + V D  E+  E+ Q L        +A ++    L+  +  R L+ + +QVL WI   + ML    +  S+L EAEQLQ EH++FQ  + + H  A+     AE  +Q   + +                             ++ AE VA  WQ+L+   E++ KL+ A+  +YKTS+QV SVL SLE+EY+R EDWC          +  ++  ++S+H EQKEAFLKAC LARR ++ F+KYL R     PG      + +++V   + +L  +E  VL  W  RK RLD+C  ++   R   +A E IH+  E  +S+
Sbjct:   60 MKAMDVLPILKEKVAYLSGGRDKRGGPILTFPARSNHDRIRQEDLRRLISYLACIPSEEVCKRGFTVIVDMR-GSKWDSIKPLLKILQESFPCCIHVALIIKPDNFWQKQRTNFGSSKFEFETNMVSLEGLTKVVDPSQLTPEFDGCLEYNHEEWIEIRVAFEDYISNATHMLSRLEELQDILAKKELPQDLEGARNMIEEHSQLKKKVIKAPIEDLDLEGQKL---LQRIQSSESFPKKNSGSGNADLQNLLPKVSTMLDRLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAEKMFDWITHNKGLFLNSYTEIGTSHPHAMELQTQHNHFAMNCMNVYVNINRIMSVANRLVESGHYASQQIRQIASQLEQEWKAFAAALDERSTLLDMSSIFHQKAEKYMSNVDSWCKACGEVDLP----SELQDLEDAIHHHQGIYEHITLAYSEVSQDGKSLLDKLQRPLTPGSSDSLTASANYSKAVHHVLDVIHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYQAAHQLEDRIQDFVRRVEQRKILLDMSVSFHTHVKELWTWLEELQKEL-LDDVYAESVEAVQDLIKRFGQQQQTTLQVTVNVIKEGEDLIQQLRDSAISSNKTPHNSSINHIETVLQQLDEAQSQMEELFQERKIKLELFLQLRIFERDAIDIISDLESWNDELSQQMN-DFDTEDLTIAEQRLQHHADKALTMNNLTFDVIHQGQDLLQYVNEV----QASGVELLCDRDVDMATRVQDLLEFLHEKQQELD-------LAAEQHRKHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEAMLQANHYDM--------------------------DMIRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAFLKACTLARRNADVFLKYLHRNSVNMPGMVTHIKAPEQQVKNILNELFQRENRVLHYWTMRKRRLDQCQQYVVFERSAKQALEWIHDNGEFYLST 1164          

HSP 2 Score: 275.789 bits (704), Expect = 1.844e-72
Identity = 158/471 (33.55%), Postives = 250/471 (53.08%), Query Frame = 3
Query: 4224 QEKAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKI-DFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEE-------------------------------------NQRTRMTSSTSDVARNADNIFYVLDDFTALEISQLSVQRNQRVQLIEQI---GEWASVRTICTNSDIVDDESTKVQGLVPASLLISVSTR 5513
            + K+A+++  ++ E+IQTE  YV DL   + TY   +  G+ +I  P  +V ++ ++F N++EI EFH ++FL E+ +Y+               LPED+GHCF+ +A+ F+ +YV Y  NK +  Q+++E    +F+E+          + N+I S+ IKPVQRITKY + LK+L   C+ G  GE+ +  EVML + KR ND +HL  ++G  E+  +ES G+ IL + F VW+P+ +I+KGR+R +FLF++ LV +K+      +  Y YKS +  +E  +TEH+EGD CKFALW GR  P  + ++VLK   +E KQ W++ +RE +QER        +E                                       RT   +  SD       +  V+ DFTA   ++L+++R Q V+++E+     +W  VRT         D S   +GLVP   L    +R
Sbjct: 1286 KRKSARRKEFIMAELIQTEKAYVRDLRECMDTYLWEMTSGVEEI--PPGIVNKELIIFGNMQEIYEFHNNIFLKELEKYEQ--------------LPEDVGHCFVTWADKFQ-MYVTYCKNKPDSTQLILEHAGSYFDEIQQ-----RHGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGK-GEIKDGLEVMLSVPKRANDAMHLSMLEGFDEN--IESQGELILQESFQVWDPKTLIRKGRERHLFLFEMSLVFSKEVKDSSGRSKYLYKSKLFTSELGVTEHVEGDPCKFALWVGRT-PTSDNKIVLKASSIENKQDWIKHIREVIQERTIHLKGALKEPIHIPKTAPATRQKGRRDGEDLDSQGDGSSQPDTISIASRTSQNTLDSDKLSGGCELTVVIHDFTACNSNELTIRRGQTVEVLERPHDKPDWCLVRTT--------DRSPAAEGLVPCGSLCIAHSR 1722          

HSP 3 Score: 127.487 bits (319), Expect = 1.585e-27
Identity = 97/358 (27.09%), Postives = 171/358 (47.77%), Query Frame = 3
Query: 4239 KKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGS--AGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWE-PRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIF----YQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEENQRTRMTSSTSDV 5291
            K+R +++ E+++TE  YV DL   ++ Y   + E      +P D+  +  ++F NI +I ++H+  FL E+ +              C   PE +G  F+++      +Y+ Y  NK +   I+ E ID F E +        Q+ + +    IKPVQRI KY + LKD        S    EL  A EVM  + +R ND +++  ++G   D  + + G  +L D F V +    ++ + R+RR+FLF+  ++ ++    D  K F    + +K+ I ++   + E++E D CKFAL T R   + E   +L      ++Q W+  + + +            ENQR  + + TS +
Sbjct: 1968 KRRHYVLQELVETERDYVRDLGYVVEGYMALMKED----GVPDDMKGKDKIVFGNIHQIYDWHRDFFLGELEK--------------CLEDPEKLGSLFVKHERRL-HMYIAYCQNKPKSEHIVSEYIDTFFEDLKQRLGHRLQLTDLL----IKPVQRIMKYQLLLKDFLKYSKKASLDTSELERAVEVMCIVPRRCNDMMNVGRLQGF--DGKIVAQGKLLLQDTFLVTDQDAGLLPRCRERRIFLFEQIVIFSEPL--DKKKGFSMPGFLFKNSIKVSCLCLEENVENDPCKFAL-TSRTGDVVET-FILHSSSPSVRQTWIHEINQIL------------ENQRNFLNALTSPI 2284          

HSP 4 Score: 87.4261 bits (215), Expect = 2.330e-15
Identity = 91/408 (22.30%), Postives = 168/408 (41.18%), Query Frame = 3
Query: 1263 VQQLYEYRAHLQHKWDAG----RSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETV--NSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELR 2465
            VQ L E+    Q + D      R  LEQ  QLR  + ++ ++  W+     + L        +  +A  L  EH QF        +   ++   A  +  + HY    I+  A K+   W+     +EDR  ++  S +F+  +E   +     E   K++    G  + +  NS   ++T +     E + A  + C+  R  A      + + S              +   ++++E++    RV      R +RL      ++F     Q L W++++GE +L   TS G S+Q  ++L   H +F+  A  T    + LI  AD    + H    EI +  T +++R + F+  +E  R +L+ A+G  + +    K            +++P +I G E +LR
Sbjct:  878 VQDLLEFLHEKQQELDLAAEQHRKHLEQCVQLRHLQAEVKQVLGWIRNGESM-LNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEAMLQANHYDMDMIRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAFLKACTLARRNADVFLKYLHRNSVNMPGMVTHIKAPEQQVKNILNELFQRENRVLHYWTMRKRRLDQCQQYVVFERSAKQALEWIHDNGEFYLSTHTSTGSSIQHTQELLKEHEEFQITAKQTKERVKLLIQLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRMEKYRTSLEKALGISSDSNKSSKSLQ--------LDIIPASIPGSEVKLR 1276          

HSP 5 Score: 63.1586 bits (152), Expect = 4.369e-8
Identity = 31/129 (24.03%), Postives = 62/129 (48.06%), Query Frame = 3
Query: 1248 QVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALE 1634
            QVK  + +L++    + H W   + RL+Q  Q  +FE    +  EW++     +L+ +   G +     +L  EH +F +     +E+V  L  +A+   + GH  +A+I+     +D  ++ F+  +E
Sbjct: 1108 QVKNILNELFQRENRVLHYWTMRKRRLDQCQQYVVFERSAKQALEWIHDNGEFYLSTHTSTGSSIQHTQELLKEHEEFQITAKQTKERVKLLIQLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRME 1236          
BLAST of Triple functional domain protein vs. UniProt/SwissProt
Match: sp|F1M0Z1|TRIO_RAT (Triple functional domain protein OS=Rattus norvegicus OX=10116 GN=Trio PE=1 SV=4)

HSP 1 Score: 661.759 bits (1706), Expect = 0.000e+0
Identity = 402/1152 (34.90%), Postives = 633/1152 (54.95%), Query Frame = 3
Query:  486 LKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRLVEE----------DEKNHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFE---ADVASAIDCLKHEVPTPMSYNF------LNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGK----SSVQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFI---RVKAEADELIHNFDEAGVSS 3860
            +KA D+L +LK  +A L G RDKRGGP+L FPA S+ D +  EDL  L+ YL  +P E V K  F+V++DMR G+ W S+KP+LK+L+E    C     IIKP+ F++KQ+    SSKF F+  +VS + L + +D SQLT  FDG L Y++EEWIEIR+  ED+ + A  M  +   L   L +K++P+ +  ++  +++H  ++ K+I+AP+  L+ EG KL   L+   +S++  + +  + N D Q L+P+V   + +L+  R HL   W   + +L+Q +QLRLFE D  +M +W+   + LFL  Y +IG +   A +L  +H  F +NC +V   ++R+  VAN L +SGHYAS QI+  A +L+ +WK+F  AL++RS +L +S+ FH +AE +++N   W  A  + ++       +  L   I   Q +++   +A+ EV  DG++L   L  P+  GS  SL A+ +YS+   H   ++HEV    +++E +  HR  RL  RL L +F++DV QVL W+  HGE FL + T VGKSL RA  L   H  FEEVA NT  NA+KL+ AA++L      DPEEI Q   +LE RIQ F + VE R+  LD++V FH H K+L+ W  +L++     ++   ++E V+D ++RF  +++  L     V+KEG  L  +L +              NH + +L Q+   +    +L  ER+++L+L LQLR+FE    D+ S ++    E+   M+ +F      + + RL    ++   +       I  G++++Q  +E+    ++ GV           + V D  E+  E+ Q L        +A ++    L+  +  R L+ + +QVL WI   + ML    +  S+L EAEQLQ EH++FQ  + + H  A+     AE  +Q   + +                             ++ AE VA  WQ+L+   E++ KL+ A+  +YKTS+QV SVL SLE+EY+R EDWC          +  ++  ++S+H EQKEAFLKAC LARR ++ F+KYL R     PG      + +++V   + +L  +E  VL  W  RK RLD+C  ++   R   +A E IH+  E  +S+
Sbjct:   60 MKAMDVLPILKEKVAYLSGGRDKRGGPILTFPARSNHDRMRQEDLRRLISYLACIPSEEVCKRGFTVIVDMR-GSKWDSIKPLLKILQESFPCCIHIALIIKPDNFWQKQRTNFGSSKFEFETNMVSLEGLTKVVDPSQLTPEFDGCLEYNHEEWIEIRVAFEDYISNAAHMLSRLEELQDVLAKKELPQDLEGARNMIDEHSQLKKKVIKAPIEDLDLEGQKL---LQRIQSSESFPKKNSGSGNADLQNLLPKVSTMLDRLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAEKMFDWITHNKGLFLNSYTEIGASHPHAMELQTQHNHFAMNCMNVYVNINRIMSVANRLVESGHYASQQIKQIANQLEQEWKAFAAALDERSTLLDMSSIFHQKAEKYMSNVDSWCKACGEVDLP----SELQDLEDAIHHHQGIYEHITLAYSEVSQDGKSLLDKLQRPLTPGSSDSLTASANYSKAVHHVLDVIHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYQAAHQLEDRIQDFVRRVEQRKILLDMSVSFHTHVKELWTWLEELQKEL-LDDVYAESVEAVQDLIKRFGQQQQTTLQVTVNVIKEGEDLIQQLRDSAISSNKTPHNSSINHIETVLQQLDEAQSQMEELFQERKIKLELFLQLRIFERDAIDIISDLESWNDELSQQMN-DFDTEDLTIAEQRLQHHADKALTMNNLTFDVIHQGQDLLQYVNEV----QASGVELLCDRDVDMATRVQDLLEFLHEKQQELD-------LAAEQHRKHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEAMLQANHYDM--------------------------DMIRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAFLKACTLARRNADVFLKYLHRNSVSMPGMVTHIKAPEQQVKNILNELFQRENRVLHYWTMRKRRLDQCQQYVVFERSAKQALEWIHDNGEFYLST 1164          

HSP 2 Score: 275.018 bits (702), Expect = 3.136e-72
Identity = 158/471 (33.55%), Postives = 250/471 (53.08%), Query Frame = 3
Query: 4224 QEKAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKI-DFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEE-------------------------------------NQRTRMTSSTSDVARNADNIFYVLDDFTALEISQLSVQRNQRVQLIEQI---GEWASVRTICTNSDIVDDESTKVQGLVPASLLISVSTR 5513
            + K+A+++  ++ E+IQTE  YV DL   + TY   +  G+ +I  P  +V ++ ++F N++EI EFH ++FL E+ +Y+               LPED+GHCF+ +A+ F+ +YV Y  NK +  Q+++E    +F+E+          + N+I S+ IKPVQRITKY + LK+L   C+ G  GE+ +  EVML + KR ND +HL  ++G  E+  +ES G+ IL + F VW+P+ +I+KGR+R +FLF++ LV +K+      +  Y YKS +  +E  +TEH+EGD CKFALW GR  P  + ++VLK   +E KQ W++ +RE +QER        +E                                       RT   +  SD       +  V+ DFTA   ++L+++R Q V+++E+     +W  VRT         D S   +GLVP   L    +R
Sbjct: 1286 KRKSARRKEFIMAELIQTEKAYVRDLRECMDTYLWEMTSGVEEI--PPGIVNKELIIFGNMQEIYEFHNNIFLKELEKYEQ--------------LPEDVGHCFVTWADKFQ-MYVTYCKNKPDSTQLILEHAGSYFDEIQQ-----RHGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGK-GEIKDGLEVMLSVPKRANDAMHLSMLEGFDEN--IESQGELILQESFQVWDPKTLIRKGRERHLFLFEMSLVFSKEVKDSSGRSKYLYKSKLFTSELGVTEHVEGDPCKFALWVGRT-PTSDNKIVLKASSIENKQDWIKHIREVIQERTVHLRGALKEPIHIPKTAPAARQKGRRDGEDLDSQGDGSSQPDTISIASRTSQNTLDSDKLSGGCELTVVIHDFTACNSNELTIRRGQTVEVLERPHDKPDWCLVRTT--------DRSPAAEGLVPCGSLCIAHSR 1722          

HSP 3 Score: 126.716 bits (317), Expect = 2.558e-27
Identity = 98/358 (27.37%), Postives = 171/358 (47.77%), Query Frame = 3
Query: 4239 KKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGS--AGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWE-PRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIF----YQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEENQRTRMTSSTSDV 5291
            K+R +++ E+++TE  YV DL   ++ Y   + E      +P D+  +  ++F NI +I ++H+  FL E+ +              C   PE +G  F+++      +Y+ Y  NK +   I+ E ID F E +        Q+ + +    IKPVQRI KY + LKD        S    EL +A EVM  + KR ND +++  ++G   D  + + G  +L D F V +    ++ + ++RRVFLF+  ++ ++    D  K F    + +K+ I ++   + E++E D CKFAL T R     E   +L      ++Q W+  + + +            ENQR  + + TS +
Sbjct: 1969 KRRHYVLQELVETERDYVRDLGCVVEGYMALMKED----GVPDDMKGKDKIVFGNIHQIYDWHRDFFLGELEK--------------CLEDPEKLGSLFVKHERRL-HMYIVYCQNKPKSEHIVSEYIDTFFEDLKQRLGHRLQLTDLL----IKPVQRIMKYQLLLKDFLKYSKKASLDTSELEKAVEVMCIVPKRCNDMMNVGRLQGF--DGKIVAQGKLLLQDTFLVTDQDAGLLPRCKERRVFLFEQIVIFSEPL--DKKKGFSMPGFLFKNSIKVSCLCLEENVESDPCKFAL-TSRTGDAVET-FILHSSSPSVRQTWIHEINQIL------------ENQRNFLNALTSPI 2285          

HSP 4 Score: 88.1965 bits (217), Expect = 1.457e-15
Identity = 91/408 (22.30%), Postives = 169/408 (41.42%), Query Frame = 3
Query: 1263 VQQLYEYRAHLQHKWDAG----RSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETV--NSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELR 2465
            VQ L E+    Q + D      R  LEQ  QLR  + ++ ++  W+     + L        +  +A  L  EH QF        +   ++   A  +  + HY    I+  A K+   W+     +EDR  ++  S +F+  +E   +     E   K++    G  + +  NS   ++T +     E + A  + C+  R  A      + + S +            +   ++++E++    RV      R +RL      ++F     Q L W++++GE +L   TS G S+Q  ++L   H +F+  A  T    + LI  AD    + H    EI +  T +++R + F+  +E  R +L+ A+G  + +    K            +++P +I G E +LR
Sbjct:  878 VQDLLEFLHEKQQELDLAAEQHRKHLEQCVQLRHLQAEVKQVLGWIRNGESM-LNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEAMLQANHYDMDMIRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAFLKACTLARRNADVFLKYLHRNSVSMPGMVTHIKAPEQQVKNILNELFQRENRVLHYWTMRKRRLDQCQQYVVFERSAKQALEWIHDNGEFYLSTHTSTGSSIQHTQELLKEHEEFQITAKQTKERVKLLIQLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRMEKYRTSLEKALGISSDSNKSSKSLQ--------LDIIPASIPGSEVKLR 1276          

HSP 5 Score: 63.1586 bits (152), Expect = 4.260e-8
Identity = 31/129 (24.03%), Postives = 62/129 (48.06%), Query Frame = 3
Query: 1248 QVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALE 1634
            QVK  + +L++    + H W   + RL+Q  Q  +FE    +  EW++     +L+ +   G +     +L  EH +F +     +E+V  L  +A+   + GH  +A+I+     +D  ++ F+  +E
Sbjct: 1108 QVKNILNELFQRENRVLHYWTMRKRRLDQCQQYVVFERSAKQALEWIHDNGEFYLSTHTSTGSSIQHTQELLKEHEEFQITAKQTKERVKLLIQLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRME 1236          
BLAST of Triple functional domain protein vs. UniProt/SwissProt
Match: sp|Q0KL02|TRIO_MOUSE (Triple functional domain protein OS=Mus musculus OX=10090 GN=Trio PE=1 SV=3)

HSP 1 Score: 658.677 bits (1698), Expect = 0.000e+0
Identity = 401/1152 (34.81%), Postives = 632/1152 (54.86%), Query Frame = 3
Query:  486 LKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRLVEE----------DEKNHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFE---ADVASAIDCLKHEVPTPMSYNF------LNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGK----SSVQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFI---RVKAEADELIHNFDEAGVSS 3860
            +KA D+L +LK  +A L G RDKRGGP+L FPA S+ D +  EDL  L+ YL  +P E V K  F+V++DMR G+ W S+KP+LK+L+E    C     IIKP+ F++KQ+    SSKF F+  +VS + L + +D SQLT  FDG L Y++EEWIEIR+  E++ + A  M  +   L   L +K++P+ +  ++  +++H  ++ K+I+AP+  L+ EG KL   L+   +S +  + +  + N D Q L+P+V   + +L+  R HL   W   + +L+Q +QLRLFE D  +M +W+   + LFL  Y +IG +   A +L  +H  F +NC +V   ++R+  VAN L +SGHYAS QI+  A +L+ +WK+F  AL++RS +L +S+ FH +AE +++N   W  A  + ++       +  L   I   Q +++   +A+ EV  DG++L   L  P+  GS  SL A+ +YS+   H   ++HEV    +++E +  HR  RL  RL L +F++DV QVL W+  HGE FL + T VGKSL RA  L   H  FEEVA NT  NA+KL+ AA++L      DPEEI Q   +LE RIQ F + VE R+  LD++V FH H K+L+ W  +L++     ++   ++E V+D ++RF  +++  L     V+KEG  L  +L +              NH + +L Q+   +    +L  ER+++L+L LQLR+FE    D+ S ++    E+   M+ +F      + + RL    ++   +       I  G++++Q  +E+    ++ GV           + V D  E+  E+ Q L        +A ++    L+  +  R L+ + +QVL WI   + ML    +  S+L EAEQLQ EH++FQ  + + H  A+     AE  +Q   + +                             ++ AE VA  WQ+L+   E++ KL+ A+  +YKTS+QV SVL SLE+EY+R EDWC          +  ++  ++S+H EQKEAFLKAC LARR ++ F+KYL R     PG      + +++V   + +L  +E  VL  W  RK RLD+C  ++   R   +A E IH+  E  +S+
Sbjct:   60 MKAMDVLPILKEKVAYLSGGRDKRGGPILTFPARSNHDRIRQEDLRRLISYLACIPSEEVCKRGFTVIVDMR-GSKWDSIKPLLKILQESFPCCIHIALIIKPDNFWQKQRTNFGSSKFEFETNMVSLEGLTKVVDPSQLTPEFDGCLEYNHEEWIEIRVAFEEYISNAAHMLSRLEELQDVLAKKELPQDLEGARNMIDEHSQLKKKVIKAPIEDLDLEGQKL---LQRIQSSDSFPKKNSGSGNADLQNLLPKVSTMLDRLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAEKMFDWITHNKGLFLNSYTEIGTSHPHAMELQTQHNHFAMNCMNVYVNINRIMSVANRLVESGHYASQQIKQIANQLEQEWKAFAAALDERSTLLDMSSIFHQKAEKYMSNVDSWCKACGEVDLP----SELQDLEDAIHHHQGIYEHITLAYSEVSQDGKSLLDKLQRPLTPGSSDSLTASANYSKAVHHVLDVIHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYQAAHQLEDRIQDFVRRVEQRKILLDMSVSFHTHVKELWTWLEELQKEL-LDDVYAESVEAVQDLIKRFGQQQQTTLQVTVNVIKEGEDLIQQLRDSAISSNKTPHNSSINHIETVLQQLDEAQSQMEELFQERKIKLELFLQLRIFERDAIDIISDLESWNDELSQQMN-DFDTEDLTIAEQRLQHHADKALTMNNLTFDVIHQGQDLLQYVNEV----QASGVELLCDRDVDMATRVQDLLEFLHEKQQELD-------LAAEQHRKHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEAMLQANHYDM--------------------------DMIRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAFLKACTLARRNADVFLKYLHRNSVSMPGMVTHIKAPEQQVKNILNELFQRENRVLHYWTMRKRRLDQCQQYVVFERSAKQALEWIHDNGEFYLST 1164          

HSP 2 Score: 274.633 bits (701), Expect = 3.713e-72
Identity = 158/471 (33.55%), Postives = 250/471 (53.08%), Query Frame = 3
Query: 4224 QEKAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKI-DFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEE-------------------------------------NQRTRMTSSTSDVARNADNIFYVLDDFTALEISQLSVQRNQRVQLIEQI---GEWASVRTICTNSDIVDDESTKVQGLVPASLLISVSTR 5513
            + K+A+++  ++ E+IQTE  YV DL   + TY   +  G+ +I  P  +V ++ ++F N++EI EFH ++FL E+ +Y+               LPED+GHCF+ +A+ F+ +YV Y  NK +  Q+++E    +F+E+          + N+I S+ IKPVQRITKY + LK+L   C+ G  GE+ +  EVML + KR ND +HL  ++G  E+  +ES G+ IL + F VW+P+ +I+KGR+R +FLF++ LV +K+      +  Y YKS +  +E  +TEH+EGD CKFALW GR  P  + ++VLK   +E KQ W++ +RE +QER        +E                                       RT   +  SD       +  V+ DFTA   ++L+++R Q V+++E+     +W  VRT         D S   +GLVP   L    +R
Sbjct: 1286 KRKSARRKEFIMAELIQTEKAYVRDLRECMDTYLWEMTSGVEEI--PPGIVNKELIIFGNMQEIYEFHNNIFLKELEKYEQ--------------LPEDVGHCFVTWADKFQ-MYVTYCKNKPDSTQLILEHAGSYFDEIQQ-----RHGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGK-GEIKDGLEVMLSVPKRANDAMHLSMLEGFDEN--IESQGELILQESFQVWDPKTLIRKGRERHLFLFEMSLVFSKEVKDSSGRSKYLYKSKLFTSELGVTEHVEGDPCKFALWVGRT-PTSDNKIVLKASSIENKQDWIKHIREVIQERTVHLRGALKEPIHIPKTAPAARQKGRRDGEDLDSQGDGSSQPDTISIASRTSQNTLDSDKLSGGCELTVVIHDFTACNSNELTIRRGQTVEVLERPHDKPDWCLVRTT--------DRSPAAEGLVPCGSLCIAHSR 1722          

HSP 3 Score: 127.102 bits (318), Expect = 1.891e-27
Identity = 99/358 (27.65%), Postives = 171/358 (47.77%), Query Frame = 3
Query: 4239 KKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGS--AGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWE-PRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIF----YQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEENQRTRMTSSTSDV 5291
            K+R +++ E+++TE  YV DL   ++ Y   + E      +P D+  +  ++F NI +I ++H+  FL E+ +              C   PE +G  F+++      +Y+ Y  NK +   I+ E ID F E +        Q+ + +    IKPVQRI KY + LKD        S    EL +A EVM  + KR ND +++  ++G   D  + + G  +L D F V +    ++ + ++RRVFLF+  ++ ++    D  K F    + +K+ I ++   + E++E D CKFAL T R     E   VL      ++Q W+  + + +            ENQR  + + TS +
Sbjct: 1968 KRRHYVLQELVETERDYVRDLGCVVEGYMALMKED----GVPDDMKGKDKIVFGNIHQIYDWHRDFFLGELEK--------------CLEDPEKLGSLFVKHERRL-HMYIVYCQNKPKSEHIVSEYIDTFFEDLKQRLGHRLQLTDLL----IKPVQRIMKYQLLLKDFLKYSKKASLDTSELEKAVEVMCIVPKRCNDMMNVGRLQGF--DGKIVAQGKLLLQDTFLVTDQDAGLLPRCKERRVFLFEQIVIFSEPL--DKKKGFSMPGFLFKNSIKVSCLCLEENVESDPCKFAL-TSRTGDAVET-FVLHSSSPSVRQTWIHEINQIL------------ENQRNFLNALTSPI 2284          

HSP 4 Score: 87.8113 bits (216), Expect = 1.481e-15
Identity = 91/408 (22.30%), Postives = 169/408 (41.42%), Query Frame = 3
Query: 1263 VQQLYEYRAHLQHKWDAG----RSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETV--NSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELR 2465
            VQ L E+    Q + D      R  LEQ  QLR  + ++ ++  W+     + L        +  +A  L  EH QF        +   ++   A  +  + HY    I+  A K+   W+     +EDR  ++  S +F+  +E   +     E   K++    G  + +  NS   ++T +     E + A  + C+  R  A      + + S +            +   ++++E++    RV      R +RL      ++F     Q L W++++GE +L   TS G S+Q  ++L   H +F+  A  T    + LI  AD    + H    EI +  T +++R + F+  +E  R +L+ A+G  + +    K            +++P +I G E +LR
Sbjct:  878 VQDLLEFLHEKQQELDLAAEQHRKHLEQCVQLRHLQAEVKQVLGWIRNGESM-LNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEAMLQANHYDMDMIRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAFLKACTLARRNADVFLKYLHRNSVSMPGMVTHIKAPEQQVKNILNELFQRENRVLHYWTMRKRRLDQCQQYVVFERSAKQALEWIHDNGEFYLSTHTSTGSSIQHTQELLKEHEEFQITAKQTKERVKLLIQLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRMEKYRTSLEKALGISSDSNKSSKSLQ--------LDIIPASIPGSEVKLR 1276          

HSP 5 Score: 63.1586 bits (152), Expect = 4.406e-8
Identity = 31/129 (24.03%), Postives = 62/129 (48.06%), Query Frame = 3
Query: 1248 QVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALE 1634
            QVK  + +L++    + H W   + RL+Q  Q  +FE    +  EW++     +L+ +   G +     +L  EH +F +     +E+V  L  +A+   + GH  +A+I+     +D  ++ F+  +E
Sbjct: 1108 QVKNILNELFQRENRVLHYWTMRKRRLDQCQQYVVFERSAKQALEWIHDNGEFYLSTHTSTGSSIQHTQELLKEHEEFQITAKQTKERVKLLIQLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRME 1236          
BLAST of Triple functional domain protein vs. UniProt/SwissProt
Match: sp|Q1LUA6|TRIO_DANRE (Triple functional domain protein OS=Danio rerio OX=7955 GN=trio PE=3 SV=1)

HSP 1 Score: 649.818 bits (1675), Expect = 0.000e+0
Identity = 397/1159 (34.25%), Postives = 638/1159 (55.05%), Query Frame = 3
Query:  486 LKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQT-------RSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRLVE----------EDEKNHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFE---ADVASAIDCLKHEVPTPMSYNF------LNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGKSS----VQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFI---RVKAEADELIHNFDEAGVSS 3860
            +KA ++L +LK  +A L G RDKRGGPVL FP+ ++ D +  EDL  L+ YL  +P E+V K  F+V++DMR G+ W S+KP+LK+L+E    C     IIKP+ F++KQ+    SSKF F+  +VS + L + +D SQLT  F+G+L Y++EEWIEIR+  EDF   A  +  +   +++ + RKD+P+ +  ++R +E+H +++ ++I+APV  ++ EG +L   ++   +  N+T       R      N D Q L+P++   +++L+  R +L   W   + +L+Q +QLRLFE D  +M +W+   + LFL  Y +IG     A +L  +H  F +NC +V   ++R+  V N L ++GHYAS QI+  + +L+ +WK+F  AL++RS +L++SA+FH + + +++N   W  A  + ++     E  ++++ +    Q L++    A+ EV  DG+AL   L  P+  GS  SL A+ +Y++   H   ++HEV    +++E +  HR  RL  RL L +F++DV QVL W+  HGE FL + T VGKSL RA  L   H  FEEVA NT  NA+KL+ AA++L      DPEEI Q   +LE RIQ F + VE R+  LD++V FH H K+L+ W  +L++     ++   ++E V+D ++RF  +++  L     V+KEG  L  +L +              NH + +L Q+   +    +L  ER+++L+L LQLR+FE    D+ S +D    E+   M+  F      L + RL    ++   +       I  G+E++Q  +E+    ++ GV           + V D  E+  E+ Q L        +A ++    L+  +  R L+ + +QVL WI   + ML    +  S+L EAEQLQ EH++FQ  + + H  A+     AE  +Q   + +                             ++ AE VA  WQ+L+   E++ KL+ A+  +YKTS+QV SVL SLE+EY+R EDWC          +  ++  ++S+H EQKEAFLKAC LARR ++ F+KY+ R     PG  S     +++V   + +L+ +E  VL  W  RK RLD+C  ++   R   +A E IH+  E  +S+
Sbjct:    1 MKAMEVLPILKEKVAFLSGGRDKRGGPVLTFPSRTNHDRIRHEDLRRLIAYLAGIPSEDVCKHGFTVIVDMR-GSKWDSIKPLLKILQESFPCCIHIALIIKPDNFWQKQRTNFGSSKFEFETTMVSLEGLSKVVDPSQLTADFEGSLDYNHEEWIEIRVAFEDFTGNARHLLARLEEMHETVTRKDLPQDLDGARRMIEEHAALKKRVIKAPVEEVDNEGQRLLQRIQSSESYANRTVPVPPGQREGQGQPNADTQGLVPRITALLEKLHSTRQNLHQSWHIRKLQLDQCFQLRLFEQDAEKMFDWIMHNKGLFLAGYTEIGNNHPHAMELQTQHNHFAMNCMNVYVNINRIMSVGNRLLEAGHYASQQIKQISGQLEQEWKAFAAALDERSALLEMSATFHQKCDQYMSNVDSWCKACGEVDLPSELQELEDAIHHH----QGLYEHITAAYSEVSQDGKALLDKLQRPLTPGSADSLTASANYTKAVNHVLDIIHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYQAAHQLEDRIQDFVRRVEQRKVLLDMSVAFHTHVKELWTWLEELQKEL-LDDVYAESVEAVQDLIKRFGQQQQTTLQFTVNVIKEGEDLIQQLRDLAISSNKTPHNSSINHIESVLQQLDEAQAQMEELFQERKIKLELFLQLRIFERDAIDIISDLDSWNEELSQQMN-EFDTEDLTLAEQRLQHHADKALTMNNLAFHVIHQGQELLQYVNEV----QASGVELLCDRDVDMATRVQDLLEFLHEKQQELD-------VAAEQHRRHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEALLQANHYDM--------------------------DMIRDCAENVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNCESDHVTPMISKHLEQKEAFLKACTLARRNADVFLKYMHRNSVSMPGMLSHVKAPEQQVKNILNELLQRENRVLHFWTMRKRRLDQCQQYVVFERSAKQALEWIHDTGEFYLST 1115          

HSP 2 Score: 276.174 bits (705), Expect = 1.328e-72
Identity = 154/470 (32.77%), Postives = 255/470 (54.26%), Query Frame = 3
Query: 4224 QEKAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKID-FFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEE------------------------------------NQRTRMTSSTSDVARNADNIFYVLDDFTALEISQLSVQRNQRVQLIEQI---GEWASVRTICTNSDIVDDESTKVQGLVPASLLISVSTR 5513
            + K+A+++  ++ E+IQTE  YV DL   + TY   +  G+ +I  P  +V ++ ++F N++++ EFH ++FL E+ +Y+               LPED+GHCF+ +A+ F+ +YV Y  NK +  Q+++E    +F+E+         ++ N+I S+ IKPVQRITKY + LK+L   C+ G  GE+ +  EVML + KR ND +HL  ++G  E+  +ES G+ IL + F VW+P+ +I+KGR+R +FLF++ L+ +K+    + +  Y YKS +  +E  +TEH+EGD CKFALW GR  P  + ++VLK   +E KQ W++ +RE +QER        +E                                      RT   +  SD       +  V+ DF A   ++L+++R Q V+++E++    +W  VRT         D S  ++GLVP ++L    +R
Sbjct: 1237 KRKSARRKDFIMAELIQTEKAYVRDLRECMDTYLWEMTSGVEEI--PPGIVNKEHIIFGNMQDLYEFHHNIFLKELEKYEQ--------------LPEDVGHCFVTWADKFQ-MYVNYCKNKPDSTQLILEHAGGYFDEIQQ-----RHRLANSISSYLIKPVQRITKYQLLLKELLTCCEEGK-GEIKDGLEVMLSVPKRANDAMHLSMLEGFDEN--IESQGELILQEAFQVWDPKTLIRKGRERHLFLFEMSLIFSKEVKDSNGRSKYIYKSKLFTSELGVTEHVEGDPCKFALWVGRT-PTSDNKIVLKASGIENKQDWIKHIREVIQERTVHLKGALKEPIHIPKASTAKHKGRRDGEDLDSQGDGSSQPDTISLASRTSQNTLDSDKLSGGCELTVVIHDFMAGNSNELTIRRGQTVEVLERLHDKPDWCLVRTT--------DRSPALEGLVPCAMLCIAHSR 1672          

HSP 3 Score: 125.946 bits (315), Expect = 4.140e-27
Identity = 96/334 (28.74%), Postives = 162/334 (48.50%), Query Frame = 3
Query: 4239 KKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKD---LCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPR-QIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIF----YQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQ 5216
            KKR +++ E+I+TE  YV DL   ++ Y   + E      +P D+  +  ++F NI++I ++HK  FL E+ +              C   P+ +G  F+++      +Y+ Y  NK +   I+ E ID + E +        Q    I    IKPVQRI KY + LKD         T S  EL +A EVM  + KR ND +++  ++G   D  + + G  +L D F V EP   ++ + ++RRVFLF+  ++ ++    D  + F    Y YK  I +    + + ++GD CKFAL T R     +   +L      ++Q W+  + + ++
Sbjct: 1919 KKRHYVLLELIETERDYVRDLSLVVEGYMARMRED----GVPDDMKGKDKIVFGNIQQIYDWHKDFFLGELEK--------------CLEDPDRLGPLFLKHERRL-HMYIVYCQNKPKSEHIVSEYIDTYFEDLKQRLGHRLQ----ITDLLIKPVQRIMKYQLLLKDFLKFSKKIGTDSI-ELEKAVEVMCIVPKRCNDMMNVGRLQGF--DGKIVAQGRLLLQDTFMVAEPEGGLLNRMKERRVFLFEQIVIFSEPL--DKKRGFSMPGYLYKYSIKVNCLGLEDSVDGDPCKFAL-TSRTSNSSKDAFILHSSHPGVRQVWMLQISQILE 2223          

HSP 4 Score: 60.077 bits (144), Expect = 4.027e-7
Identity = 31/129 (24.03%), Postives = 60/129 (46.51%), Query Frame = 3
Query: 1248 QVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALE 1634
            QVK  + +L +    + H W   + RL+Q  Q  +FE    +  EW++     +L+ +   G +     +L  EH  F +     +E+V  L  +A+   D GH  +A+I+     +D  ++ F+  ++
Sbjct: 1059 QVKNILNELLQRENRVLHFWTMRKRRLDQCQQYVVFERSAKQALEWIHDTGEFYLSTHTSTGSSIHHTQELLKEHEDFHITAKQTKERVKLLIQLADGFCDKGHSHAAEIKKWVTAVDKRYRDFSLRMD 1187          
BLAST of Triple functional domain protein vs. UniProt/SwissProt
Match: sp|A2CG49|KALRN_MOUSE (Kalirin OS=Mus musculus OX=10090 GN=Kalrn PE=1 SV=1)

HSP 1 Score: 648.662 bits (1672), Expect = 0.000e+0
Identity = 408/1155 (35.32%), Postives = 628/1155 (54.37%), Query Frame = 3
Query:  486 LKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRY--GLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRL------------VEEDEKNHFKV-----------LLMQVQSDKETATDLLTERQVRLDLCLQLRLFE---ADVASAIDCLKHEVPTPMSYNFLNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGKSS----VQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFIRVKAEADELIHNFDEAG 3851
            LKA D+L +LK  +A + G RDKRGGP+L FPA S+ D +  EDL  LV YL  +P E+V K  F+V+IDMR G+ W  +KP+LK L+E          IIKP+ F++KQK    SSKF F+  +VS + L + +D SQLT+ FDG+L Y++EEWIE+R+ LE+FF  A  +  +   L + L RK+ P  V  S+R +++H  ++ K+++APV  L+ EG +L   +R   G + +N      +  + D+Q L+P++   + +L+  R HL   W   + +L+Q +QLRLFE D  +M +W++  + LFL  + +IG +   A DL  +H  F +N  +    ++R+  VA+ L+++GHYAS QI+  + +LD +WKSF  AL++RS +L +SA FH +AE FL+    W     +     G    +  L   I   Q L+++   A+ EV  DG+AL   L  P+  G+  SL A  +YS+       ++HEV    +R+E++  HR  RL  RL L +F++DV QVL W+  HGE FL + T VGKSL RA  L   H  FEEVA NT  NA+KL+ AA++L      DPEEI +    LE RIQ F + VE R+  LD++V FH HTK+L+ W   L++     ++   +++ V++ +++F  ++   LDA   V+KEG  L  +L              +   ++ K            +L Q+   +    +L  ER+++LD+ LQLR+FE    +V + +D    ++   M  N  N   L  +   L+  T   +A      EVIQ+G +L +    V     A G        +D A    E ++ L  +  +L +  ++ + +L+  L  R L+ + +QVL WI   + ML  + +  S+L+EAEQLQ EH++FQ  + + H  A+     AE  +Q                   + H     I       +  AE VA  WQ+L+   E++ KL+ A+  +YKTS+QV SVL SLE+EYRR EDWC          ++ ++  LLS+H EQKEAFLKAC LARR +E F+KY+ R     P  +S     +++V A + +L+ +E  VL  W  +K RLD+C  ++  +  A + +    E G
Sbjct:   12 LKASDVLPILKEKVAFVSGGRDKRGGPILTFPARSNHDRIRQEDLRKLVTYLASVPSEDVCKRGFTVIIDMR-GSKWDLIKPLLKTLQEAFPAEIHVALIIKPDNFWQKQKTNFGSSKFIFETSMVSVEGLTKLVDPSQLTEEFDGSLDYNHEEWIELRLSLEEFFNSAVHLLSRLEDLQEMLARKEFPVDVEGSRRLIDEHTQLKKKVLKAPVEELDREGQRLLQCIRCSDGFSGRN-----CIPGSADFQSLVPKITSLLDKLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAEKMFDWISHNKELFLQSHTEIGVSYQHALDLQTQHNHFAMNSMNAYVNINRIMSVASRLSEAGHYASQQIKQISTQLDQEWKSFAAALDERSTILAMSAVFHQKAEQFLSGVDAWCKMCSEG----GLPSEMQDLELAIHHHQSLYEQVTQAYTEVSQDGKALLDVLQRPLSPGNSESLTATANYSKAVHQVLDVVHEVLHHQRRLESIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHDDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYKAARHLEVRIQDFVRRVEQRKLLLDMSVSFHTHTKELWTWMEDLQKE-VLEDVCADSVDAVQELIKQFQQQQTATLDATLNVIKEGEDLIQQLRSAPPSLGEPTEARDSAMSNNKTPHSSSISHIESVLQQLDDAQVQMEELFHERKIKLDIFLQLRIFEQYTIEVTAELDAWNEDLLRQM--NDFNTEDLTLAEQRLQRHTERKLAMNNMTFEVIQQGQDLHQYIMEVQ----ASGIELICEKDLDLAAQVQELLEFLHEKQHELELNAEQTHKRLEQCLQLRHLQAEVKQVLGWIRNGESMLNASLVNASSLSEAEQLQREHEQFQLAIEKTHQSALQVQQKAEALLQ-------------------AGHYDADAI-------RECAEKVALHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYRRDEDWCGGRDKLGPAAEMDHVIPLLSKHLEQKEAFLKACTLARRNAEVFLKYIHRNNVSMPSVASHTRGPEQQVKAILSELLQRENRVLHFWTLKKRRLDQCQQYVVFERSAKQALDWIQETG 1123          

HSP 2 Score: 282.722 bits (722), Expect = 1.431e-74
Identity = 165/470 (35.11%), Postives = 256/470 (54.47%), Query Frame = 3
Query: 4230 KAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKID-FFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSF-GPIYEENQ-------------------------------------RTRMTSSTSDVARNADNIFYVLDDFTALEISQLSVQRNQRVQLIEQIGE---WASVRTICTNSDIVDDESTKVQGLVPASLLISVSTR 5513
            K+A+K+  ++ E++QTE  YV DL   L+TY   +  G+ +I  P  ++ ++ ++F NI+EI +FH ++FL E+ +Y+               LPED+GHCF+ +A+ F+ +YV Y  NK + NQ+++E    FF+E+          + N+I S+ IKPVQR+TKY + LK+L   C+ G  GEL +  EVML + K+ ND +H+  ++G  E+  L+  G+ IL D F VW+P+ +I+KGR+R +FLF++ LV +K+         Y YK+ +L +E  +TEH+EGD CKFALW+GR P   + + VLK  ++E KQ+W++ +RE +QERI    G + E  Q                                     RT   +  SD       +  VL DF+A   S+LS+Q  Q V+L+E+  E   W  VRT         + S   +GLVP+S L    +R
Sbjct: 1250 KSARKKEFIMAELLQTEKAYVRDLHECLETYLWEMTSGVEEI--PPGILNKEHIIFGNIQEIYDFHNNIFLKELEKYEQ--------------LPEDVGHCFVTWADKFQ-MYVTYCKNKPDSNQLILEHAGTFFDEIQQ-----RHGLANSISSYLIKPVQRVTKYQLLLKELLTCCEEGK-GELKDGLEVMLSVPKKANDAMHVSMLEGFDEN--LDVQGELILQDAFQVWDPKSLIRKGRERHLFLFEISLVFSKEIKDSSGHTKYVYKNKLLTSELGVTEHVEGDPCKFALWSGRTPS-SDNKTVLKASNIETKQEWIKNIREVIQERIIHLKGALKEPIQLPKTPAKLRNNSKRDGVEDGDSQGDGSSQPDTISIASRTSQNTVESDKLSGGCELTVVLQDFSAGHSSELSIQVGQTVELLERPSERPGWCLVRTT--------ERSPPQEGLVPSSALCISHSR 1685          

HSP 3 Score: 131.724 bits (330), Expect = 9.182e-29
Identity = 92/333 (27.63%), Postives = 165/333 (49.55%), Query Frame = 3
Query: 4230 KAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPED-IGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGS--AGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIK-KGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQ 5216
            KA + R+ ++NE++QTE  YV DL   ++ + K I E      +P+D+  ++ ++F NI +I ++HK  FL E+ +               C   +D +   FI++      IYV Y  NK     I+ E   +F E+       E   + T+  F IKP+QRITKY + LKD     +       ++ +A E+M  + KR ND ++L  ++G   +  L + G  +  D F V E    ++ + ++RRVFLF+  ++ ++          Y +K  I +    + ++++GD CKFAL           R++L+  + +I+Q WV+ + + ++
Sbjct: 1896 KALRGRMFVLNELVQTEKDYVKDLGIVVEGFMKRIEEK----GVPEDMRGKEKIVFGNIHQIYDWHKDFFLAELEK---------------CIQEQDRLAQLFIKHERKLH-IYVWYCQNKPRSEYIVAEYDAYFEEVKQ-----EINQRLTLSDFLIKPIQRITKYQLLLKDFLRYSEKAGLECSDIEKAVELMCLVPKRCNDMMNLGRLQGF--EGTLTAQGKLLQQDTFYVIELDAGMQSRTKERRVFLFEQIVIFSELLRKGSLTPGYMFKRSIKMNYLVLEDNVDGDPCKFALMNRET----SERVILQAANSDIQQAWVQDINQVLE 2197          

HSP 4 Score: 68.9366 bits (167), Expect = 8.793e-10
Identity = 83/385 (21.56%), Postives = 165/385 (42.86%), Query Frame = 3
Query: 1239 LIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQ--YITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEG-RKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNH-TKDL 2378
            L  QV++ ++ L+E +  L+   +    RLEQ  QLR  + ++ ++  W+     +      +   + S+A  L  EH QF +      +   ++   A  L  +GHY +  I+  A K+   W+     +EDR  ++  S +F+  +E   +     E   ++     G  + +    +  ++  L     E + A  + C+  R  A      + + ++ S+ +   ++ G  +    ++ E+     RV      + +RL      ++F     Q L W+ E GE +L   TS G++ +  ++L   + +F   A  T    + LI  AD  V + H    EI +  T +++  + F+  +   R +L+ A+G +    KDL
Sbjct:  839 LAAQVQELLEFLHEKQHELELNAEQTHKRLEQCLQLRHLQAEVKQVLGWIRNGESMLNASLVN-ASSLSEAEQLQREHEQFQLAIEKTHQSALQVQQKAEALLQAGHYDADAIRECAEKVALHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYRRDEDWCGGRDKLGPAAEMDHVIPLLSKHLEQKEAFLKACTLARRNAEVFLKYIHR-NNVSMPSVASHTRGPEQQVKAILSELLQRENRVLHFWTLKKRRLDQCQQYVVFERSAKQALDWIQETGEYYLSTHTSTGETTEETQELLKEYGEFRVPAKQTKEKVKLLIQLADSFVEKGHIHATEIRKWVTTVDKHYRDFSLRMGKYRYSLEKALGVNTEDNKDL 1221          
BLAST of Triple functional domain protein vs. TrEMBL
Match: A0A4V6RGT3 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009074 PE=4 SV=1)

HSP 1 Score: 1635.93 bits (4235), Expect = 0.000e+0
Identity = 907/1898 (47.79%), Postives = 1222/1898 (64.38%), Query Frame = 3
Query:  486 LKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQT----------------------------RSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAHDPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRLVEEDEKNHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFEADVASAIDCLKHEVP-----------------------TPMS---YNFLNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGKSSVQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFIRVKAEADELIHNFDEAG--VSSPKLD---EIYKRLIHNLESKNLNQHTEVIK-LIRNRLNLRFAN----QYLLKPNQVQTGQPGQAVPT-----TGQLIGQ---------SQPAKLRTQLSSGSNYGSGDLNRXXXXXXXXXXXXXXXXXXX-------XXXXXXXXXXXQIQEKAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGIS--DIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNH--DDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEENQRTRMTSSTSDVARNAD--NIFYVLDDFTALEISQLSVQRNQRVQLIEQI-----------------------GEWASVRTICTNSDIVDDESTKV-QGLVPASLLISVSTRRYLVDDKSINGSSMKKWL---RDRRHG------PVRRGSKVE-------SQXXXXXXXXXXXXXXXXXXXASSDINIENNLLDNVSEESVDVELPPPMA-LQEFPVV 5783
            L+A+D + LL+  IALLPG R ++GGP+LCFP+NS A ++  +DL +LV YLT+LPDE+VKK  FSV++DMR GTTW++VKPIL+ +E+C+    +  +IIKP+ FFEK KA M   KF F+IQ+VS   L +E+D SQLT   +GTLPY +EEWI+IR C+E+FF  A DM D+F  L+  L RK   +TV  +K  +E+H+S+R KI+QAPV  +EAE D+L  WL +G+ +   T                             +SWV+MNPD+Q+LIPQV++T   L E+R HLQ KW+  RS LEQIYQLRLFE+D  RM+ WL Q+RHLFLTE+ DIGQTA  AADL AEHRQF+  CS   + V+RL GVA +L D GH+AS QI  QA +++H+WKSF +ALEDRS VL LSASFH+RA+AFLANCP+  TAM+Q N       TV+ LNQ + TLQ  WQEA+ AH EVC DG+AL  HLS+PVP GSHTSL AAVDYS+GRKHCT L+HE+W   K +E V   R  RL +RL+LLMF+EDV QVLAWL EHGEPFL RQT+VGKS+QRAEQLYN HMQFE+VAA TL+NAEKLI  ADEL +QA DPEE+LQ   EL  RI AFT+AVE RR T+DL  GF+NHTK++  W H +KE+HN  E LP TIEG+EDEL  FH ++  I + AD+V  EG TL SRL + +E  H + +L QV S++ T + LL ERQVRLDLCLQLRLFEADV SA+DCL+H +P                       +P+S   + +L DPR A  +  LEE+++ F++ + + EEV+ KG EL RAFES+GVNFPAGG GS+DSGV DSAE A+ER+ RLS EL ++V  VDE+N K+  EL+WRRLEQQS+QVL  ISQC++M+R TA++P+NL+EA+ LQ EH+KFQP+LNEAHP+AV CA+ A + + Q +        S++    SST   ++  + RRK+ + + E V + WQKLVYAAE++HKLL+AA NWYKTSDQVTSVL SLEKEYRR EDWCQNEKA S  D   YL  L  +H EQKEAFLKAC+LARRTS+ F +YL RQ   TPG+  V+EK+  ++ +LM KEQAVL+AWA R+ RLD+C+ FI +K   +EL+    +    + SP  D    +  +L  +L  + +N+  E ++ +I   + L   +    + LLK  Q    QP  +  T     +GQ + Q         S PA + ++L         D +    S + + SS   S +T        +G ++ ++G +Q Q +  ++R +L++E+IQTE  YV  LE  L TY + +    S  ++K+P  L    +VLF N+  + EFHK  F PE+ +Y       TE+     FLPED+GHCF+ Y+     +YV Y  N  E  ++ +E+   F  ++   F+    +   + S+ IKPVQR+TKY + L++L + CD  S  EL+E  E ML++ KR ND +HL  + GLP+D P+ SLGD IL D FTVWEP+Q+IKK R+RRVFLFD CL+L K+ +    ++K  Y YKS +LL ECNITEHIEGDQCKFALWTGRVPP+ EYR+VLK   L++KQ WVRALRE M+ER+FS   +Y+ +Q++  T  T  ++ +A+  +  Y+L+++ A   ++LSV  +Q VQ++ +                        GEWA +R +   +       + + +G +PA L+ + S RR          +S ++WL    D R G      P +RGSK +                 ++ +      + ++ ++I + +LDNVSEES+DVELPPPM  LQ  P  
Sbjct:  161 LRARDHVKLLREKIALLPGGRSRQGGPLLCFPSNSRAHDIPYDDLCLLVCYLTYLPDESVKKAGFSVIVDMRNGTTWNNVKPILRAVEQCVVPNVAITYIIKPDNFFEKHKANMQIGKFNFEIQLVSLATLFREVDPSQLTAELEGTLPYHHEEWIKIRCCVEEFFFSAQDMMDQFGHLFNLLKRKLDLDTVERAKLALEEHRSLRSKIVQAPVSAIEAEADRLTTWLLFGMTAATVTSTNAGGSQSFPASTSAMNAAGAGGASFLSTSWVSMNPDFQKLIPQVRRTFTTLNEFRTHLQQKWEDVRSHLEQIYQLRLFEEDANRMATWLGQRRHLFLTEHVDIGQTACHAADLLAEHRQFVEACSAAFDTVARLNGVARILADVGHFASQQILKQAAQIEHEWKSFVSALEDRSQVLCLSASFHARAQAFLANCPNRATAMQQVN-----GNTVHELNQALLTLQNYWQEAQTAHMEVCVDGKALTDHLSAPVPTGSHTSLTAAVDYSQGRKHCTDLVHEIWDRLKLLERVYNERRTRLNSRLTLLMFKEDVGQVLAWLTEHGEPFLHRQTAVGKSIQRAEQLYNTHMQFEQVAATTLLNAEKLISVADELAAQADDPEEVLQRANELLTRISAFTQAVEARRETVDLGCGFYNHTKEVIAWLHAVKESHNTGEHLPATIEGMEDELTNFHRDRSAIEEGADRVATEGETLISRLKDTEEVTHIRSVLAQVASERSTVSALLMERQVRLDLCLQLRLFEADVNSALDCLRHGIPSFSQLLANRNEANSLLNATATTQSPVSSSQFAWLADPRQAPDIASLEELSSIFMSVLPAAEEVLNKGGELIRAFESLGVNFPAGGPGSSDSGVGDSAETAMERVHRLSNELAEVVSFVDELNEKINGELEWRRLEQQSKQVLLRISQCEDMMRDTAIIPANLSEAQSLQTEHEKFQPVLNEAHPRAVQCASKASLLLHQTA-----NYSSSSGLLSSSTGGSSTMEHPRRKDFRAVGEAVTEHWQKLVYAAEDRHKLLVAATNWYKTSDQVTSVLWSLEKEYRREEDWCQNEKAMS--DTAGYLNQLSMKHAEQKEAFLKACMLARRTSDLFSRYLHRQSPTTPGRKEVEEKMRTAMSELMAKEQAVLEAWAVRRRRLDDCIYFINIKGRVEELLTRVQQQSSLMHSPSKDIGMTVSSQLASSL-CQEVNRACESLESMIAASMPLSPGHTTQLRSLLKRLQSTLPQPSPSTATAKLSVSGQDVSQKPQGEQRKLSAPASVTSRLDIAPRPKRPDTDTDRTSVSSTSSSGAGSTSTGASDVFLGSGSAASATGPTQEQRRMIRRRENLLHELIQTERSYVQALEQCLATYKQGLLNPPSWPELKVPPGLSDMVNVLFGNMPALFEFHKQTFEPELGKY-------TESGD---FLPEDVGHCFVVYSERLADLYVDYCVNYTESTRLYIEQGQAFFSVIQRYFN----LTEPLPSYLIKPVQRVTKYQLLLRELRDCCDPASVAELNEGLEAMLDVPKRANDALHLSMLHGLPDDLPIHSLGDVILQDQFTVWEPKQLIKKSRERRVFLFDNCLILAKEASTQPGEHKAKYHYKSRLLLAECNITEHIEGDQCKFALWTGRVPPIHEYRMVLKASSLDLKQTWVRALREGMRERMFSVQSLYQHHQQSASTGKTGVLSEDAELLDTHYILENYQASRPNELSVSAHQIVQVLHRCDTPNLPLAEPGSTDSVKLDPHASGEWAYIRMLVQGTGTTTTTQSPIKEGFIPARLIGAPSGRRSSTTRNRSANASGRRWLLAGSDVRRGAGSGLVPGKRGSKADLNQTQGFPTPYPTATPRVLSTDRQPPKLNATPVDIGSTILDNVSEESIDVELPPPMTELQVLPTT 2031          

HSP 2 Score: 92.4337 bits (228), Expect = 1.776e-14
Identity = 58/197 (29.44%), Postives = 94/197 (47.72%), Query Frame = 3
Query: 6423 PQILDLPGNGDEKLLGELRLSDDMNVAGRLWSPS-------------DDEMV-----EDVTYNFISRRLLLYETGLILINEVLETCPSINSDLNSNSMPSVVRC--KHILSLARLSIKEDVDMSEGRRSANKLLWFCLYEEVSSN-------------------------QSVLCHIIDPITPDVRARWLTELTQMI 6878
            P ++ LP   +   LG+LRL   +NVA +L +               D+EM+     E    +F+SR L LY+  L++ +  +E  P+   + NS +    ++C  +H L ++++SI EDV     + ++ +LLWFCL E   +                          QS LC+++ P +PD R RWLTELT M+
Sbjct: 2110 PSLVGLPVGANLSGLGDLRLHGGLNVAAKLVAGPRPVATGSQSTVGPDEEMLRGVFDEGAELHFVSRYLFLYDQALVIADAAVELLPT--DEENSPTSRRRLQCQFRHALPISQISIMEDVGAPGSKPTSEQLLWFCLSERARTTVSTSPLDSAGGGGNHSNSPPPPSSAQSYLCYVVAPRSPDTRVRWLTELTAMV 2304          
BLAST of Triple functional domain protein vs. TrEMBL
Match: H2KVC7 (Kalirin OS=Clonorchis sinensis OX=79923 GN=CLF_111888 PE=4 SV=1)

HSP 1 Score: 1635.93 bits (4235), Expect = 0.000e+0
Identity = 908/1904 (47.69%), Postives = 1223/1904 (64.23%), Query Frame = 3
Query:  486 LKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQT----------------------------RSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAHDPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRLVEEDEKNHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFEADVASAIDCLKHEVP-----------------------TPMS---YNFLNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGKSSVQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFIRVKAEADELIHNFDEAG--VSSPKLD---EIYKRLIHNLESKNLNQHTEVIK-LIRNRLNLRFAN----QYLLKPNQVQTGQPGQAVPT-----TGQLIGQ---------SQPAKLRTQLSSGSNYGSGDLNRXXXXXXXXXXXXXXXXXX-------XXXXXXXXXXXXQIQEKAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGIS--DIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNH--DDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEENQRTRMTSSTSDVARNAD--NIFYVLDDFTALEISQLSVQRNQRVQLIEQI-----------------------------GEWASVRTICTNSDIVDDESTKV-QGLVPASLLISVSTRRYLVDDKSINGSSMKKWL---RDRRHG------PVRRGSKVE-------SQXXXXXXXXXXXXXXXXXXXASSDINIENNLLDNVSEESVDVELPPPMA-LQEFPVV 5783
            L+A+D + LL+  IALLPG R ++GGP+LCFP+NS A ++  +DL +LV YLT+LPDE+VKK  FSV++DMR GTTW++VKPIL+ +E+C+    +  +IIKP+ FFEK KA M   KF F+IQ+VS   L +E+D SQLT   +GTLPY +EEWI+IR C+E+FF  A DM D+F  L+  L RK   +TV  +K  +E+H+S+R KI+QAPV  +EAE D+L  WL +G+ +   T                             +SWV+MNPD+Q+LIPQV++T   L E+R HLQ KW+  RS LEQIYQLRLFE+D  RM+ WL Q+RHLFLTE+ DIGQTA  AADL AEHRQF+  CS   + V+RL GVA +L D GH+AS QI  QA +++H+WKSF +ALEDRS VL LSASFH+RA+AFLANCP+  TAM+Q N       TV+ LNQ + TLQ  WQEA+ AH EVC DG+AL  HLS+PVP GSHTSL AAVDYS+GRKHCT L+HE+W   K +E V   R  RL +RL+LLMF+EDV QVLAWL EHGEPFL RQT+VGKS+QRAEQLYN HMQFE+VAA TL+NAEKLI  ADEL +QA DPEE+LQ   EL  RI AFT+AVE RR T+DL  GF+NHTK++  W H +KE+HN  E LP TIEG+EDEL  FH ++  I + AD+V  EG TL SRL + +E  H + +L QV S++ T + LL ERQVRLDLCLQLRLFEADV SA+DCL+H +P                       +P+S   + +L DPR A  +  LEE+++ F++ + + EEV+ KG EL RAFES+GVNFPAGG GS+DSGV DSAE A+ER+ RLS EL ++V  VDE+N K+  EL+WRRLEQQS+QVL  ISQC++M+R TA++P+NL+EA+ LQ EH+KFQP+LNEAHP+AV CA+ A + + Q +        S++    SST   ++  + RRK+ + + E V + WQKLVYAAE++HKLL+AA NWYKTSDQVTSVL SLEKEYRR EDWCQNEKA S  D   YL  L  +H EQKEAFLKAC+LARRTS+ F +YL RQ   TPG+  V+EK+  ++ +LM KEQAVL+AWA R+ RLD+C+ FI +K   +EL+    +    + SP  D    +  +L  +L  + +N+  E ++ +I   + L   +    + LLK  Q    QP  +  T     +GQ + Q         S PA + ++L   S     D +    S + + SS   S +T        +G ++ ++G +Q Q +  ++R +L++E+IQTE  YV  LE  L TY + +    S  ++K+P  L    +VLF N+  + EFHK  F PE+ +Y       TE+     FLPED+GHCF+ Y+     +YV Y  N  E  ++ +E+   F  ++   F+    +   + S+ IKPVQR+TKY + L++L + CD  S  EL+E  E ML++ KR ND +HL  + GLP+D P+ SLGD IL D FTVWEP+Q+IKK R+RRVFLFD CL+L K+ +    ++K  Y YKS +LL ECNITEHIEGDQCKFALWTGRVPP+ EYR+VLK   L++KQ WVRALRE M+ER+FS   +Y+ +Q++  T  T  ++ +A+  +  Y+L+++ A   ++LSV  +Q VQ++ +                              GEWA +R +   +       + + +G +PA L+ + S RR          +S ++WL    D R G      P +RGSK +                 ++ +      + ++ ++I + +LDNVSEES+DVELPPPM  LQ  P  
Sbjct:  161 LRARDHVKLLREKIALLPGGRSRQGGPLLCFPSNSRAHDIPYDDLCLLVCYLTYLPDESVKKAGFSVIVDMRNGTTWNNVKPILRAVEQCVVPNVAITYIIKPDNFFEKHKANMQIGKFNFEIQLVSLATLFREVDPSQLTAELEGTLPYHHEEWIKIRCCVEEFFFSAQDMMDQFGHLFNLLKRKLDLDTVERAKLALEEHRSLRSKIVQAPVSAIEAEADRLTTWLLFGMTAATVTSTNAGGSQSFPASASAMNAASAGGASFLSTSWVSMNPDFQKLIPQVRRTFTTLNEFRTHLQQKWEDVRSHLEQIYQLRLFEEDANRMATWLGQRRHLFLTEHVDIGQTACHAADLLAEHRQFVEACSAAFDTVARLNGVARILADVGHFASQQILKQAAQIEHEWKSFVSALEDRSQVLCLSASFHARAQAFLANCPNRATAMQQVN-----GNTVHELNQALLTLQNYWQEAQTAHMEVCVDGKALTDHLSAPVPTGSHTSLTAAVDYSQGRKHCTDLVHEIWDRLKLLERVYNERRTRLNSRLTLLMFKEDVGQVLAWLTEHGEPFLHRQTAVGKSIQRAEQLYNTHMQFEQVAATTLLNAEKLISVADELAAQADDPEEVLQRANELLTRISAFTQAVEARRETVDLGCGFYNHTKEVIAWLHAVKESHNTGEHLPATIEGMEDELTNFHRDRSAIEEGADRVATEGETLISRLKDTEEVTHIRSVLAQVASERSTVSALLMERQVRLDLCLQLRLFEADVNSALDCLRHGIPSFSQLLANRNEANSLLNATATTQSPVSSSQFAWLADPRQAPDIASLEELSSVFMSVLPAAEEVLNKGGELIRAFESLGVNFPAGGPGSSDSGVGDSAETAMERVHRLSNELAEVVTFVDELNEKINGELEWRRLEQQSKQVLLRISQCEDMMRDTAIIPANLSEAQSLQTEHEKFQPVLNEAHPRAVQCASKASLLLHQTA-----NYSSSSGLLSSSTGGSSAMEHPRRKDFRAVGEAVTEHWQKLVYAAEDRHKLLVAATNWYKTSDQVTSVLWSLEKEYRREEDWCQNEKAMS--DTAGYLNQLSMKHAEQKEAFLKACMLARRTSDLFSRYLHRQSPTTPGRKEVEEKMRTAMSELMAKEQAVLEAWAVRRRRLDDCIYFINIKGRVEELLTRVQQQSSLMHSPSKDIGMTVSSQLASSL-CQEVNRACESLESMIAASMPLSPGHTTQLRSLLKRLQSTLPQPSPSAATAKLSISGQDVSQKPQGEQRKLSAPASVTSRLDIASRPKRPDTDTDRTSVSSTSSSGAGSTSTGASDVFLGSGSAASATGPTQEQRRMIRRRENLLHELIQTERSYVQALEQCLATYKQGLLNPPSWPELKVPPGLSDMVNVLFGNMPALFEFHKQTFEPELGKY-------TESGD---FLPEDVGHCFVVYSERLADLYVDYCVNYTESTRLYIEQGQAFFSVIQRYFN----LTEPLPSYLIKPVQRVTKYQLLLRELRDCCDPASVAELNEGLEAMLDVPKRANDALHLSMLHGLPDDLPIHSLGDVILQDQFTVWEPKQLIKKSRERRVFLFDNCLILAKEASTQPGEHKAKYHYKSRLLLAECNITEHIEGDQCKFALWTGRVPPIHEYRMVLKASSLDLKQTWVRALREGMRERMFSVQSLYQHHQQSASTGKTGVLSEDAELLDTHYILENYQASRPNELSVSAHQIVQVLHRCDTPNLPLVEPGGPDSGDPSKSVKLDPHASGEWAYIRMLVQGTGTTTTTQSPIKEGFIPARLIGAPSGRRSSTTRNRSANASGRRWLLAGSDVRRGAGSGLVPGKRGSKADLNQTQGFPTPYPTATPRVLSTDRQPPKLNAAPVDIGSTILDNVSEESIDVELPPPMTELQVLPTT 2037          

HSP 2 Score: 90.5077 bits (223), Expect = 8.196e-14
Identity = 55/195 (28.21%), Postives = 90/195 (46.15%), Query Frame = 3
Query: 6423 PQILDLPGNGDEKLLGELRLSDDMNVAGRLWSPS-------------DDEMV-----EDVTYNFISRRLLLYETGLILINEVLETCPSINSDLNSNSMPSVVRCKHILSLARLSIKEDVDMSEGRRSANKLLWFCLYEEVSSN-------------------------QSVLCHIIDPITPDVRARWLTELTQMI 6878
            P ++ LP   +   LG+LRL   +NVA +L +               D+EM+     E    +F+SR L LY+  L++ +  +E  P+      ++      + +H L ++++SI EDV     + ++ +LLWFCL E   +                          QS LC+++ P +PD R RWLTELT M+
Sbjct: 2115 PSLVGLPIGANLSGLGDLRLHGGLNVAAKLVAGPRPVATGSQSTVGPDEEMLRGVFDEGAELHFVSRYLFLYDQALVIADAAVELLPTDEETSPTSRRRLQCQFRHALPISQISIMEDVGAPGSKPTSEQLLWFCLSERARTTVSTSPLDSAGGGGNHSNSPPPPSSAQSYLCYVVAPRSPDTRVRWLTELTAMV 2309          
BLAST of Triple functional domain protein vs. TrEMBL
Match: A0A0X3PU00 (Triple functional domain protein OS=Schistocephalus solidus OX=70667 GN=TRIO PE=4 SV=1)

HSP 1 Score: 1634.39 bits (4231), Expect = 0.000e+0
Identity = 910/1918 (47.45%), Postives = 1202/1918 (62.67%), Query Frame = 3
Query:  486 LKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQTR-----------------------SSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAHDPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRLVEEDEKNHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFEADVASAIDCLKHEVPT----------------------------------PMSYNFLNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGKSSVQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFI-------------------RVKAEADELIHNFDEAGVSSPKLDEIYKRLIHNL----ESKNLNQHTEVIKLIRNRLNLRFANQYLLKPNQVQTGQPGQAVPTTGQLIGQSQPAKLRTQLSSGSN---------YGSGDLNRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQIQEKAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKID-FFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKK--YNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEENQRTRMTSSTSDVARNADNIFYVLDDFTALEISQLSVQRNQRVQLIEQI----------------------------GEWASVRTICTNSDIVDDESTKVQGLVPASLL--------ISVSTRRYLVDDKSINGSSMKKWL-----RDRR-------HGPV---RRGSKVESQXXXXXXXXXXXXXXXXXXXASSDI-----NIEN---NLLDNVSEESVDVELPPPMA-LQEFPVV 5783
            L+A +L+ LL+  IA+LPG R + GGP+LCFPAN+HADEL +EDLY+LVRYLT+LPD+NVKKL F+V+IDMR+GTTWHSVKPIL+V+EECIG   +  +IIKP+KFFEKQKA MA  K++F+ Q+VS + L  E+D SQLT   +G+LPYS+ EWI+IR CLEDFF  AHDMSDKF  LY FLDRK  PETV ESKR +E+H+S+RLK++QAPV  LEAE D+L  WLRYGL + +                          SSWV+MNPD+QQLIPQV++TV QLYE+RAHLQ KW++ R+RLEQIYQLRLFEDD  RM+ WL QQRH+FL+E  +IG TA+QA +L+++HRQFL  C+ VREQVSRLTGVA ML D+GH+AS QI  QA +L+H+ K+FT AL++RS VLQLS SFH+ AE F  N P WE ++   N        V+ LNQ +  +Q  WQE + A+EE C DGRAL   +S PV  GSH SL A +DYS+ RKHCT L+H++W CFKR+E     R +RLT+RL+LLMF+EDV QVLAWL +HGEPFL RQT+VGKS QRAEQLYNAHMQFE+VAANTL NA+KLI AADEL SQA +P+EIL E  EL+RRI  FT AV+ RR  LDLA GF+ H K++    H   E++N  E  P  IEGVEDEL  FH ++ ++  A ++V  EG+ L  RL + DE  H + +L QV S+K  A  LLTERQ+RLDLC+QLRLFEADV  +++ L+ EVP                                       +++ DPRLA S+  LEEV  + + A+ + EEV+ KGSEL RAFESVGVNFPAGG GS+DSGV DS+E A ER+QRL  EL D V  VD+++ ++  ELDWRRL+ QS QVL WISQC+ +L QT+++P++L+EAE L+ +H+ FQP+LNEAHPQAV CAA A   +Q                       L  + + RR + Q++AE VA++WQKLVYAAEE+HKLLLAA NWYKTS+QV SVLRSLEKEYRR +DWC +EKA S G+   YL   LS+H EQKEAFLKACILARRTS+ F+KYL RQP  T G++ V+E++  ++ +LM KEQAVL+AWAA++ RLD+C+++I                      A+ D            SP   E+ KR  H L    E   L  H   +  +  RL      Q  + P      +P       G     S  AK+RT    GSN         YGSG               + TS +  T  ++++  +++ Q K   +R +L+ E++ TE  YV  L T L+T+            +P  +V ++ ++F N+ EI ++H+ +F PE+ +Y               FLPED+GHCF+ + +   ++YV Y  NK +  QI++E  D FF  L  +       +   +QSF IKPVQRITKY + L++L + CD  SAGEL+E  EVML + K+ N+ IHL+ ++GLP+D P+ +LGD I+ D FTVWEP+Q+IKKGR+RRVFLFD CLVL K+      D+K+ YQ+KS +LL + NITEHIEGDQCKFALWTGRVPP+ + RLV K ++LE+KQ WVRA+RE M+ER+FS   +++++    +T+   D A    + FY+L+++ A    ++SV  +Q VQL+++                              +WA VR + T S      S   +G +PA LL         S                S +KWL     +DRR       +G +   +RGS+ +      +P     S   +  +A++DI      +E     LLDNVSEESV++ELPPPM  LQ  P  
Sbjct:  164 LRAAELIPLLRKKIAMLPGGRTRTGGPILCFPANTHADELPLEDLYLLVRYLTYLPDDNVKKLGFTVIIDMRSGTTWHSVKPILRVIEECIGGNVAVAYIIKPDKFFEKQKAQMALGKYSFETQLVSVESLFNEVDPSQLTADLEGSLPYSHSEWIQIRCCLEDFFMFAHDMSDKFGQLYCFLDRKQNPETVEESKRSLEEHRSLRLKVMQAPVPALEAESDRLTAWLRYGLAATSSAGGTSQGVLPSCVSGATGSGASYVPSSWVSMNPDFQQLIPQVRQTVSQLYEFRAHLQQKWESTRTRLEQIYQLRLFEDDASRMANWLEQQRHIFLSECTEIGSTAAQATELHSQHRQFLQKCAGVREQVSRLTGVAVMLADTGHFASQQILKQANQLEHERKAFTAALDERSRVLQLSTSFHTGAETFFKNLPSWEASLSHIN-----GANVSDLNQALKNVQDWWQEIQRAYEEACIDGRALTKQVSVPVSNGSHNSLTATIDYSQCRKHCTELLHKLWDCFKRLERAVIDRRRRLTSRLALLMFKEDVGQVLAWLTDHGEPFLARQTAVGKSSQRAEQLYNAHMQFEQVAANTLTNADKLISAADELASQAENPQEILNEANELQRRITTFTNAVDTRREMLDLACGFYGHAKEVLTCLHGFSESYNPGEHFPPNIEGVEDELTNFHQDRSSLEAAIEQVNAEGNVLIGRLQDTDEVTHLRSILHQVASEKAAAWSLLTERQLRLDLCMQLRLFEADVHQSLEKLRREVPAIAFATSSTPSSTTVGTAGASESGSTTSATSASTPQQELSWVVDPRLAPSIAALEEVNTSCLNALPTVEEVLNKGSELFRAFESVGVNFPAGGPGSSDSGVGDSSETAFERLQRLIAELADSVNVVDDISERVSGELDWRRLQLQSYQVLQWISQCENVLYQTSVIPTSLSEAEALKTDHENFQPVLNEAHPQAVQCAARASYLLQ-----------------------LVGSDHPRRSDLQSVAETVANRWQKLVYAAEEQHKLLLAATNWYKTSEQVISVLRSLEKEYRRDKDWCHSEKAMSSGNIKIYLDHQLSKHGEQKEAFLKACILARRTSDLFVKYLHRQPPTTEGRADVEERIRTAMAELMTKEQAVLEAWAAQRRRLDDCVNYICFERDIRDLASRILQSVSSGTPADVDATNEPLPSLTPQSPLYGEV-KRTCHKLSVLIEMGGL--HVPYLTALHTRL------QTCITP----PSRPSATSAAVGDTSESSLIAKMRTTSIGGSNRTSVSSTGSYGSG---------------TATSTSEDTATAAVTVALTEEQRKQISRRENLLRELVATERSYVVALRTCLETFRVGTFNPPVGTHVPASVVGKEAIVFGNLAEICDYHEKIFEPELCKYAGGGD----------FLPEDVGHCFVSHGDRLAELYVDYCVNKVDSTQILIEDTDNFFQRLQIH-----YDLSEPLQSFLIKPVQRITKYQLLLRELRDCCDKSSAGELNEGLEVMLAVPKKANEAIHLRMLQGLPDDLPVSALGDVIVQDQFTVWEPKQLIKKGRERRVFLFDFCLVLAKECPVAPGDHKMKYQFKSRVLLADLNITEHIEGDQCKFALWTGRVPPVNDGRLVFKAQNLEVKQTWVRAIREAMRERMFSVQSLHQDH----LTARPGDAASLTPDTFYILENYQAQGPHEISVSAHQIVQLLQRTDSPKIPCSDENTPTPSEEEAASDITSNESQWALVRFVVTGS-ASSPRSPVSEGFIPARLLGAPVFQQRASSVGPSSTGGGGGTRRRSGRKWLPSSGFKDRRGTAPTPTNGTISAAKRGSRTD------MPIVQAISATLEQPLAATDIIPTVGQLEAAGVALLDNVSEESVELELPPPMVELQALPTA 1999          

HSP 2 Score: 78.9518 bits (193), Expect = 2.004e-10
Identity = 61/227 (26.87%), Postives = 98/227 (43.17%), Query Frame = 3
Query: 6384 EFDDSNHSPILIAPQILDLPGNGDEKLLGELRLSDDMNVAGRL-------------------------------------WSPS--DDEMVEDVTYN-----FISRRLLLYETGLILINEVLETCPSINSDLNSNSMPSVVRC--KHILSLARLSIKEDVDMSEGRRSANKLLWFCLYEE------------VSSNQSVLCHIIDPITPDVRARWLTELTQMIQMEK 6890
            E  DS  S +   P ++ +P +     LG+LRL   + VA RL                                      +PS  D+E++  V        F++R L+L+E GL++ +E +ET          +  P  +RC  +H +S A+ +I ED+       + + +LWFC+ E              ++ QS LCHI+ P + +VR RWLTEL  ++Q  K
Sbjct: 2053 EVVDSEQSALNCVPVLMGVPSDVK---LGQLRLHGALRVATRLVGAPRGSDPGPASSPTAATSAKTTGCAAASSDLAAATTAPSLQDEELLRAVVEESTDLVFVNRHLMLFERGLVIADEAVETT-------APDGGPRQLRCQFRHFISFAQAAILEDISAGGSHPTGDHVLWFCVSERPRRALSATTGGTAATIQSHLCHILAPPSVEVRLRWLTELNSLVQENK 2269          
BLAST of Triple functional domain protein vs. TrEMBL
Match: A0A5K3FCH9 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 1614.74 bits (4180), Expect = 0.000e+0
Identity = 898/1903 (47.19%), Postives = 1206/1903 (63.37%), Query Frame = 3
Query:  486 LKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGL-----------------------------------------NSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAHDPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRLVEEDEKNHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFEADVASAIDCLKHEVP-------------------------------------TPMSYN--FLNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGKSSVQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFIRVKAEADELIHN-FDEAGVSSPKLDEIYKRL-IHNLESKNLNQHTEVIKLIRNRLNLRFANQY---LLKPNQVQTGQPGQAVPTTGQLIGQSQPAKLRTQLSSGSNYGSGDLNRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQIQEKAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKK--YNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEENQRTRMTSSTSDVARNADNIFYVLDDFTALEISQLSVQRNQRVQLIEQIGE---------------------------WASVRTICTNSDIVDDESTKVQGLVPASLLIS-VSTRRYLVDDKSINGS---------SMKKWL------RDRR----HGPVRRGSKVE----SQXXXXXXXXXXXXXXXXXXXASSDINIENNLLDNVSEESVDVELPPPMA-LQEFP 5777
            L+A +L+TLL+   A+LPG R + GGP+LCFPANSHAD L +E+LY LVRYLT+LP+ENVKKL F+V+IDMR+GTTWHSVKPILKV+EECIG   S  +IIKP+K+FEKQK  +A  KF+F+IQ+VS ++L  E+D SQLT   +GTLPY +EEWI+IR CLE+FF  AHDMSDKF+ LY FLD+K  PETV ESKR +EDH+SVRLK++QAPV  LEAE D+L  WLRYG+                                         +  +   SSWV+MNPD+QQLIPQV++TV QLYE+RAHLQ KW+ GR+RLEQIYQ RLFEDD  RM+ WL+QQ  L LTE+ DIG TA+QA +L+ +HRQFL  C+ VREQVSRLTG+A ML D+GH+A  Q+  QA +L+H+ KSFT ALE+RS VLQLS SFH+RAEAFL +C  WE  ++  +        V+ LNQ +  +Q+ WQ+ + ++EE C DGRA+   LS+PV  GSHTSL AA+DYS+GRKHC  L+HE+WA +KR+E     R  RLT+RL+LLMF+EDV QVLAWL +HGEPFL RQT++GKS QRAEQLYNAHMQFE+VAANTL NA+KLI A DEL SQA +P E+ QE  +L++RI  FT AV+ RR  LDLA GF+ HTK++  WFH   EN+N  E  P TIEG++DEL  F   + ++  A ++V+ EG  L +RL + +E  H + +L QV +++ +  D+L +RQ+RL+LC+QLRLFEADV  +++ L+ +VP                                     TP +    +++DPR A S+  LEEV  +  A +   EEV+ KG EL R FESVGVNFPAGG GS+DSGV DS+E AVER+ RL  EL D V  VDE+N ++  ELDWRRL+ QS+QVL WI QC+ +L QTA +PS+L EAE +Q +HDKFQP+LN+AHP+AV CAA A   +Q ++                         + RR + Q +AE VA +WQKLVYAAEEKHKLL+AA NWYKTS+QV SVLRSLEK+YRR EDWC+++KA   G+   YL DLL++H EQKEAFLKACILARRTSE F+KYL RQP  T  +S V+E++ + + DLM KEQAVL+AWAA++ R ++C+ F+ V+AE  EL    F   G      ++    L +  L+S   N      + ++  L++     +   LLK +         A P        + PAK+R+  S+GS       NR+S+SSTGS ++  +SD  ++   + + G++  Q K   +R +++ E++ TE  YV  L T L+T+     +   DI IP  +  ++ V+F N++EI  FH+  F PEI +Y               FLPED+GHCF+ + +    +YV+Y  NK++   I++   + F   +   F    Q+   +QSF IKPVQRITKY + L++L + CD  SAGELSE  +VM+ + K+ N+ IHL+ ++GLP+D P+  LGD +L D FTVWEP+Q+IKK RDRRVFLFD+CLVL K+   +  D+K+ YQ+KS  LL + NITEHIEGDQCKFALWTGRVPP+ +YRLVLK  +LE+KQ WVRA+RE M+ER+FS   +++E            +  +A + +Y+ +++ A   +++SV  +Q VQLI++  +                           WA VR + T S    +     +G +PA LL + V  R   V      G          SM++WL      ++RR    +   +RGSK +       +            + T  A++       LLDNVSEESV++ELPPPM  LQ  P
Sbjct:  151 LRAAELITLLRGKYAMLPGGRTRNGGPILCFPANSHADCLPLEELYFLVRYLTYLPEENVKKLGFAVIIDMRSGTTWHSVKPILKVIEECIGGNVSMTYIIKPDKYFEKQKVQLAIGKFSFNIQLVSVEQLFLEVDPSQLTADLEGTLPYHHEEWIQIRCCLEEFFMFAHDMSDKFSQLYCFLDQKQNPETVEESKRALEDHRSVRLKVMQAPVPALEAESDRLSAWLRYGISAAASASASGGGPAAVTSSSSGGVAGGGVGLPSSVTVATSGSGASYVPSSWVSMNPDFQQLIPQVRQTVTQLYEFRAHLQQKWETGRTRLEQIYQFRLFEDDASRMTGWLDQQGMLLLTEHADIGDTAAQAVELHNQHRQFLQKCNGVREQVSRLTGIARMLADTGHFAGQQMLKQATELEHERKSFTAALEERSRVLQLSTSFHTRAEAFLNSCTSWEAGVRHVS-----GTNVSDLNQALRLIQERWQDIQRSYEEACRDGRAMVDLLSAPVAGGSHTSLTAAIDYSQGRKHCADLVHELWAWYKRLERTFTDRKSRLTSRLALLMFKEDVGQVLAWLTDHGEPFLARQTAIGKSSQRAEQLYNAHMQFEQVAANTLTNADKLISAVDELASQAENPREVRQEAAKLQQRITNFTNAVDARREMLDLACGFYGHTKEVLNWFHNATENYNPGEHFPPTIEGMDDELTAFRQHRASLEAAVNRVVSEGEALIARLQDSEETAHLRSILAQVTNERGSVWDILGDRQMRLELCMQLRLFEADVHDSMEGLRRDVPAITAAAAAAAAATSSTSPTASTAASDSGAASAPSTTGTPATSELYWISDPRQAPSIAALEEVNVSCTAVLPKVEEVLNKGGELIRIFESVGVNFPAGGPGSSDSGVGDSSETAVERVHRLISELGDSVATVDEINERVSNELDWRRLQSQSRQVLKWIGQCEVILYQTAAIPSSLAEAEAMQTDHDKFQPVLNDAHPEAVQCAARASYLLQSVAAD-----------------------HPRRADFQAVAESVAARWQKLVYAAEEKHKLLIAATNWYKTSEQVISVLRSLEKDYRRDEDWCRSDKALGSGNVEAYLNDLLNKHGEQKEAFLKACILARRTSELFMKYLHRQPPSTACRSKVEERIRSDMADLMTKEQAVLEAWAAQRRRFEDCVKFVAVEAEMLELARRIFQSVGAPVKSAEDPNAALPLIPLQSPFHNGVKRACQTLKALLDVGIGPHHVDRLLKIHHRFDACLASAEPPRPPEGDSTAPAKMRST-SAGS-------NRTSVSSTGSSAAVASSDAASSVGITATVGLTDGQRKLINRRQNILRELVTTERAYVVALRTCLETFRVGTMDPPVDIPIPASIAGKEKVVFGNLEEIYHFHEKFFEPEICKYASGGD----------FLPEDVGHCFVSFGDRLAGLYVEYCVNKEDSMHILVGDTENFFGRLQLRF----QLSEPLQSFLIKPVQRITKYQLLLRELRDCCDKASAGELSEGLDVMMAVPKKANEAIHLRMLQGLPDDLPMSCLGDVVLQDQFTVWEPKQLIKKARDRRVFLFDICLVLAKECPVSPGDSKMKYQFKSRFLLADVNITEHIEGDQCKFALWTGRVPPVSDYRLVLKAPNLEVKQTWVRAIREAMRERMFSVQSLHQEGGAAPNKLGADSI--SALDAYYIRENYQAQGPNEISVAAHQIVQLIQRTAQPTTESVGSPPPTPTPSADGDGEAGGMPWALVRFVVTGSAASPNAPVD-EGFIPARLLGAPVYPRAASVTASGSGGGGGASSGGRLSMRRWLPSGTGAKERRQIIPNSAGKRGSKADMVPPPIPLVHRARAATSQHPAPTPGAATSAQDNAALLDNVSEESVELELPPPMVELQALP 2000          

HSP 2 Score: 72.4034 bits (176), Expect = 2.405e-8
Identity = 40/147 (27.21%), Postives = 74/147 (50.34%), Query Frame = 3
Query: 6525 DDEMVEDVTYN-----FISRRLLLYETGLILINEVLET---CPSINSDLNSNSMPSVVRC--KHILSLARLSIKEDVDMSEGRRSANKLLWFCLYEEV---------------SSNQSVLCHIIDPITPDVRARWLTELTQMIQMEK 6890
            DDE+++ +  +     F++R L+L++ GL++ +  +E    C  +   +         RC  +H L  ++++I ED+ ++  R +  ++LWFC+ E                 S  QS LCH++ P +P+ R RWLTEL   ++  K
Sbjct: 2148 DDELLKAIAEDSTSLCFVNRHLMLFDRGLVIADAAVEATSRCDGVTRQM---------RCQFRHFLPFSQIAILEDISVAGSRPTEEQVLWFCVSERPRQSTASGVCGGGGAQSGLQSHLCHVLAPHSPETRIRWLTELNAALEQSK 2285          
BLAST of Triple functional domain protein vs. TrEMBL
Match: A0A0R3UMD6 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS8905 PE=4 SV=2)

HSP 1 Score: 1613.59 bits (4177), Expect = 0.000e+0
Identity = 898/1903 (47.19%), Postives = 1206/1903 (63.37%), Query Frame = 3
Query:  486 LKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGL-----------------------------------------NSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAHDPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRLVEEDEKNHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFEADVASAIDCLKHEVP-------------------------------------TPMSYN--FLNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGKSSVQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFIRVKAEADELIHN-FDEAGVSSPKLDEIYKRL-IHNLESKNLNQHTEVIKLIRNRLNLRFANQY---LLKPNQVQTGQPGQAVPTTGQLIGQSQPAKLRTQLSSGSNYGSGDLNRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQIQEKAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKK--YNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEENQRTRMTSSTSDVARNADNIFYVLDDFTALEISQLSVQRNQRVQLIEQIGE---------------------------WASVRTICTNSDIVDDESTKVQGLVPASLLIS-VSTRRYLVDDKSINGS---------SMKKWL------RDRR----HGPVRRGSKVE----SQXXXXXXXXXXXXXXXXXXXASSDINIENNLLDNVSEESVDVELPPPMA-LQEFP 5777
            L+A +L+TLL+   A+LPG R + GGP+LCFPANSHAD L +E+LY LVRYLT+LP+ENVKKL F+V+IDMR+GTTWHSVKPILKV+EECIG   S  +IIKP+K+FEKQK  +A  KF+F+IQ+VS ++L  E+D SQLT   +GTLPY +EEWI+IR CLE+FF  AHDMSDKF+ LY FLD+K  PETV ESKR +EDH+SVRLK++QAPV  LEAE D+L  WLRYG+                                         +  +   SSWV+MNPD+QQLIPQV++TV QLYE+RAHLQ KW+ GR+RLEQIYQ RLFEDD  RM+ WL+QQ  L LTE+ DIG TA+QA +L+ +HRQFL  C+ VREQVSRLTG+A ML D+GH+A  Q+  QA +L+H+ KSFT ALE+RS VLQLS SFH+RAEAFL +C  WE  ++  +        V+ LNQ +  +Q+ WQ+ + ++EE C DGRA+   LS+PV  GSHTSL AA+DYS+GRKHC  L+HE+WA +KR+E     R  RLT+RL+LLMF+EDV QVLAWL +HGEPFL RQT++GKS QRAEQLYNAHMQFE+VAANTL NA+KLI A DEL SQA +P E+ QE  +L++RI  FT AV+ RR  LDLA GF+ HTK++  WFH   EN+N  E  P TIEG++DEL  F   + ++  A ++V+ EG  L +RL + +E  H + +L QV +++ +  D+L +RQ+RL+LC+QLRLFEADV  +++ L+ +VP                                     TP +    +++DPR A S+  LEEV  +  A +   EEV+ KG EL R FESVGVNFPAGG GS+DSGV DS+E AVER+ RL  EL D V  VDE+N ++  ELDWRRL+ QS+QVL WI QC+ +L QTA +PS+L EAE +Q +HDKFQP+LN+AHP+AV CAA A   +Q ++                         + RR + Q +AE VA +WQKLVYAAEEKHKLL+AA NWYKTS+QV SVLRSLEK+YRR EDWC+++KA   G+   YL DLL++H EQKEAFLKACILARRTSE F+KYL RQP  T  +S V+E++ + + DLM KEQAVL+AWAA++ R ++C+ F+ V+AE  EL    F   G      ++    L +  L+S   N      + ++  L++     +   LLK +         A P        + PAK+R+  S+GS       NR+S+SSTGS ++  +SD  ++   + + G++  Q K   +R +++ E++ TE  YV  L T L+T+     +   DI IP  +  ++ V+F N++EI  FH+  F PEI +Y               FLPED+GHCF+ + +    +YV+Y  NK++   I++   + F   +   F    Q+   +QSF IKPVQRITKY + L++L + CD  SAGELSE  +VM+ + K+ N+ IHL+ ++GLP+D P+  LGD +L D FTVWEP+Q+IKK RDRRVFLFD+CLVL K+   +  D+K+ YQ+KS  LL + NITEHIEGDQCKFALWTGRVPP+ +YRLVLK  +LE+KQ WVRA+RE M+ER+FS   +++E            +  +A + +Y+ +++ A   +++SV  +Q VQLI++  +                           WA VR + T S    +     +G +PA LL + V  R   V      G          SM++WL      ++RR    +   +RGSK +       +            + T  A++       LLDNVSEESV++ELPPPM  LQ  P
Sbjct:  151 LRAAELITLLRGKYAMLPGGRTRNGGPILCFPANSHADCLPLEELYFLVRYLTYLPEENVKKLGFAVIIDMRSGTTWHSVKPILKVIEECIGGNVSMTYIIKPDKYFEKQKVQLAIGKFSFNIQLVSVEQLFLEVDPSQLTADLEGTLPYHHEEWIQIRCCLEEFFMFAHDMSDKFSQLYCFLDQKQNPETVEESKRALEDHRSVRLKVMQAPVPALEAESDRLSAWLRYGISAAASASASGGGPAAVTSSSSGGVAGGGVGLPSSVTVATSGSGASYVPSSWVSMNPDFQQLIPQVRQTVTQLYEFRAHLQQKWETGRTRLEQIYQFRLFEDDASRMTGWLDQQGMLLLTEHADIGDTAAQAVELHNQHRQFLQKCNGVREQVSRLTGIARMLADTGHFAGQQMLKQATELEHERKSFTAALEERSRVLQLSTSFHTRAEAFLNSCTSWEAGVRHVS-----GTNVSDLNQALRLIQERWQDIQRSYEEACRDGRAMVDLLSAPVAGGSHTSLTAAIDYSQGRKHCADLVHELWAWYKRLERTFTDRKSRLTSRLALLMFKEDVGQVLAWLTDHGEPFLARQTAIGKSSQRAEQLYNAHMQFEQVAANTLTNADKLISAVDELASQAENPREVRQEAAKLQQRITNFTNAVDARREMLDLACGFYGHTKEVLNWFHNATENYNPGEHFPPTIEGMDDELTAFRQHRASLEAAVNRVVSEGEALIARLQDSEETAHLRSILAQVTNERGSVWDILGDRQMRLELCMQLRLFEADVHDSMEGLRRDVPAITAAAAAAAAATSSTSPTASTAASDSGAASAPSTTGTPATSELYWISDPRQAPSIAALEEVNVSCTAVLPKVEEVLNKGGELIRIFESVGVNFPAGGPGSSDSGVGDSSETAVERVHRLISELGDSVATVDEINERVSNELDWRRLQSQSRQVLKWIGQCEVILYQTAAIPSSLAEAEAMQTDHDKFQPVLNDAHPEAVQCAARASYLLQSVAAD-----------------------HPRRADFQAVAESVAARWQKLVYAAEEKHKLLIAATNWYKTSEQVISVLRSLEKDYRRDEDWCRSDKALGSGNVEAYLNDLLNKHGEQKEAFLKACILARRTSELFMKYLHRQPPSTACRSKVEERIRSDMADLMTKEQAVLEAWAAQRRRFEDCVKFVAVEAEMLELARRIFQSVGAPVKSAEDPNAALPLIPLQSPFHNGVKRACQTLKALLDVGIGPHHVDRLLKIHHRFDACLASAEPPRPPEGDSTAPAKMRST-SAGS-------NRTSVSSTGSSAAVASSDAASSVGITATVGLTDGQRKLINRRQNILRELVTTERAYVVALRTCLETFRVGTMDPPVDIPIPASIAGKEKVVFGNLEEIYHFHEKFFEPEICKYASGGD----------FLPEDVGHCFVSFGDRLAGLYVEYCVNKEDSMHILVGDTENFFGRLQLRF----QLSEPLQSFLIKPVQRITKYQLLLRELRDCCDKASAGELSEGLDVMMAVPKKANEAIHLRMLQGLPDDLPMSCLGDVVLQDQFTVWEPKQLIKKARDRRVFLFDICLVLAKECPVSPGDSKMKYQFKSRFLLADVNITEHIEGDQCKFALWTGRVPPVSDYRLVLKAPNLEVKQTWVRAIREAMRERMFSVQSLHQEGGAAPNKLGADSI--SALDAYYIRENYQAQGPNEISVAAHQIVQLIQRTAQPTTESVGSPPPTPTPSADGDGEAGGMPWALVRFVVTGSAASPNAPVD-EGFIPARLLGAPVYPRAASVTASGSGGGGGASSGGRLSMRRWLPSGTGAKERRQIIPNSAGKRGSKADMVPPPIPLVHRARAATSQHPAPTPGAATSAQDNAALLDNVSEESVELELPPPMVELQALP 2000          

HSP 2 Score: 72.0182 bits (175), Expect = 2.649e-8
Identity = 40/147 (27.21%), Postives = 74/147 (50.34%), Query Frame = 3
Query: 6525 DDEMVEDVTYN-----FISRRLLLYETGLILINEVLET---CPSINSDLNSNSMPSVVRC--KHILSLARLSIKEDVDMSEGRRSANKLLWFCLYEEV---------------SSNQSVLCHIIDPITPDVRARWLTELTQMIQMEK 6890
            DDE+++ +  +     F++R L+L++ GL++ +  +E    C  +   +         RC  +H L  ++++I ED+ ++  R +  ++LWFC+ E                 S  QS LCH++ P +P+ R RWLTEL   ++  K
Sbjct: 2148 DDELLKAIAEDSTSLCFVNRHLMLFDRGLVIADAAVEATSRCDGVTRQM---------RCQFRHFLPFSQIAILEDISVAGSRPTEEQVLWFCVSERPRQSTASGVCGGGGAQSGLQSHLCHVLAPHSPETRIRWLTELNAALEQSK 2285          
BLAST of Triple functional domain protein vs. Ensembl Cavefish
Match: trioa (trio Rho guanine nucleotide exchange factor a [Source:NCBI gene;Acc:557667])

HSP 1 Score: 654.825 bits (1688), Expect = 0.000e+0
Identity = 401/1159 (34.60%), Postives = 634/1159 (54.70%), Query Frame = 3
Query:  486 LKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQT-------RSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRLVEE----------DEKNHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFE---ADVASAIDCLKHEVPTPMSYNF------LNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGKSS----VQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFI---RVKAEADELIHNFDEAGVSS 3860
            +KA ++L +LK  +A L G RDKRGGPVL FP+ ++ D +  EDL  L+ YL  +P E+V K  F+V++DMR G+ W S+KP+LK+L+E    C     IIKP+ F++KQ+    SSKF F+  +VS + L + +D SQLT  F+G+L Y++EEWIEIR+  EDF   A  +  +   +   + RKD P+ +  ++R +E+H +++ K+++APV  +++EG +L   ++   +  N+T       R +    N D Q L+P++   ++QL+  R +L   W   + +L+Q +QLRLFE D  +M +W+   + LFL  Y +IG   S A +L  +H  F +NC +V   ++R+  V N L ++GHYAS QI+  + +L+ +WK+F  AL++RS +L++SA+FH + + +++N   W  A  + ++       +  L   I   Q L++    A+ EV  DG+AL   L  P+  G   SL A  +YS+   H   ++HEV    +++E +  HR  RL  RL L +F++DV QVL W+  HGE FL + T VGKSL RA  L   H  FEEVA NT  NA+KL+ AA++L      DPEEI Q   +LE RIQ F + VE R+  LD++V FH H K+L+ W  +L++     ++   ++E V+D ++RF  +++  L     V+KEG  L  +L +              NH + +L Q+   +    +L  ER+++L+L LQLR+FE    D+ S +D    E+   MS +F      L + RL    ++   +       I  G+E++Q  +E+    ++ GV           + V D  E+  E+ Q L        +A ++    L+  +  R L+ + +QVL WI   + ML    +  S+L EAEQLQ EH++FQ  + + H  A+     AE  +Q   + +                             ++ AE VA  WQ+L+   E++ KL+ A+  +YKTS+QV SVL SLE+EY+R EDWC          +  ++  ++S+H EQKEAFLKAC LARR ++ F+KY+ R     PG  S     +++V   + +L+ +E  VL  W  RK RLD+C  ++   R   +A E IH+  E  +S+
Sbjct:   13 MKAMEVLPILKEKVAFLSGGRDKRGGPVLTFPSRTNHDRIRHEDLRRLIAYLAGIPSEDVCKHGFTVIVDMR-GSKWDSIKPLLKILQESFPSCIHVALIIKPDNFWQKQRTNFGSSKFEFETTMVSLEGLSKVVDPSQLTADFEGSLDYNHEEWIEIRVAFEDFTGNARHLLARLEEMQDTVTRKDFPQDLEGARRMIEEHAALKKKVMKAPVEEVDSEGQRLLQRIQSSESYANRTVPVGPGQREAQGQPNADTQGLMPRISSLLEQLHSTRQNLHQAWHVRKLQLDQCFQLRLFEQDAEKMFDWIMHNKGLFLAGYTEIGNNHSHAMELQTQHNHFAMNCMNVYVNINRIMSVGNRLLEAGHYASQQIKQISGQLEQEWKAFAAALDERSTLLEMSATFHQKCDQYMSNVDSWCKACGEVDLP----SELQDLEDAIHHHQGLYEHITTAYSEVSQDGKALLDKLQRPLTPGGADSLTATANYSKAVHHVLDIIHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYQAAHQLEDRIQDFVRRVEQRKVLLDMSVAFHTHVKELWTWLEELQKEL-LDDVYAESVEAVQDLIKRFGQQQQTTLQVTVNVIKEGEDLIQQLRDSAISSNKAPHNSSINHIESVLQQLDEAQAQMEELFQERKIKLELFLQLRIFERDAIDIISDLDSWNEELSQQMS-DFDTEDLTLAEQRLQHHADKALTMNNLTFDVIHQGQELLQYVNEV----QASGVELLCDRDVDMATRVQDLLEFLHEKQQELD-------VAAEQHRRHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAETLLQANHYDM--------------------------DMIRDCAENVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNCETDHVTPMISKHLEQKEAFLKACTLARRNADVFLKYMHRNSVNMPGMLSHVKAPEQQVKNILNELLQRENRVLHFWTMRKRRLDQCQQYVVFERSAKQALEWIHDTGEFYLST 1127          

HSP 2 Score: 275.404 bits (703), Expect = 2.622e-73
Identity = 155/468 (33.12%), Postives = 253/468 (54.06%), Query Frame = 3
Query: 4224 QEKAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKI-DFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEE----------------------------------NQRTRMTSSTSDVARNADNIFYVLDDFTALEISQLSVQRNQRVQLIEQI---GEWASVRTICTNSDIVDDESTKVQGLVPASLLISVSTR 5513
            + K+A+++  ++ E+IQTE  YV DL   + TY   +  G+ +I  P  +V ++ ++F N++++ EFH ++FL E+ +Y+               LPED+GHCF+ +A+ F+ +YV Y  NK +  Q+++E    +F+E+         ++ N+I S+ IKPVQRITKY + LK+L   C+ G  GE+ +  EVML + KR ND +HL  ++G  E+  +ES G+ IL + F VW+P+ +I+KGR+R +FLF++ LV +K+    + +  Y YKS +  +E  +TEH+EGD CKFALW GR  P  + ++VLK   +E KQ W++ +RE +QER        +E                                    RT   +  SD       +  V+ DF     ++L+V+R Q V+++E++    +W  VRT         D S   +GLVP ++L    +R
Sbjct: 1249 KRKSARRKDFIMAELIQTEKAYVRDLRECMDTYLWEMTSGVEEI--PPGIVNKEHIIFGNMQDLYEFHHNIFLKELEKYEQ--------------LPEDVGHCFVTWADKFQ-MYVNYCKNKPDSTQLILEHAGSYFDEIQQ-----RHRLANSISSYLIKPVQRITKYQLLLKELLTCCEEGK-GEIKDGLEVMLSVPKRANDAMHLSMLEGFDEN--IESQGELILQESFQVWDPKTLIRKGRERHLFLFEMSLVFSKEVKDSNGRSKYIYKSKLFTSELGVTEHVEGDPCKFALWVGRT-PTSDNKIVLKASSIENKQDWIKHIREVIQERTVHLKGALKEPIHIPKPSTAKHKGHGEDLDSQGDGSSQPDTISLASRTSQNTLDSDKLSGGCELTVVIHDFLGGNSNELTVRRGQTVEVLERLHDKPDWCLVRTT--------DRSPAQEGLVPCAMLCIAHSR 1682          

HSP 3 Score: 111.309 bits (277), Expect = 1.533e-23
Identity = 87/335 (25.97%), Postives = 160/335 (47.76%), Query Frame = 3
Query: 4239 KKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAG----ELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEP-RQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIF----YQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQ 5216
            K+R +++ E+++TE  YV DL   ++ Y   + E      +P D+  +  ++F NI +I ++H+  FL E+ +              C   P+ +G  F++       +Y+ Y  NK +   I+ E ID + E +        Q+ + +    IKPVQRI KY + LKD      +  AG    E  +A EVM  + KR ND +++  ++G   D  + + G  +L D F V +    ++ + ++RRVFLF+  ++ ++    D  + F    + YK+ I ++   + +  +GD CKF L T R+        +L      ++Q W   + + ++
Sbjct: 1929 KRRHYILLELVETERDYVRDLGLVVEGYMTRMKED----GVPDDMKGKDKIVFGNIHQIYDWHRDFFLGELEK--------------CLEDPDHLGPLFVKQERRL-HMYIVYCQNKPKSEHIVSEYIDTYFEDLKQRLGHRLQLTDLL----IKPVQRIMKYQLLLKDFLKF--SKKAGLDSLEFEKAVEVMCIVPKRCNDMMNVGRLQGF--DGKIVAQGRLLLQDTFLVSDSDGGLLGRMKERRVFLFEQIVIFSEPL--DKKRGFSMPGFLYKNSIKVSCLGLEDCADGDPCKFTL-TSRMSNGSNEAFILHSSHPGVRQVWTLQISQILE 2233          

HSP 4 Score: 60.077 bits (144), Expect = 4.719e-8
Identity = 31/129 (24.03%), Postives = 60/129 (46.51%), Query Frame = 3
Query: 1248 QVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALE 1634
            QVK  + +L +    + H W   + RL+Q  Q  +FE    +  EW++     +L+ +   G +     +L  EH  F +     +E+V  L  +A+   D GH  +A+I+     +D  ++ F+  ++
Sbjct: 1071 QVKNILNELLQRENRVLHFWTMRKRRLDQCQQYVVFERSAKQALEWIHDTGEFYLSTHTSTGSSIHHTQELLKEHEDFHITAKQTKERVKLLIQLADGFCDKGHAHAAEIKKWVTAVDKRYRDFSLRMD 1199          
BLAST of Triple functional domain protein vs. Ensembl Cavefish
Match: kalrna (kalirin RhoGEF kinase a [Source:ZFIN;Acc:ZDB-GENE-100921-4])

HSP 1 Score: 640.573 bits (1651), Expect = 0.000e+0
Identity = 392/1152 (34.03%), Postives = 621/1152 (53.91%), Query Frame = 3
Query:  510 LLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTL--------------------------CSRLVEEDEKNHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFE---ADVASAIDCLKHEVPTPMSYNFLNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESV---GVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGKS-----SVQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFIRVKAEADELIHNFDEAG 3851
            +L+  +A + G RDKRGGP+L FPA S+ D +  EDL  LV YL+ +P E+V K  F+V+IDMR G+ W  +KP+LK L+E          IIKP+ F++KQK    S+KFTF+  +VS + L + +D SQLT  F+G+L Y++EEW+E+R+ LE+F   A  +  +   L + L +K+ P  V  S+R +E+H  ++ K+++APV  L+ EG +L   +R   +S   +  + ++ + D+Q ++P++   + +L+  R HL   W   + +L+Q +QLRLFE D  +M +W++  + LFL  + +IG +   A DL  +H  F +N  +    ++R+  VA+ L+++GHYAS QI+  + +LD +WKSF  AL++RS +L +SA FH ++E FL+    W     +     G    +  L   I   Q L+++   A+ EV  DG+AL   L  P+  G+  SL A  +YS+       ++HEV    +R+E++  HR  RL  RL L +F++DV QV+ W+  HGE FL + T VGKSL RA  L   H  FEEVA NT  NA+KL+ AA++L      DPEEI +    LE RIQ F + VE R+  LD++V FH HTK+L+ W   L++     E+   +++ V++ +++F  ++   L+A   V+KEG  L                           +++       H + +L Q+   +    +L  ER+++LD+ LQLR+FE    +V + +D    ++   +S     +P L      L+      +A      EVIQ+G +L +    V   G+           + V +  E+  E+   L        M+ ++   +++  L  R L+ + +QVL WI   + ML  + +  S+L+EAEQLQ EH++FQ  + + H  A+     AE  +Q   +   PE+                         +  AE VA  WQ+L+   E++ KL+ A+  +YKTS+QV SVL SLE+EYRR EDWC          +  ++  L+S+H EQKEAFLKAC LARR +E F+KY+ R    TP  S     S +++V A + +L+ +E  VL  W  +K RLD+C  ++  +  A + +    EAG
Sbjct:    1 VLREKVAFVSGGRDKRGGPILTFPARSNHDRIKQEDLRKLVTYLSTVPSEDVCKRGFTVIIDMR-GSKWDLIKPLLKTLQEAFPAEICVALIIKPDNFWQKQKTNFGSAKFTFETSMVSVEGLTKLVDPSQLTDDFEGSLEYNHEEWMELRVALEEFLGSAVHLLSRLEDLQELLAKKEFPVDVEGSRRLIEEHTQLKKKVMKAPVEELDREGQRLLQCIR---SSDGFSGRNCISGSADFQSVVPKIASLLDKLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAEKMFDWISHNKELFLQSHTEIGVSYQHAVDLQTQHNHFAMNSMNAYVNINRIMSVASRLSEAGHYASQQIKQISAQLDQEWKSFAAALDERSTILAMSAVFHQKSEQFLSGVEAWCKMCSEG----GLPSEMQDLELAIHHHQTLYEQVTQAYTEVSQDGKALLDVLQRPLSPGNSESLTATANYSKAVHCILDVVHEVLHHHRRLESIWQHRKVRLHQRLQLCVFQQDVQQVMDWIENHGEAFLSKHTGVGKSLHRARALQKRHDDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYKAARHLEVRIQDFVRRVEQRKLLLDMSVSFHTHTKELWTWMEDLQKEL-LEEVCSDSVDSVQELIKQFQQQQTATLEATLNVIKEGEDLIQQLRLDSTPPTHSESHTLNTDSAMSSNKMPHNSSIAHIESVLQQLDEAQGQMEELFHERKIKLDIFLQLRIFEQYTIEVTAELDAWNEDLMRQVSEFNAEEPSLVE--QRLQRHAERKVAMTNMTYEVIQQGQDLHQYIMEVQASGIELTGEKEVDLATQVQELLEFLHEKQHELD-------MSAEQTQKRIEQCLQLRHLQAEVKQVLGWIRNGESMLNASMVNASSLSEAEQLQREHEQFQLAIEKTHQSALQVQQKAEAMLQAGHYD--PEA------------------------IRTCAEKVALYWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYRRDEDWCGGHDKLGPAAETDHVFPLISKHLEQKEAFLKACTLARRNAEVFLKYIHRNNVSTPASSSGNTRSPEQQVKAILNELLQRENRVLHFWTMKKRRLDQCQQYVVFERSAKQAVEWIQEAG 1108          

HSP 2 Score: 254.988 bits (650), Expect = 3.401e-67
Identity = 162/472 (34.32%), Postives = 248/472 (52.54%), Query Frame = 3
Query: 4230 KAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVF-LPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKI-DFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFG-------PIYEENQRTRMTSSTSDVARNADN--------------------------------IFYVLDDFTALEISQLSVQRNQRVQLIEQIGE---WASVRTICTNSDIVDDESTKVQGLVPASLLISVSTR 5513
            K+A+K+  ++ E++QTE  YV DL   L+TY   +  G+ +I  P  +  ++ V+F NI+EI +FH   F + E+  +    + K         L   I H  +    D   IYV Y  NK + +Q+++E    FF+++          + N+I S+ IKPVQRITKY + LK+L + C+ G  GE+ +  EVML + KR ND +HL  ++G  E+  ++  G+ IL D F VW+P+ +I+KGRDR +FLF++CLV +K+      +  Y YK+ +L +E  +TEHIEGD CKFALW GR P   + + VLK   +E+KQ+W++ +RE +QERI           PI +   + R ++S  D   +AD+                                +  VL DF A   ++LSVQ  Q V+L+E+  E   W  VRT         D+S   +GLVP+  L    +R
Sbjct: 1235 KSARKKEFIMAELLQTEKAYVRDLHECLETYLWEMTSGVEEI--PPGIANKEHVIFGNIQEIYDFHNKFFYILELIVFHHLFKLKE-------IL---ISHTLLVLQADKFHIYVSYCKNKPDSSQLILEHAGSFFDDIQQ-----RHGLANSISSYLIKPVQRITKYQLLLKELLSCCEEGK-GEIKDGLEVMLGVPKRANDAMHLSMLEGFDEN--MDVQGELILQDTFQVWDPKSLIRKGRDRHLFLFEICLVFSKEIKDSAGRTKYAYKNKLLTSELGVTEHIEGDPCKFALWAGRTPS-SDNKTVLKASSIEVKQEWIKNIREVIQERIIHLKGALKEPIPIPKTPAKPR-SNSRRDTGEDADSQGDGSSQPDTISIASRTSQNTVDSDKLSGGCELTVVLQDFVASCTAELSVQTGQTVELLERPSERPGWCLVRTT--------DKSPPQEGLVPSGTLCISHSR 1676          

HSP 3 Score: 126.716 bits (317), Expect = 3.435e-28
Identity = 90/324 (27.78%), Postives = 157/324 (48.46%), Query Frame = 3
Query: 4230 KAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGS--AGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWE-PRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWV 5192
            KA + R+ ++NE+IQTE  YV DL   ++ + K I E      +P+D+  +  ++F NI +I ++H+  F+ E+ +              C    E +   FI++      +YV Y  NK +   I+ E   +F  +     S     +  I  F IKP+QRITKY + LKD   N +        + +A ++M ++ K  ND ++L  ++G   +  L S G  +  + F V E    ++ + ++RRVFLF+  ++ ++      +   YQ+K  I ++  ++ EH++ D CKF L           R  L+  + +IKQ WV
Sbjct: 1872 KALRGRMFVLNELIQTEKDYVKDLGIVVEGFMKKIEEK----GVPEDMKGKDKIVFGNIHQIYDWHRDFFVGELEK--------------CLEDHEKLPELFIKHERRLY-MYVVYCQNKPKSEFIVAEYDSYFESIQQDVNS-----RLGISDFLIKPIQRITKYQLLLKDYLKNSNKAGLDCFNIEKAVDLMSQVPKLCNDMMNLGRLQGY--EGKLTSQGKLLQQETFFVTEQDSGVLSRSKERRVFLFEQIVIFSELLRKGSSTPGYQFKKSIKVSYLDLEEHVDNDPCKFVLSCRG----SSERFTLQAANTDIKQVWV 2165          

HSP 4 Score: 76.6406 bits (187), Expect = 4.987e-13
Identity = 83/381 (21.78%), Postives = 160/381 (41.99%), Query Frame = 3
Query: 1263 VQQLYEYRAHLQHKWDAG----RSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQ--YITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEG-RKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNH-TKDL 2378
            VQ+L E+    QH+ D      + R+EQ  QLR  + ++ ++  W+     +      +   + S+A  L  EH QF +      +   ++   A  +  +GHY    I+T A K+   W+     +EDR  ++  S +F+  +E   +     E   ++     G  + +    +  ++  L     E + A  + C+  R  A      + + + ++ A++   +    +    +++E+     RV      + +RL      ++F     Q + W+ E GE FL    S G S ++  QL   + +F   A  T    + LI  AD  V + H    E+ +  + +++R + F+  +   R  LD A+G  +   KDL
Sbjct:  827 VQELLEFLHEKQHELDMSAEQTQKRIEQCLQLRHLQAEVKQVLGWIRNGESMLNASMVN-ASSLSEAEQLQREHEQFQLAIEKTHQSALQVQQKAEAMLQAGHYDPEAIRTCAEKVALYWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYRRDEDWCGGHDKLGPAAETDHVFPLISKHLEQKEAFLKACTLARRNAEVFLKYIHRNNVSTPASSSGNTRSPEQQVKAILNELLQRENRVLHFWTMKKRRLDQCQQYVVFERSAKQAVEWIQEAGEYFLSTHCSAGDSPEKNHQLLKEYQEFCIPAKQTKEKVKLLIQLADNFVEKGHVHVTELKKWVSTVDKRYRDFSLRMGQYRCCLDSALGVSSEDNKDL 1206          

HSP 5 Score: 53.9138 bits (128), Expect = 3.750e-6
Identity = 33/147 (22.45%), Postives = 65/147 (44.22%), Query Frame = 3
Query: 1182 NSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFT 1622
            N      SS  T +P+ Q     VK  + +L +    + H W   + RL+Q  Q  +FE    +  EW+ +    FL+ +   G +  +   L  E+++F +     +E+V  L  +A+   + GH    +++     +D  ++ F+
Sbjct: 1041 NVSTPASSSGNTRSPEQQ-----VKAILNELLQRENRVLHFWTMKKRRLDQCQQYVVFERSAKQAVEWIQEAGEYFLSTHCSAGDSPEKNHQLLKEYQEFCIPAKQTKEKVKLLIQLADNFVEKGHVHVTELKKWVSTVDKRYRDFS 1182          
BLAST of Triple functional domain protein vs. Ensembl Cavefish
Match: triob (trio Rho guanine nucleotide exchange factor b [Source:ZFIN;Acc:ZDB-GENE-030616-399])

HSP 1 Score: 640.188 bits (1650), Expect = 0.000e+0
Identity = 401/1158 (34.63%), Postives = 623/1158 (53.80%), Query Frame = 3
Query:  486 LKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMET-VNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRLVEE----------DEKNHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFE---ADVASAIDCLKHEVPTPMSYNFLNDPRLAR-----------SMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGK----SSVQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFI---RVKAEADELIHNFDEAGVSS 3860
            +KA ++L +LK  +A L G RD+RGGPVL FPA S+ D +  EDL  L+ YL  +P E V +  F+V++DMR G+ W S+KP+LK+L+E    C     IIKP+ F++KQ+    SSKF F+  +VS   L + +D SQLT  FDG+L Y++EEWIE+R+  E+F   A  +  +   L   + ++++P  +  ++R +E+H S++ ++ +APV  L+AEG +L   ++ G   +            D Q L P+V   + +L+  R HL   W   + +L+Q +QLRLFE D  +M +W+   + LFLT Y +IG       +L  +H  F +NC +V   +SR+  V N L + GHYA+ QIQ  + +L+ +WK+F  AL++RS +L++SA+FH + + +L+N   W  A  +     G++ + +  L   I   Q L++    A+ EV  DG++L   L  P+  GS  SL A+ +YS+   H   ++HEV    +++E +  HR  RL  RL L +F++DV QVL W+  HGE FL + T VGKSL RA  L   H  FEEVA NT  NA+KL+ AA++L      DPEEI Q   +LE RIQ F + VE R+  LD++V FH H K+L+ W  +L++     ++   ++E V+D ++RF  +++  L     V+KEG  L  +L +               H + +L Q+   +    +L  ER+++L+L LQLR+FE    DV S ++    E+   M      D  LA            +MN L     TF   I  G+E++Q  +E+    ++ GV           + V D  ++  E+ Q L         A ++    L+  +  R L+ + +QVL WI   + ML    +  S+L EAEQLQ EH++FQ  + + H  A+     AE  +Q   + +                             ++ AE VA  WQ+L+   E++ KL+ A+  +YKTS+QV SVL SLE+EY+R EDWC          +  ++  ++S+H EQKEAFLKAC LARR ++ F+KYL R     PG      + +++V   + +L+ +E  VL  W  RK RLD+C  ++   R   +A E IH+  E  +S+
Sbjct:   35 MKAIEVLPILKEKVAFLSGGRDRRGGPVLTFPARSNHDRIRQEDLRRLIAYLAGIPSEEVSRHGFTVIVDMR-GSKWDSIKPLLKILQESFPSCIHVALIIKPDNFWQKQRTNFGSSKFEFETIMVSLDGLSKMVDPSQLTADFDGSLDYNHEEWIEVRVAFEEFTGNAARVLSRLEELQDLVSQRELPADLDGARRSMEEHASLKKRVTKAPVEELDAEGQRLLQRIQCGDRGRG-----------DVQGLSPKVSALLDKLHATRQHLHQSWHMRKLKLDQCFQLRLFEQDAEKMFDWIVHNKGLFLTSYTEIGANHQHVLELQTQHNHFAMNCMNVYVNISRIMTVGNRLLEGGHYAAMQIQQVSGQLEQEWKAFAAALDERSTMLEMSANFHQKMDQYLSNVEPWCKACGE-----GELPSELQDLEDTIHHHQGLYEHITAAYSEVSQDGKSLLDKLQRPLTPGSADSLTASANYSKAVNHVLDIIHEVLHHQRQLENIWQHRKLRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYQAAHQLEDRIQDFVRRVEQRKVLLDMSVAFHTHGKELWTWLEELQKEL-LDDVYAESVEAVQDLIKRFGQQQQTTLQVTVNVIKEGEDLIQQLRDSAISSNKTPHNSSMAHIESVLQQLDEAQARMEELFQERKIKLELFLQLRIFERDAIDVISDLESWNEELSQQMGEFDTEDLNLAEQRLQHHADKALTMNNL-----TF-HVIHQGQELLQYVTEV----QASGVELLCDRDVDMATRVQDLLDFLHEKQQELD-------AAAEKHRRHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEALLQANHYDM--------------------------DMIRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGTDKLGPNSETDHVTPMVSKHLEQKEAFLKACTLARRNADVFLKYLHRNSVNMPGMLAQIKAPEQQVKNILNELLQRENRVLHFWTLRKRRLDQCQQYVVFERSAKQALEWIHDTGEFYLST 1131          

HSP 2 Score: 208.764 bits (530), Expect = 3.696e-53
Identity = 124/358 (34.64%), Postives = 191/358 (53.35%), Query Frame = 3
Query: 4560 KIYVKYFSNKDEGNQIMMEKID-FFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSF-GPIYEENQRTRMTSST-------------SDVARNADNI----------------------FYVLDDFTALEISQLSVQRNQRVQLIEQI---GEWASVRTICTNSDIVDDESTKVQGLVPASLLISVSTR 5513
            ++YV Y  NK +  Q++++    +F+E+         ++ N+I S+ IKPVQRITKY + LK+L   C+ G  GE+ +  EVML + K+ ND +HL  + G  E+  +ES G+ IL + F VW+P+ +I+KGRDR +FLF++ L+ +K     + +  Y YKS ++ ++  +TEH+EGD CKFALW GR  P  + ++VLK   LE KQ+W++ +RE +QER     G + E     + TSS               D +   D I                        V+ DF A   S+L+V+R Q V+L+E+     EW  VRT         D S   +GLVP+++L    +R
Sbjct: 1315 QMYVNYCKNKPDSTQLILDHAGPYFDEIQQ-----RHRLANSISSYLIKPVQRITKYQLLLKELLTCCEEGK-GEIKDGLEVMLSVPKKANDAMHLSMLDGFDEN--IESQGELILQETFQVWDPKTLIRKGRDRHLFLFEMSLIFSKDVKDSNGRSKYLYKSKLMTSQLGVTEHVEGDPCKFALWVGRT-PTSDNKIVLKASSLENKQEWIKNVREVIQERTIHLRGALKEPIHIPKATSSKLKGRRDGEDLDSQGDASSQPDTISIASRTSQNTLDSDKLSGGCELTVVIHDFMASNGSELTVRRGQTVELLERPHDRPEWCLVRTT--------DRSPAQEGLVPSAMLCIAHSR 1655          

HSP 3 Score: 129.028 bits (323), Expect = 6.007e-29
Identity = 102/358 (28.49%), Postives = 167/358 (46.65%), Query Frame = 3
Query: 4239 KKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAG--ELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWE-PRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIF----YQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEENQRTRMTSSTSDV 5291
            KKR +++ E+++TE  YV DL + ++ Y   + E      +P D+  +  ++F NI +I E+HK  FL E+ +              C   P+ +   FI+       +Y+ Y  NK +   I+ E ID + E +        Q+ + +    IKPVQRI KY + LKD             EL +A EVM  + KR ND +++  ++G   D  + + G  IL D F V +    ++ + ++RRVFLF+  ++ ++    D  K F    Y +K+ I ++   + E  +GD CKF L T R    G  R +L    L + Q WV  +   +            ENQR  + + TS +
Sbjct: 1898 KKRHYVLLELVETERDYVRDLGSVVEGYMSRMKEE----GVPDDMKGKDKIVFGNIHQIFEWHKDFFLSELEK--------------CLEDPDRLAPLFIKQERRL-HMYIVYCQNKPKSEHIVSEYIDTYFEDLKQRLGHRLQITDLL----IKPVQRIMKYQLLLKDFLKFSKKAGVDTTELEKAVEVMCVVPKRCNDMMNVGRLQGF--DGKIVAQGRLILQDTFMVSDQDGGLLSRMKERRVFLFEQIVIFSEPL--DKKKGFSMPGYLFKNSIKVSWLGLEESSDGDPCKFTL-TSRSSTGGSERYILHSSSLALCQTWVHQISSIL------------ENQRNFLNALTSPI 2215          

HSP 4 Score: 82.4185 bits (202), Expect = 8.387e-15
Identity = 90/413 (21.79%), Postives = 168/413 (40.68%), Query Frame = 3
Query: 1263 VQQLYEYRAHLQHKWDAG----RSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETV--NSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAHDPE-EILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNE 2480
            VQ L ++    Q + DA     R  LEQ  QLR  + ++ ++  W+     + L        +  +A  L  EH QF        +   ++   A  L  + HY    I+  A K+   W+     +EDR  ++  S +F+  +E   +     E   K++    G  + +  NS   ++T +     E + A  + C+  R  A      + + S              +   ++++E+     RV      R +RL      ++F     Q L W+++ GE +L   TS G S+   ++L   H +F+  A  T    + LI  AD    + H    EI +    +++R + F+  ++  R+ L+ A+G  + T  + K            +++P +  G E +LR  ++E
Sbjct:  845 VQDLLDFLHEKQQELDAAAEKHRRHLEQCVQLRHLQAEVKQVLGWIRNGESM-LNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEALLQANHYDMDMIRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGTDKLGPNSETDHVTPMVSKHLEQKEAFLKACTLARRNADVFLKYLHRNSVNMPGMLAQIKAPEQQVKNILNELLQRENRVLHFWTLRKRRLDQCQQYVVFERSAKQALEWIHDTGEFYLSTHTSTGSSIHHTQELLKEHEEFQITAKQTKERVKLLIQLADGFCEKGHAHACEIKKWVASVDKRYRDFSLRMDKYRSCLEKALGISSDTNKVSKDLQ--------LDIIPASAPGAEVKLRDANHE 1248          

HSP 5 Score: 57.7658 bits (138), Expect = 2.316e-7
Identity = 36/177 (20.34%), Postives = 77/177 (43.50%), Query Frame = 3
Query: 1248 QVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHS---------RAEAFLANCPHWETAMKQQNIQLGQ 1751
            QVK  + +L +    + H W   + RL+Q  Q  +FE    +  EW++     +L+ +   G +     +L  EH +F +     +E+V  L  +A+   + GH  + +I+     +D  ++ F+  ++   + L+ +    S         + +   A+ P  E  ++  N +L +
Sbjct: 1075 QVKNILNELLQRENRVLHFWTLRKRRLDQCQQYVVFERSAKQALEWIHDTGEFYLSTHTSTGSSIHHTQELLKEHEEFQITAKQTKERVKLLIQLADGFCEKGHAHACEIKKWVASVDKRYRDFSLRMDKYRSCLEKALGISSDTNKVSKDLQLDIIPASAPGAEVKLRDANHELNE 1251          
BLAST of Triple functional domain protein vs. Ensembl Cavefish
Match: kalrnb (kalirin RhoGEF kinase b [Source:ZFIN;Acc:ZDB-GENE-060421-7244])

HSP 1 Score: 142.51 bits (358), Expect = 4.454e-34
Identity = 97/334 (29.04%), Postives = 168/334 (50.30%), Query Frame = 3
Query: 4230 KAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPED-IGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAG----ELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEP-RQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETM 5213
            KA + R+ ++NEM+QTE  YV DL   ++ + + + E      +P+D+  +  ++F NI +I ++HK  F+ E+ +               C    D +   FI++      +YV Y  NK     I+ E   FF E+       E   + +I  + IKP+QRITKY + LKD      +  AG    E+ +A ++M  + KR ND ++L  ++G   +  L + G  +  D F V E    ++ + ++RRVFLF+  ++ ++      +   YQ+K  I ++  ++ EH+E D CKF L           RL L+  +++IK +WVR++RE +
Sbjct:  188 KALRGRMFVLNEMVQTEKDYVKDLGIVVEGFKRRVVEK----GVPEDMTGKDKIVFGNIHQIYDWHKDFFMGELEK---------------CLQDHDKLAELFIKHERRLH-MYVIYCQNKPHSEFIVAEYEAFFEEIKQ-----EVNSRMSISDYLIKPIQRITKYQLLLKDFLKY--SSKAGLDCQEIEKAVDLMFLVPKRCNDMMNLGRLQGY--EGKLTAQGKLLQQDTFFVTEQDSGVLSRSKERRVFLFEQIVIFSELLRKGSSTPGYQFKKSIKVSYLSMEEHVESDPCKFVLACRG----SSERLTLQAANIDIKMEWVRSIRELL 488          
BLAST of Triple functional domain protein vs. Ensembl Cavefish
Match: mcf2la (mcf.2 cell line derived transforming sequence-like a [Source:ZFIN;Acc:ZDB-GENE-090312-122])

HSP 1 Score: 140.584 bits (353), Expect = 7.977e-33
Identity = 117/379 (30.87%), Postives = 174/379 (45.91%), Query Frame = 3
Query: 4224 QEKAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKID--FFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDL---CNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVW-EPRQIIKKGRD--------RRVFLFDVCLVLTKKYNHD----DNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSF-GPIYEENQRTRMTSSTSDVARNA 5303
            +E  A  R H++NE+++TE  YV +L   L+ Y   +        IP  L  +KDVLF N+ EI +FH   FL E+  Y           T C   PE +G CF+    D  +IY KY  NK     +  +  D  FF E    C    E  K  + S+ +KPVQRITKY + LK+L      C+   A +L EA   +L + K +ND +HL  I G   +  L  LG  ++   F+VW E ++   K +D        R +FL    L+  KK   +    +    Y +K  + ++   ITE+ +GD  KF +W        E   +++    EIK  WV  +R+ +  ++ +  G    E  R R T  T+   R A
Sbjct:  585 EENLAVLRRHVMNELLETERAYVEELLCVLQGYADEMDNPSMANLIPNTLHNKKDVLFGNMAEIYQFHNKTFLRELEAY-----------TDC---PELVGRCFLERMTDL-QIYEKYCQNKPRSESLWRQCSDCAFFQE----CQKKLEH-KLGLDSYLLKPVQRITKYQLLLKELLKYSKGCE--GAEDLQEALSSILGILKAVNDSMHLIAITGYEGN--LNDLGRLLMQGSFSVWTEHKKGHAKVKDLARFKPMQRHLFLHQKALLFCKKREENGEGYEKAPSYSFKHSLSMSAVGITENAKGDNKKFEIWCNS----REEVYIVQAASAEIKTAWVNEIRKVLTSQLKACRGERARETHRERETICTNTSGRQA 935          

HSP 2 Score: 105.145 bits (261), Expect = 5.691e-22
Identity = 106/450 (23.56%), Postives = 186/450 (41.33%), Query Frame = 3
Query:  486 LKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKA--LMASSKFTFD-----IQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNI-----QLGQMETVNSLNQYITTLQQ 1799
            L A D+   L+   A L G R   G P++ FP      EL  ++ + ++ YLT +P  +   + F +VID R    W SVK  L  +          V +++P   F++  +  L   SK  F      I + S  ELH  ID++QLTQ   GT  Y +E+WI  R  +E F  +    +    +    L   ++P  V  +   +  H   + + ++  + +  ++G +L   +   L S         TMN D  + +  V++ + QL E        W+  +++LEQ  QLR FE +   +   L+Q     L+ + ++G + +    +  E         +V ++   L    + L +S HYA   I  +  +L    +     L+ + + L  +   HS  E     C      +  Q +     Q G    +  + +Y+ T  Q
Sbjct:   35 LCAADISPDLRKCFAFLSGGRGNNGSPIVVFPEYPAFSELQEQEFHNVLTYLTSVPSLSASGVGFILVIDRRQ-DRWASVKGTLLRIAGSFPGNLQLVLVLRPTTLFQRTLSDFLFKFSKDEFKMKVPVIMLSSVTELHSYIDRTQLTQELGGTQEYCHEKWISHRTAIEGFALMVKKTAQTLQAFGTELAETELPNDVEATSTLLTTHTEKKDE-MKEDLKIALSQGGRLLESINEPLVSDPD-----YTMNHDELENLSTVQRLLGQLDETETAFDDFWERHQTKLEQCLQLRHFEHNFREVRSHLDQVADK-LSGFSEVGISPAHGEHILKELTIHEDRTCEVLDRALALACEGDTLIESSHYAVDSILPKCSELRAVCEEVGAVLKAKKSHLLKAMELHSSLEKATKWCEDGIYLLASQPVDKCQSQDGAEAALQEIERYLDTANQ 476          
BLAST of Triple functional domain protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001772.1 (pep scaffold:Pmarinus_7.0:GL478212:9652:51053:-1 gene:ENSPMAG00000001585.1 transcript:ENSPMAT00000001772.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 603.979 bits (1556), Expect = 0.000e+0
Identity = 383/1109 (34.54%), Postives = 596/1109 (53.74%), Query Frame = 3
Query:  564 PVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMET-VNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRLVE-----EDEKNHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFEAD---VASAIDCLKHEVPTPMSYNF------LNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGKSS----VQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFIRVKAEADELI 3830
            P+L FPA S+ D +  EDL  L+ YL  +P E   K  F+VVIDMR G+ W S+KP+LK L+E          IIKP+ F++KQK    SSKF F+  +VS + L + +D SQLT   DG+ PY +EEW+ +R+ LE+F T A  +  +   L + L R+D P  +  ++R +E+H  ++ ++++AP+  L+ EG  L       L     +  +    N D+Q L+P++   + +L+  R HL   W   + +L+Q +QLRLFE D  +M EW++  + LFL  Y +IG +  QA +L A+H  F  N  +V   +SR+  V + LT++GHYA+ QI+  A  LD +WK F  AL++RS +L +SA FH +AE +L++   W  A        G + T +  L   I   Q L+++   A+ E+ +DG+AL   L  P+  G+  SL A  +YS+  +    L+HEV    +++ET+  HR  RL  RL L +F++DV QVL W+  HGE FL + T +GKSL RA  L   H  FEEVA NT  NA+KL+ AA++L      DPEEI Q    LE RIQ F + VE R+  LD++V FH HTK+L+ W  +L++     ++   ++  V++ + RF  +++ +L A   V+KEG  L  +L E          H + +L Q+   +    ++  ER+++LDL LQLR+FE D   V S ++    E+   +S  F      L + RL R  ++   +       I+ G+E+ Q  +++       G+           + V +  E+  ++ Q L        +  ++   +L+  L  R L+ + +QVL WI   + ML  + +   +L+EAEQLQ EH++FQ    + H  A+     AE  +  +                   H    TI       +  AE VA  WQ+L+   E++ KL+ A+  +YKTS+QV SVL SLE+EY+R EDWC        G    ++  ++++H EQKEAFLKAC LARR +E F+KY+ R     PG +S     +++V   + +L+ +E  VL  W  RK RLD+C  ++  +  A + +
Sbjct:   38 PILTFPARSNHDRIKQEDLRRLITYLASVPCEESAKKGFTVVIDMR-GSKWDSIKPLLKTLQESFPASIHVALIIKPDNFWQKQKTNFGSSKFEFETSLVSIEGLCRLVDPSQLTAELDGSFPYEHEEWLSLRLALEEFVTAASHLLSRLEELQELLSRRDFPLDLEGARRLIEEHAQLKRRVLRAPIEELDREGQAL-------LQRIQGSAGNAGGGNADFQSLVPRISGLLDKLHSTRQHLHQMWHGRKLKLDQCFQLRLFEQDAEKMFEWISHNKALFLEGYTEIGPSHQQAVELQAQHAHFARNSMNVYVNISRIMSVGSRLTEAGHYAAQQIKQIASHLDQEWKCFAAALDERSTLLSMSALFHLKAEQYLSSVDAWYKACGD-----GDLPTELPDLEDAIHHHQGLYEQIATAYAELSTDGKALLDKLQRPLSPGA-DSLTATANYSKAVRQVLDLVHEVLHHQRQLETICQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGIGKSLHRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIFQAAHALEDRIQDFVRRVEQRKLLLDMSVSFHTHTKELWSWLEELQKE-LLDDVYAESVVAVQELISRFQQQQQTMLQATVNVIKEGEDLIQQLRECMVSGNSSIAHVEGVLHQLDEAQAQMEEIFQERKIKLDLFLQLRMFERDAVEVLSDLEAWNDELVRQLS-EFDSDDLTLAEQRLQRHADKSLTMNNLVFDVIRQGQELYQFVTDVQAT--GAGIEVTCDKDVDMGTRVQELLEFLHDKQQELE-------LNAEQHRKRLEQCLQLRHLQTEVKQVLGWIRNGESMLSASLINACSLSEAEQLQREHEQFQHAQQKTHQSALQVQQKAESLLGSV-------------------HYAPDTI-------RECAERVAAHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGGDKLGPGSDSDHVTPMINKHLEQKEAFLKACTLARRNAEVFLKYIHRNNVSMPGMTSHTRGAEQQVKTILSELLQRENRVLHFWTMRKRRLDQCQQYVVFERSAKQAV 1095          

HSP 2 Score: 202.216 bits (513), Expect = 3.936e-52
Identity = 105/278 (37.77%), Postives = 169/278 (60.79%), Query Frame = 3
Query: 4230 KAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKID-FFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLT 5060
            K+A+++  ++ E++QTE  YV DL   L+ Y   +  G+ +I  P  ++ ++D +F N++EI +FH ++FL E+ +Y+               LPED+GHCF+ +A+ F+ +YV Y  NK +  Q++M+    FF+E+          + NTI S+ IKPVQRITKY + LK+L   CD  + GEL EA EVML + KR ND +HL  ++G  E+  L++ G+ IL + F VW+P+ +I+KGR+R +FLF++ LV +K+         Y YK  +L++
Sbjct: 1225 KSARRKEFIMAELLQTEKAYVRDLHECLEIYLWEMTSGVEEI--PPGIINKEDTIFGNMQEIFDFHNNIFLKELEKYEQ--------------LPEDVGHCFVTWADKFQ-MYVSYCKNKPDSTQLIMDHAGTFFDEIQQ-----RHGLANTISSYLIKPVQRITKYQLLLKELLTCCDERT-GELKEALEVMLSVPKRANDAMHLSMLEGFDEN--LDAQGELILQESFQVWDPKTLIRKGRERHLFLFELALVFSKEVRDSSGNSKYLYKHKLLVS 1477          
BLAST of Triple functional domain protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009375.1 (pep scaffold:Pmarinus_7.0:GL476851:10100:39210:1 gene:ENSPMAG00000008478.1 transcript:ENSPMAT00000009375.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 525.783 bits (1353), Expect = 4.446e-158
Identity = 363/1152 (31.51%), Postives = 569/1152 (49.39%), Query Frame = 3
Query:  501 LLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLT-IEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRL----------VEEDEKNHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFEADVASAIDCLK--HEVPTPMSYNF-LNDP-----RLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRR-----------LEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPG----KSSVQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFIRVKAEADELIHNFDEAG 3851
            +L LLK  +A L G RD++GGP++ FPA    +    +DL  L+ YL  +P E   +  F+ V+DMR G+ W  VK +L+ L++ +     +  IIKP+ F++KQK    SSKF F+  +VS   L + +D +QLT   DG+L Y +EEW+E+R   E     A  +  +   L + L RKD P  +  +++   +H  ++  ++ APV  LE E  +L   +R G ++Q   R      NPD Q L P +    ++L+  R HL   W   + +L+Q +QLRLFE D  +M +W+   + LFL    ++G     A++L+ +H  F +N  +    ++R+  VA  L + GHYA+ Q++  A +L  +WK FT A+++RS +L +S  FH R E F AN   W  A  +  +       ++SL   I   Q L  E   A+ EV  +G++L   L  P+  GS  SL A+ +YS   +     +HE     +++E +   R  RL  RL LL+F++DV QVL W++ HGE FL + T VGKSL RA  L   H  FE+VA NT +NAEKL+ AA+ L      DPEE+      LE R+Q F + V  R+  LD++V FHN   +L+ W  +++ +    E       E V++ L  +   + + L+A   V +EG  L  +L                 H + +  Q++    +  D   ER VRL L L+ R FE +    +  L   HE     S  F   DP     RL    ++   +    +  +  G+ ++Q   E     ++ G+                  E   E    +   + +L+  V E  ++L+   D  R           L+ + +QVL+WI   + ML  + L   +L EAE LQ EH+ FQ  + + H  A        + +QQ +  L             + H  T  + S        AE+VA  WQ+L+   E++ KL+ A+  +YKTS QV SVL SLE+EY+R +DWC        G +  ++  ++ +H EQKEAFLKAC LARR +E F+K + R     PG        +++V   + +L+ +E  VL  W  RK RL++C  ++  +  A +++    + G
Sbjct:   16 VLPLLKDKVAYLSGGRDRQGGPIIMFPARGSLERARPDDLRELIAYLASVPSEEAGRRGFTAVVDMR-GSKWEGVKLLLRTLQDALPGRVHAALIIKPDNFWQKQKTNFGSSKFEFETALVSVDGLARVVDLAQLTSELDGSLDYRHEEWLEMRGAAERLAGRARHLLSRLEELQEMLARKDSPGELERARQLASEHARLKRTVLAAPVEALEQETRRLVARVRSG-DAQAFPRC-----NPDLQALGPWLAGLTERLHTTRQHLHQVWHVRKLKLDQCFQLRLFEQDADKMFDWIEHNKELFLKSCTEMGSGHQHASELHTQHSHFAMNSMNAYVNINRIVSVAGRLAEGGHYAAQQLRQTAERLQREWKGFTAAIDERSLLLSMSVRFHLRGEQFQANVDGWCKACGEGALP----SDIHSLEAAILRHQGLSDEIGQAYAEVSREGKSLLEKLQRPLSPGSAESLTASANYSGAVQLILDCVHEALHKHRQLEALCTLRKLRLHQRLQLLVFKQDVRQVLEWIDTHGETFLSKHTGVGKSLHRARALQKRHADFEQVAQNTYVNAEKLLEAAEALAQSGECDPEEVYCAAHALEERVQDFVRRVGQRKLLLDMSVSFHNRVSELWGWLEEVQHDDALEEAGESGDAEAVQELLSDWRRRQHSTLEAIASVAREGDDLIQQLRSVFKTGGGAPHASSLAHLQAVRRQLEEATASMEDFFDERGVRLQLLLRFRSFEREATEVMSSLSVWHEEIERRSTEFSTEDPTEAERRLRFHSDKSLGLNNLALDLLAQGQGLMQCMLE----EQAAGL------------------EVVCEGDVDMCVRVQELLQCVQERRLQLEGSADLHRQRLEQCLQLCQLQDEVKQVLSWIRNGESMLNASLLSACSLEEAESLQREHEHFQVAIEQTHQSA--------LRVQQRAAAL-----------LGAGHYATDAVRS-------CAEMVAQHWQRLLLRVEDRLKLVTASVAFYKTSQQVCSVLDSLEQEYKREDDWCGGSDKLGPGAENDHVEPIIHKHLEQKEAFLKACTLARRNAEVFLKCIHRNSVTQPGFLSPARGPEQQVKVILGELLQRENRVLHHWTVRKRRLEQCQQYVLFERSAKQVLSWIHDTG 1108          

HSP 2 Score: 71.2478 bits (173), Expect = 3.096e-12
Identity = 76/376 (20.21%), Postives = 154/376 (40.96%), Query Frame = 3
Query: 1239 LIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVN--SLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGF 2357
            +  +V++ +Q + E R  L+   D  R RLEQ  QL   +D++ ++  W+     +          +  +A  L  EH  F V      +   R+   A  L  +GHYA+  +++ A  +   W+     +EDR  ++  S +F+  ++   +     E   K+++   G  + +   + N ++  +     E + A  + C+  R  A      + + S T            +    ++ E+     RV      R +RL      ++F     QVL+W+++ GE +L   +  G++   +  L   H  F   A    +  + L+  A+  +++ H    +  Q  T +++R + F+      R  L+ A+G 
Sbjct:  824 MCVRVQELLQCVQERRLQLEGSADLHRQRLEQCLQLCQLQDEVKQVLSWIRNGESMLNASLLS-ACSLEEAESLQREHEHFQVAIEQTHQSALRVQQRAAALLGAGHYATDAVRSCAEMVAQHWQRLLLRVEDRLKLVTASVAFYKTSQQVCSVLDSLEQEYKREDDWCGGSDKLGPGAENDHVEPIIHKHLEQKEAFLKACTLARRNAEVFLKCIHRNSVTQPGFLSPARGPEQQVKVILGELLQRENRVLHHWTVRKRRLEQCQQYVLFERSAKQVLSWIHDTGEFYLSTHSCTGQTPDESRALLQEHDSFSSSAKRVCVRVKLLLGLAESFLAKGHAHAVDFRQWVTAVDKRYRDFSCRAHKHRAALEAALGL 1198          
BLAST of Triple functional domain protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001767.1 (pep scaffold:Pmarinus_7.0:GL478212:7918:46552:-1 gene:ENSPMAG00000001585.1 transcript:ENSPMAT00000001767.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 519.62 bits (1337), Expect = 3.219e-154
Identity = 352/1087 (32.38%), Postives = 552/1087 (50.78%), Query Frame = 3
Query:  654 DENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMET-VNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRLVEEDEK---------NHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFEAD---VASAIDCLKHEVPTPMSYNF------LNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQ--------------VLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGKSS----VQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFI 3800
            +E+ KK  F+VVIDMR G+ W S+KP+LK L+E          IIKP+ F++KQK    SSKF F+  +VS + L + +D SQLT   DG+ PY +EEW+ +R+ LE+F T A  +  +   L + L R+D P  +  ++R +E+H  ++ ++++AP+  L+ EG  L          Q    S     N D+Q L+P++   + +L+  R HL   W   + +L+Q +QLRLFE D  +M EW++  + LFL  Y +IG +  QA +L A+H  F  N  +V   +SR+  V + LT++GHYA+ QI+  A  LD +WK F  AL++RS +L +SA FH +AE +L++   W  A        G + T +  L   I   Q L+++   A+ E        A     P   G   +     +  E R+       ++          +AHR  RL  RL L +F++DV QVL W+  HGE FL + T +GKSL RA  L   H  FEEVA NT  NA+KL+ AA++L      DPEEI Q    LE RIQ F + VE R+  LD++V FH HTK+L+ W  +L++     ++   ++  V++ + RF  +++ +L A   V+KEG  L  +L +  ++          H + +L Q+   +    ++  ER+++LDL LQLR+FE D   V S ++    E+   +S  F      L + RL R  ++   +       I+ G+E+ Q  +++       G+           + V +  E+  ++ Q L        +  ++   +L+  L  R L+                   VL WI   + ML  + +   +L+EAEQLQ EH++FQ                    +QQ                     +L  +++      +  AE VA  WQ+L+   E++ KL+ A+  +YKTS+QV SVL SLE+EY+R EDWC        G    ++  ++++H EQKEAFLKAC LARR +E F+KY+ R     PG +S     +++V   + +L+ +E  VL  W  RK RLD+C  ++
Sbjct:    3 EESAKK-GFTVVIDMR-GSKWDSIKPLLKTLQESFPASIHVALIIKPDNFWQKQKTNFGSSKFEFETSLVSIEGLCRLVDPSQLTAELDGSFPYEHEEWLSLRLALEEFVTAASHLLSRLEELQELLSRRDFPLDLEGARRLIEEHAQLKRRVLRAPIEELDREGQAL---------LQRIQVSGEAGGNADFQSLVPRISGLLDKLHSTRQHLHQMWHGRKLKLDQCFQLRLFEQDAEKMFEWISHNKALFLEGYTEIGPSHQQAVELQAQHAHFARNSMNVYVNISRIMSVGSRLTEAGHYAAQQIKQIASHLDQEWKCFAAALDERSTLLSMSALFHLKAEQYLSSVDAWYKACGD-----GDLPTELPDLEDAIHHHQGLYEQIATAYAE--------AGPPRCPPEHGREGASGQTAEAPEPRRRLADGHGQLLES-------RAHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGIGKSLHRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIFQAAHALEDRIQDFVRRVEQRKLLLDMSVSFHTHTKELWSWLEELQKE-LLDDVYAESVVAVQELISRFQQQQQTMLQATVNVIKEGEDLIQQLRKTKQECMVSGNSSIAHVEGVLHQLDEAQAQMEEIFQERKIKLDLFLQLRMFERDAVEVLSDLEAWNDELVRQLS-EFDSDDLTLAEQRLQRHADKSLTMNNLVFDVIRQGQELYQFVTDVQAT--GAGIEVTCDKDVDMGTRVQELLEFLHDKQQELE-------LNAEQHRKRLEQCLQLRHLQTNCSDSVCVCVTGRGARLYVLGWIRNGESMLSASLINACSLSEAEQLQREHEQFQ--------------------VQQ------------------KAESLLGSVHYAPDTIRECAERVAAHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGGDKLGPGSDSDHVTPMINKHLEQKEAFLKACTLARRNAEVFLKYIHRNNVSMPGMTSHTRGAEQQVKTILSELLQRENRVLHFWTMRKRRLDQCQQYV 1009          

HSP 2 Score: 253.832 bits (647), Expect = 5.120e-68
Identity = 127/327 (38.84%), Postives = 201/327 (61.47%), Query Frame = 3
Query: 4230 KAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKID-FFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRE 5207
            K+A+++  ++ E++QTE  YV DL   L+ Y   +  G+ +I  P  ++ ++D +F N++EI +FH ++FL E+ +Y+               LPED+GHCF+ +A+ F+ +YV Y  NK +  Q++M+    FF+E+          + NTI S+ IKPVQRITKY + LK+L   CD  + GEL EA EVML + KR ND +HL  ++G  E+  L++ G+ IL + F VW+P+ +I+KGR+R +FLF++ LV +K+         Y YK  +L +E  +++H+EGD CKF LW GR P   + +LVLK   ++ KQ W++ +RE
Sbjct: 1156 KSARRKEFIMAELLQTEKAYVRDLHECLEIYLWEMTSGVEEI--PPGIINKEDTIFGNMQEIFDFHNNIFLKELEKYEQ--------------LPEDVGHCFVTWADKFQ-MYVSYCKNKPDSTQLIMDHAGTFFDEIQQ-----RHGLANTISSYLIKPVQRITKYQLLLKELLTCCDERT-GELKEALEVMLSVPKRANDAMHLSMLEGFDEN--LDAQGELILQESFQVWDPKTLIRKGRERHLFLFELALVFSKEVRDSSGNSKYLYKHKLLTSELGVSDHVEGDACKFTLWVGRTPT-SDNKLVLKASSIDTKQDWIKHIRE 1456          
BLAST of Triple functional domain protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009380.1 (pep scaffold:Pmarinus_7.0:GL476851:10109:39210:1 gene:ENSPMAG00000008478.1 transcript:ENSPMAT00000009380.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 293.508 bits (750), Expect = 5.129e-82
Identity = 162/475 (34.11%), Postives = 255/475 (53.68%), Query Frame = 3
Query:  501 LLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYS 1925
            +L LLK  +A L G RD++GGP++ FPA    +    +DL  L+ YL  +P E   +  F+ V+DMR G+ W  VK +L+ L++ +     +  IIKP+ F++KQK    SSKF F+  +VS   L + +D +QLT   DG+L Y +EEW+E+R   E     A  +  +   L + L RKD P  +  +++   +H  ++  ++ APV  LE E  +L   +R G ++Q   R      NPD Q L P +    ++L+  R HL   W   + +L+Q +QLRLFE D  +M +W+   + LFL    ++G     A++L+ +H  F +N  +    ++R+  VA  L + GHYA+ Q++  A +L  +WK FT A+++RS +L +S  FH R E F AN   W  A  +  +       ++SL   I   Q L  E   A+ EV  +G++L   L  P+  GS  SL A+ +YS
Sbjct:   13 VLPLLKDKVAYLSGGRDRQGGPIIMFPARGSLERARPDDLRELIAYLASVPSEEAGRRGFTAVVDMR-GSKWEGVKLLLRTLQDALPGRVHAALIIKPDNFWQKQKTNFGSSKFEFETALVSVDGLARVVDLAQLTSELDGSLDYRHEEWLEMRGAAERLAGRARHLLSRLEELQEMLARKDSPGELERARQLASEHARLKRTVLAAPVEALEQETRRLVARVRSG-DAQAFPRC-----NPDLQALGPWLAGLTERLHTTRQHLHQVWHVRKLKLDQCFQLRLFEQDADKMFDWIEHNKELFLKSCTEMGSGHQHASELHTQHSHFAMNSMNAYVNINRIVSVAGRLAEGGHYAAQQLRQTAERLQREWKGFTAAIDERSLLLSMSVRFHLRGEQFQANVDGWCKACGEGALP----SDIHSLEAAILRHQGLSDEIGQAYAEVSREGKSLLEKLQRPLSPGSAESLTASANYS 476          

HSP 2 Score: 181.03 bits (458), Expect = 6.002e-46
Identity = 178/669 (26.61%), Postives = 287/669 (42.90%), Query Frame = 3
Query: 1953 MHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAHDPEEILQEQTE-LERRIQAFTKAVENRRNTLDLAVGFH----NHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRLVEEDEKNHFKVLL--------MQVQSDKETATDLLTERQVRLDLCLQLRLFEADVASAIDCLK--HEVPTPMSYNF-LNDP-----RLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRR-----------LEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPG----KSSVQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFIRVKAEADELIHNFDEAG 3851
            +H+VW            R  +L     L +F +D  ++  W+  + E FLK  T +G   Q A +L+  H  F   + N  +N  +++  A  L    H   + L++  E L+R  + FT A++ R   L ++V FH        ++  W     E       LP  I  +E  + R       I  A  +V +EG +L  +L         + L         +Q+  D     D   ER VRL L L+ R FE +    +  L   HE     S  F   DP     RL    ++   +    +  +  G+ ++Q   E     ++ G+                  E   E    +   + +L+  V E  ++L+   D  R           L+ + +QVL+WI   + ML  + L   +L EAE LQ EH+ FQ  +          + F +  +QQ + Q        AA    + H  T  + S        AE+VA  WQ+L+   E++ KL+ A+  +YKTS QV SVL SLE+EY+R +DWC        G +  ++  ++ +H EQKEAFLKAC LARR +E F+K + R     PG        +++V   + +L+ +E  VL  W  RK RL++C  ++  +  A +++    + G
Sbjct:  270 LHQVWHV----------RKLKLDQCFQLRLFEQDADKMFDWIEHNKELFLKSCTEMGSGHQHASELHTQHSHFAMNSMNAYVNINRIVSVAGRLAEGGHYAAQQLRQTAERLQREWKGFTAAIDERSLLLSMSVRFHLRGEQFQANVDGWCKACGEG-----ALPSDIHSLEAAILRHQGLSDEIGQAYAEVSREGKSLLEKLQRPLSPGSAESLTASANYSGAVQLILDCVPMEDFFDERGVRLQLLLRFRSFEREATEVMSSLSVWHEEIERRSTEFSTEDPTEAERRLRFHSDKSLGLNNLALDLLAQGQGLMQCMLE----EQAAGL------------------EVVCEGDVDMCVRVQELLQCVQERRLQLEGSADLHRQRLEQCLQLCQLQDEVKQVLSWIRNGESMLNASLLSACSLEEAESLQREHEHFQVAIE---------SLFPDRSLQQ-THQSALRVQQRAAALLGAGHYATDAVRS-------CAEMVAQHWQRLLLRVEDRLKLVTASVAFYKTSQQVCSVLDSLEQEYKREDDWCGGSDKLGPGAENDHVEPIIHKHLEQKEAFLKACTLARRNAEVFLKCIHRNSVTQPGFLSPARGPEQQVKVILGELLQRENRVLHHWTVRKRRLEQCQQYVLFERSAKQVLSWIHDTG 884          

HSP 3 Score: 65.4698 bits (158), Expect = 1.706e-10
Identity = 76/385 (19.74%), Postives = 155/385 (40.26%), Query Frame = 3
Query: 1239 LIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLV---------NCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVN--SLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGF 2357
            +  +V++ +Q + E R  L+   D  R RLEQ  QL   +D++ ++  W+     +          +  +A  L  EH  F V         +     +   R+   A  L  +GHYA+  +++ A  +   W+     +EDR  ++  S +F+  ++   +     E   K+++   G  + +   + N ++  +     E + A  + C+  R  A      + + S T            +    ++ E+     RV      R +RL      ++F     QVL+W+++ GE +L   +  G++   +  L   H  F   A    +  + L+  A+  +++ H    +  Q  T +++R + F+      R  L+ A+G 
Sbjct:  591 MCVRVQELLQCVQERRLQLEGSADLHRQRLEQCLQLCQLQDEVKQVLSWIRNGESMLNASLLS-ACSLEEAESLQREHEHFQVAIESLFPDRSLQQTHQSALRVQQRAAALLGAGHYATDAVRSCAEMVAQHWQRLLLRVEDRLKLVTASVAFYKTSQQVCSVLDSLEQEYKREDDWCGGSDKLGPGAENDHVEPIIHKHLEQKEAFLKACTLARRNAEVFLKCIHRNSVTQPGFLSPARGPEQQVKVILGELLQRENRVLHHWTVRKRRLEQCQQYVLFERSAKQVLSWIHDTGEFYLSTHSCTGQTPDESRALLQEHDSFSSSAKRVCVRVKLLLGLAESFLAKGHAHAVDFRQWVTAVDKRYRDFSCRAHKHRAALEAALGL 974          
BLAST of Triple functional domain protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000080.1 (pep scaffold:Pmarinus_7.0:GL476403:365803:389077:1 gene:ENSPMAG00000000073.1 transcript:ENSPMAT00000000080.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.9005 bits (237), Expect = 1.154e-21
Identity = 79/256 (30.86%), Postives = 120/256 (46.88%), Query Frame = 3
Query: 4512 PEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKID--FFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAG--ELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVW-EPRQIIKKGRD--------RRVFLFDVCLVLTKKYNHD----DNKIFYQYKSHILLTECNITEHIEGDQCKFAL-WTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERI 5225
            PE IG CF++   DF+ IY KY  NK     +  +  D  FF E            K  + S+ +KPVQRITKY + LK++   C   SAG  EL EA   ML + K +ND +H   I G   D  +  LG  ++   F+VW E R+   K ++        R +FL+   L+  K+        +    Y +K  + +    ITE  +GDQ KF + + GR     E    ++   +E+K  WV  +R+ +  ++
Sbjct:   13 PELIGRCFLQRKEDFQ-IYEKYCQNKPRSEAVWRQFADAAFFQECQRRL-----DHKLALDSYLLKPVQRITKYQLLLKEML-KCSKNSAGTQELEEALAGMLSILKAVNDSMHQIAITGFEGD--VRDLGRLLMQGAFSVWAESRKGHSKVKELARFKPMQRHLFLYPKLLLFCKRREETGEGYEKAPSYSFKHALKMDGVGITEVSKGDQKKFEVSYNGR-----EEVYTIQASSVEVKTAWVHEIRKVLTSQL 254          
BLAST of Triple functional domain protein vs. Ensembl Nematostella
Match: EDO43752 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXC9])

HSP 1 Score: 593.193 bits (1528), Expect = 1.541e-178
Identity = 459/1613 (28.46%), Postives = 789/1613 (48.92%), Query Frame = 3
Query:  549 DKRGGPVLCFPANS-HADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEML--PLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRL-------VEEDEKNHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFEAD-------VASAIDCLKHEVPTPMSYNFLNDPRLARSMNELEEVTATFIAAIKSGE-EVIQKGSELSRAFESVGVNFPAXX-XXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAE-DWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGKSSVQEKVDASIKDLM----VKEQAVLQAWAARKSRLDECLDFIRVKAEADEL---IHNFDEAGVSSPKLD---EIYKRLIHNLESKNLNQHTEVIKLIRNRLNLRFANQYLLKPNQVQTG----QPGQAVPTTGQLIGQSQPAKLRTQLSSGSNYGSGDLNRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQIQEKAAKKRIHLINEMIQTEIYYVNDLETYLK------------------TYYKAIAEGI--SDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEK-IDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQE 5219
            D+RGG ++  PA++   ++ D E +  +V YL  LP E+  +L FS+++DMR+  TW + KP+L+ L+EC  +   SV+IIKPE F+E+ K  + +SK +F+  + S   L + I+ SQLT    GTL Y + +W+ +R+ LE F   A  +  K   +   L + +  ET    K +++ +  V+  I++APV +L+ EG+++   L+   N  ++      T+  DY++   QV++ V+ L   R  L+  W+  + +L+Q +Q R+F+ D  +M +W+ + R  FL  Y +IG     A +L  EHR F  +C +V   + R+  +A+ L+++GHY + +I+  A  +D +WKSF   +  RS++L  S ++H  +E FL N  +W+  +  ++  L +   V+++   I  L +L QE   +   V +D +AL   L  P        L +  +YSE   H   +  EV    +++  +   +  RL   L L MF +D  QV+ W+ EHGE FLK+ T +GKSL +AE L   H +FE++A NT  NA KL+ AA  L      +PEEI +     E+R+Q F   V  R+  L LAV F+  T+ L +   QLK      E+   P  I  V   L    ++    LD+    + EG T+   L       ++    +H + ++ ++   +       + R+ +L+L LQLR FE         + S  + L+  V  P      + PR  +++   E+    ++  I++       +G EL  A +   +         + +          +E + R   +L DL    +E  IKL+  L  R+LE  ++QV+ W+   + ML     + S+L EAE L  EHD+FQ  + +    A      AE  I+   F+  PE                 TI +        A+ + ++WQ L+  +E +  L+ A+ N++   + V S++  L +EY+  + D C     +    ++  +  ++  + + +E+ +      + T++ ++  +  +     G     ++ +  +KD+M    V+EQ V+  W  RK+  + C+ ++ ++  A E    IH   E  +SS   D   E   R+      K  ++  E  + IR+++         L       G    Q   AV    +    S+ +K R +L +   Y + D          +           T   S    +++ + ++AK++  ++NE++QTE  YV DL+  ++                  + Y A+   +  S   +P  LV ++ ++F NI++I +FH + FL E+ +Y+                PED+G  FI +   F + YV Y  NK   N +++E   +FF++L +    G      +I ++ IKPVQRITKY + LKDL   C+ GS   L    +VML + +R ND +++  + GL E+  L+ LG  IL D FTV++P+ + +KG+DR VFLF+  LV +K+   +D K+ Y YK  +  +E  +TEHI  D CKFA+WTG+ PP  E + V+K  ++E+KQ WV+ LRE +Q+
Sbjct:    2 DRRGGRIITLPAHTFQGEQQDEESIGQIVSYLANLPSEDECRLGFSIILDMRS-CTWSTAKPVLRSLQECFPEKIHSVYIIKPEGFWERHKTNLKTSKLSFETTLTSLDGLAKFIEPSQLTASLGGTLKYDHTDWLNMRLALEKFLYEAMALLSKLDEIQDGLSKDEFAETQDGLKDQIKKNHHVKKWIVKAPVEILQEEGERI---LKSIKNPTSEHLVDGFTIQ-DYKKAEQQVQELVESLILKRQRLRELWNIRKQKLDQCFQFRVFQIDAHKMLKWIKENREDFLINYSEIGNDTESAEELEEEHRNFESSCMNVYGNIHRVLEIADKLSEAGHYEADRIEALAESVDREWKSFDMEVNQRSSLLSCSVAYHKHSEEFLRNIKYWKQYL--EDPDLIKNSNVSTVEIKIQELDKLRQEFEDSFHTVSTDSKALLGELQKPAVAFDDQFLKSP-EYSEASSHVMDIYLEVHEHHRQLGILWEKQRTRLKDHLHLCMFDQDSKQVIRWIEEHGETFLKKHTGIGKSLVKAEALLKRHEEFEKIAQNTYTNAAKLLEAARHLAQSGECNPEEIQKRVDYFEKRVQEFIGRVNRRKGLLKLAVNFYTRTQKLTELVEQLKSQLELEEVSDNPDNIATV---LTNLKHQGEATLDSIHTAIDEGETIVEELKLASADGMDSSSLHHVEKVIKELDRVRRAIEHSWSRRRQQLELWLQLREFERAAKQLKDRLESCEELLERGVVAP------DLPRAKQALTHHED----YVQDIENASLRTFCRGEELIDALKQSEIELRVKDPLTAENIDAQTHVHNLLEVLHRKRRDLRDL---AEERKIKLEQNLLLRQLESDAKQVVGWVRNGEAMLYACTDLGSSLVEAEALLREHDEFQRAIEKTCQSATEVRQRAEKLIKDGHFE--PE-----------------TIRA-------CADAMTNRWQHLMERSENRKVLITASFNFFNAGEAVGSLMDRLVREYKTEDGDPCSKLIETETTKKLEAMRAIVQSYDDDRESIVHGFSEVKYTADSYLNMITAREVHVDGSY---DRAEQQVKDVMDVLKVQEQVVMDLWGVRKTMAEHCVQYLELETSAKEALDWIHENGEFYLSSHPNDGDTEAETRMF----LKEHHEFKEAAEEIRDKVRTMLQQAESLVTKSCHHGDGIRQWATAVEKRYKDFS-SRMSKYRVRLETKLGYPTID----QEVRILAPQDQPAFALRETSKDSGIHEMTEEKRRSAKRKEFIVNELLQTERAYVGDLKCVIEVSSVRISSKRRMPLRISLSGYCAVFPALRSSAYDVPAGLVGKESIIFGNIQDIYKFHSNTFLQEMEKYETH--------------PEDVGEAFIEWGETFVRFYVSYCKNKPFSNSLLIEHGGNFFSDLQASYGHG-----LSISAYLIKPVQRITKYQLLLKDLLTCCE-GSENSLQAGLDVMLSVPRRANDAMYVNMLHGLEEN--LDHLGRIILQDAFTVFDPKLLRRKGKDRHVFLFEQALVFSKETKDNDGKVSYLYKYKLKTSELGVTEHIAEDPCKFAVWTGK-PPQSEDKRVIKAANIEVKQLWVKELRELIQQ 1529          
BLAST of Triple functional domain protein vs. Ensembl Nematostella
Match: EDO32328 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVF8])

HSP 1 Score: 132.88 bits (333), Expect = 4.643e-31
Identity = 99/335 (29.55%), Postives = 162/335 (48.36%), Query Frame = 3
Query: 4239 KKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNK--DEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNC--DTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIK----KGRDRRVFLFDVCLVLTKKYNHDDNK--IFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETM 5213
            KKR  ++ E++ TE  YV DL+  ++ Y           KIP +L  +++ +F NI+EILEFH+  FL E+++              C   P+ +G  F     +F+K Y  Y  NK   E  Q  +  + +  E  +         K  + ++ +KPVQRITKY + L+++  N   D  +   L EA+  M  + + +ND +H   +KG   +  L  LG  +L D F VW      K    KG  R+VFL++  ++ +K+      K  + Y +K+ I  ++  ITE I G   KF LW   +P   E   +L+  + EIK++W+  +R  +
Sbjct:  483 KKRSQIMAELVTTEKDYVRDLDHIVRGYLHEFERAAG--KIPIELFDQRETIFGNIEEILEFHRCDFLEELNK--------------CSETPKSVGKVFTERRGEFEK-YALYCKNKPASEALQQQLINVPYIRECQANL-----GHKLPLTAYLLKPVQRITKYQLLLREMMKNTKNDRIAYMNLMEAFHAMQNVLRHLNDVMHSSGLKGYHGN--LGDLGKLLLQDPFLVWYTGARRKLPPLKGSQRQVFLYEKMVIFSKREEDSTTKDAVTYHFKNSIKTSDVGITETINGAPLKFELW---LPGRTEV-FLLQANNSEIKERWISEIRSVL 789          

HSP 2 Score: 68.5514 bits (166), Expect = 3.629e-11
Identity = 70/347 (20.17%), Postives = 150/347 (43.23%), Query Frame = 3
Query:  678 FSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASS---KFTFDIQIV-SAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEW-LNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANC 1703
            F+ +ID R  + W S+   L  L++      + V+++KP+ F ++      SS   +  F I ++ +  +L + + + QLT   DG   Y ++EW++ R  +E      + +  +  S  + L + +I  ++ + +  ++  + +  K I+  +      G K+        ++ +     +  M PD +    +++  +Q+LY+        W     R+ Q  +   FE +IG+++   L    H  +T  +D+G + + A  L  + R+F        E+   L      + ++GHY+   I+ ++ +L      FT     R + L+++   H   E     C
Sbjct:    2 FTFIIDKRK-SKWSSLNNTLSKLQKTFPDRVNCVYVLKPQGFMQRFIGGSLSSEDAQAAFRIVVLGTVSDLLKYVTRDQLTTDLDGEFDYKHDEWVQHRTAIERLEKTIYQLECRMDSHRQQLSKTEILSSIQDMEHTLDTQQEI-WKDIKEDIASAHLTGKKVA-----VSSNSSSYYHHFHNMTPDVKANTTELEGLLQRLYQSEEDFGKFWVDHEKRIRQGLEFSFFEQEIGQVTGLILTATGH--VTAMNDVGDSRAAAEVLLDDARKFAEKSQGHIERALGLAARGIDMAENGHYSRDTIRLRSEELRQLCSDFTEHARKREHHLKVAMDIHEILEQVSKWC 339          
BLAST of Triple functional domain protein vs. Ensembl Nematostella
Match: EDO31420 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXZ7])

HSP 1 Score: 98.2117 bits (243), Expect = 6.832e-22
Identity = 89/318 (27.99%), Postives = 145/318 (45.60%), Query Frame = 3
Query: 4251 HLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQ---DLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCN-NCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWV 5192
            +++ EMI+TE  YV  L+  ++ Y       IS +  P     L  +K++LF NI+ + +FHK  FL E+           EN   C   P  IG CF+++   F  +Y  Y  NK   +Q++    D  N     C   E   K  + S+ +KPVQR+ KY + L+D+      +    EL  A E++    +  ND + +  ++    D  ++  G  +  D+F VW      KK   RRVFLF+  ++ +K          Y YK  +   +  +TE +     +F LW  R   +GE   +L+   +E+K  W+
Sbjct:    1 YIVTEMIETERDYVKSLDYIVENY-------ISQMDNPDLLPSLKGKKNILFGNIERLSDFHKGSFLREL-----------EN---CKERPLQIGSCFLKWERQFY-LYALYNMNKPRSDQLLS---DHGNAYFRIC-QKELGDKLDLGSYLMKPVQRMCKYGLLLRDMIKVYGGSTRVSELKAAEEMVKFQLRHGNDLLAMDSLRAC--DINVKEQGRLLRQDNFIVWHA----KKKTRRRVFLFEDLVLFSKAKKQAGGVDLYFYKHSLKTADIGLTESVGDSGLQFELWFRR-RKIGE-TYILQPSSVEVKHAWL 284          
BLAST of Triple functional domain protein vs. Ensembl Nematostella
Match: EDO37558 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFH2])

HSP 1 Score: 90.5077 bits (223), Expect = 7.908e-18
Identity = 79/325 (24.31%), Postives = 140/325 (43.08%), Query Frame = 3
Query: 4248 IHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQER 5222
            ++ ++E+I TE  Y+ D++  LK Y   IA    D   P +L   +  +FSNI++I ++H + F   +                C  +P  +G  F    +  +++Y  Y  NK + + ++M   D F +   +      Q    I  + IKPVQRITKY + L                                      +  P+D      GD IL +   V + +   +K R+  VFLF+  ++LT+  + +  +   ++ + I +     TE ++ D CK+A+W  +    G    VLK   +EIKQ W++A+ E  +++
Sbjct:  323 LYAVSELIHTEESYIRDMDHVLKGYMSEIA----DASAPSELKGNQKFIFSNIQDIHDWHANKFYTFLKD--------------CEDMPSQLGDVFTYAESKLEELYTVYCRNKPKSDSLVMTYKDTFFQECRHRLGHRLQ----ITDYLIKPVQRITKYQLLL--------------------------------------RAKPDD-----TGDLILRETLVVADGKA-KQKSRECNVFLFEKVILLTEP-SEEGGRPTLRFLNSIKVRGLGQTESVDSDPCKWAVWLRKRS--GSEIYVLKAPSIEIKQIWMKAIIECNEKK 578          
BLAST of Triple functional domain protein vs. Ensembl Nematostella
Match: EDO43753 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXD0])

HSP 1 Score: 74.7146 bits (182), Expect = 2.143e-14
Identity = 74/272 (27.21%), Postives = 127/272 (46.69%), Query Frame = 3
Query: 4254 LINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMME-KIDFFNEL---MSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAG--ELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHI 5051
            ++ E+IQTE  YV  L   +  Y   IAE  S   +P++L  ++ ++F NIK+I E+HK            T   K E+       PE +   F++ A    ++YV Y  NK +   ++ E K  +F ++   + Y  S        I+ + IKPVQR+ KY + LKD     +       EL  A  +M  + K+ ND +++  ++G      + + G+ +L D   V +     K  + RRVFLF+  ++ ++ +    +   Y Y+  I
Sbjct:    2 VLRELIQTEQDYVTSLGEVVDGY---IAE-FSKPDLPEELKGKERMVFGNIKQIYEWHK------------TELEKCEDA------PEKLASVFLK-AERRLQMYVIYCQNKPKSTALVHEFKETYFTDMKDRLGYRLS--------IEDYLIKPVQRVMKYQLLLKDFVKYTERAGLDIIELKRALHLMHVVPKKANDFLNVGMLEGYTGK--ITAQGNLVLQDTLMVMDVNAKAKPVK-RRVFLFEQLVIFSEPFERKTDWTVYIYRHSI 239          
BLAST of Triple functional domain protein vs. Ensembl Medaka
Match: ENSORLT00000018136.2 (triple functional domain protein [Source:NCBI gene;Acc:101159451])

HSP 1 Score: 634.024 bits (1634), Expect = 0.000e+0
Identity = 394/1150 (34.26%), Postives = 622/1150 (54.09%), Query Frame = 3
Query:  489 KAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRLVEE----------DEKNHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFEADVASAIDCLK--HEVPTPMSYNF------LNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGKSS----VQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFI---RVKAEADELIHNFDEAGVSS 3860
            +A ++L +LK  +A L G RDKRGGPVL FP+ ++ D +  +DL  LV YL  +P E+V K  F+++IDMR G+ W S+KP LKVL++    C     IIKP+ F+EKQ+    SSKF F+  +VS + L + +D SQLT  F+G+L Y++EEWIE+R+  E+F   A  M  +   + + + RKD P+ +  ++  +E+H S++ K+++AP+  L  EG +L       L   + + S     N D Q L+ ++ + + +L+  R H+   W   + +L+Q +QLRLFE D  +M +W+   + LFL  Y DIG    QA +L  +H+ F +NC +V   ++R+  V   L DSGHYA+  I+  + +L+ +WK+F  AL++RS +L++SA+F  + + ++ N   W     + ++       +  L   I   Q L++    A+ EV  DG+AL   L  P+   S  SL A+ +YS+   H  +++HE+    +++E +  HR  RL  RL L +F++DV QVL W+  HGE FL + T VGKSL RA  L   H  FE+VA NT  NA+KL+ AA++L      DPEEI Q   +LE RIQ F + VE R+  LD++V FH H K+L  W   L++     ++   ++E V+D ++ F  +++ IL  +   +KEG  L  +L +              NH + +L Q+   +    DL  ER+++LDL LQLR+FE D  + I  L+  +E  T    +F      + + RL    ++   +       I  G+E++   S++    ++ GV       G   + V +  E+  E+ Q L        +A +     L+  +  R L+ + +QVL WI   + ML    +  S+L EAEQLQ EH++FQ  + + H  A+     AE+ +Q                   + H     I       ++ AE VA  WQ+L+   E++ KL+ A+  ++KTS+QV SVL SLE+EY+R EDWC          +  ++  ++S+HFEQKEAFLKAC LARR ++ F+KY+ R     PG  S     +++V   + +L+ +E  VL  W  RK RLD+C  F+   R   +A E IH+  E  +S+
Sbjct:   30 RAMEVLPILKEKVAFLSGGRDKRGGPVLTFPSRTNHDRIRADDLRRLVAYLYSIPSEDVCKHGFTIIIDMR-GSKWESIKPFLKVLQDSFPSCIHVALIIKPDNFWEKQRTNFGSSKFEFETTMVSLEGLTKVVDPSQLTADFEGSLDYNHEEWIEVRVAFEEFSGHATQMVARLEEMQETVSRKDFPQDLEGARLMIEEHASLKKKVMKAPIEELNTEGQRL-------LQRIHSSSSGNSVCNIDTQSLVLRITQLLDKLHSIRQHILQSWHVRKLKLDQCFQLRLFEQDAEKMFDWIMHNKGLFLAGYTDIGNNHLQAVELQTQHKHFAMNCMNVYVNINRILSVGKRLLDSGHYATQPIKQISGQLEQEWKAFAAALDERSTLLEMSANFQQKCDKYINNVESWCKVCGEVDLP----AELQDLEDAIHHHQGLYEHITAAYSEVSQDGKALLDKLQRPLTPDSTDSLTASANYSKAVHHVLNIIHELLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHEDFEDVAQNTYTNADKLLEAAEQLAQTGECDPEEIYQAAHQLEDRIQDFVRRVEQRKVLLDMSVSFHTHVKELLTWLEGLQKEL-LDDVYAESVEAVQDLIKHFGQQQQTILQFSVNTVKEGEDLIQQLRDSAISSNKTPHNSSINHIESVLRQLDEAQTQMEDLFQERKIKLDLFLQLRIFERDAINIISDLESWNEELTAQINDFDTEDLTVAEQRLQLHADKALTMNNLTFDVIHQGQELLHYVSDV----QASGVVLLCDRDGDMATRVRELLEFLHEKQQELD-------VASERHRRHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEVLLQ-------------------ANHYDADLI-------RDCAENVASHWQQLMLKMEDRLKLVNASVAFFKTSEQVCSVLESLEQEYKREEDWCGGGDKLGPNCETDHVTPMISKHFEQKEAFLKACTLARRNADVFLKYMHRNSMNMPGMLSHVKAPEQQVKNILNELLQRENRVLHFWTRRKRRLDQCQQFVVFERNAKQALEWIHDTGEFYLST 1129          

HSP 2 Score: 284.263 bits (726), Expect = 4.309e-76
Identity = 166/474 (35.02%), Postives = 265/474 (55.91%), Query Frame = 3
Query: 4224 QEKAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKI-DFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSF-----GPI---------YEENQRTR-----------------MTSSTSDVARNADN------IFYVLDDFTALEISQLSVQRNQRVQLIEQI---GEWASVRTICTNSDIVDDESTKVQGLVPASLLISVSTRRYL 5522
            + K+A+++  ++ E+IQTE  YV DL   ++TY   +  G+ +I  P  +V ++ ++F NI+++ EFH ++FL E+ +Y+               LPED+GHCF+ +A+ F+ +YV Y  NK +  Q+++E   ++F+EL         ++ NTI S+ IKPVQRITKY + LK+L   C+ G  GE+ E  EVML + KR ND +HL  ++G  E+  LES G+ IL D F VW+P+ +I+KGR+R +FLF++ L+L+K+    + +  Y YK+ +  +E  +TEH+EGD CKFALW GR P   + R+VLK  ++E KQ W++ +RE +QER          PI         + + +R R                 + S TS    ++D       +  V+ DF A   ++L+V+  Q V+++E+     +W  V+TI        D S   +GLVP S+L    +R  L
Sbjct: 1299 KRKSARRKDFIMAELIQTEKTYVRDLRECMETYLWEMTSGVEEI--PPGIVNKEHIIFGNIQDLFEFHYNIFLKELEKYEQ--------------LPEDVGHCFVTWADKFQ-MYVNYCRNKPDSTQLILEHAGNYFDELQQ-----RHRLANTISSYLIKPVQRITKYQLLLKELLTCCEEGK-GEIKEGLEVMLSVPKRANDAMHLSMLEGFDEN--LESQGELILQDSFQVWDPKTLIRKGRERHLFLFEMSLILSKEVKDSNGRSKYIYKNKLYTSELGVTEHVEGDPCKFALWVGRTPT-SDNRIVLKASNIENKQDWIKHIREVIQERTIHLRGALKEPIHIPKTTTSKHHKGRRDREDLDSQGESSSQPDTISLASRTSQNTLDSDKLSGGCELIVVIHDFVASNNNELTVRCGQTVEVLERCHDKPDWCLVQTI--------DRSPPQEGLVPCSMLCIAHSRSSL 1738          

HSP 3 Score: 121.709 bits (304), Expect = 9.100e-27
Identity = 94/350 (26.86%), Postives = 162/350 (46.29%), Query Frame = 3
Query: 4236 AKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKID-FFNEL---MSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSE--AWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQI-IKKGRDRRVFLFDVCLVLTKKYNHDDNKIF--YQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEENQ 5258
            + KR  ++ E+++TE  YV DL   ++ Y   + E      +P D+  +  ++FSN+ +I  +HK  FL E+ +              C   P+ +G  F +       +Y+ Y   K +   I++E ID +F EL   +  C          I    +KPVQRI KY + LKD            +    A EV+  ++KR ND ++L  ++G   D  +E+LG  +L D F V  P  + + +  +RRVFLF+  ++ +K  +         + Y++ I ++   + E +EGD+CKF L +  +  + E   VL    L + + W   +R  +  +     P Y+EN 
Sbjct: 1979 SNKRRFILLELVETEREYVRDLCMLVEGYMSMMKEE----GVPDDMKGKDKIVFSNVHDIYVWHKDFFLRELEK--------------CLENPDRLGPLFFKQERKL-NMYITYCQTKSKSEHIVLEYIDTYFEELKQRLGECLQ--------ITDLLLKPVQRILKYQLLLKDFLKYSKKAGLESVDSERAVEVICIVSKRCNDMMNLSRLQGF--DGKIETLGRLLLQDTFMVSNPEGVLLGQMTERRVFLFEQMVIFSKPLDQKAALCLPGFLYRNSIKVSCLGLEETVEGDRCKFILTSRSLNGITE-SFVLHSSHLGVHEVWTLQVRHILGSQRNCL-PEYQENH 2297          

HSP 4 Score: 63.1586 bits (152), Expect = 5.097e-9
Identity = 85/422 (20.14%), Postives = 173/422 (41.00%), Query Frame = 3
Query:  948 WIEIRICLEDFFTLAHDM---SDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQTRSSWVTMNPDYQ-QLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETV--NSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTL 2195
            ++++RI   D   +  D+   +++ T+     D +D+  TV E  +R++ H    L +      V+  +G +L H++       +  ++S V +  D    +  +V++ ++ L+E +  L    +  R  LEQ  QLR  + ++ ++  W+     + L        +  +A  L  EH QF        +   ++   A +L  + HY +  I+  A  +   W+     +EDR  ++  S +F   +E   +     E   K++    G  + +  N    ++T +     E + A  + C+  R  A      + + S              +   ++++E+     RV      R +RL      ++F  +  Q L W+++ GE +L   TS G S+   ++L   H  F   A  +L
Sbjct:  750 FLQLRIFERDAINIISDLESWNEELTAQINDFDTEDL--TVAE--QRLQLHADKALTMNNLTFDVIH-QGQELLHYV-------SDVQASGVVLLCDRDGDMATRVRELLEFLHEKQQELDVASERHRRHLEQCVQLRHLQAEVKQVLGWIRNGESM-LNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEVLLQANHYDADLIRDCAENVASHWQQLMLKMEDRLKLVNASVAFFKTSEQVCSVLESLEQEYKREEDWCGGGDKLGPNCETDHVTPMISKHFEQKEAFLKACTLARRNADVFLKYMHRNSMNMPGMLSHVKAPEQQVKNILNELLQRENRVLHFWTRRKRRLDQCQQFVVFERNAKQALEWIHDTGEFYLSTHTSTGSSIHHTQELLKEHEVFHVTAKVSL 1158          
BLAST of Triple functional domain protein vs. Ensembl Medaka
Match: ENSORLT00000006661.2 (triple functional domain protein [Source:NCBI gene;Acc:101164837])

HSP 1 Score: 615.535 bits (1586), Expect = 2.248e-178
Identity = 393/1145 (34.32%), Postives = 621/1145 (54.24%), Query Frame = 3
Query:  510 LLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMET-VNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAH-DPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRLVEE----------DEKNHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFE---ADVASAIDCLKHEVPTPMSYNF------LNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGKSSVQEKVDASIKD----LMVKEQAVLQAWAARKSRLDECLDFI---RVKAEADELIHNFDEAGVSS 3860
            +LK  +A L G RD+RGGP+L FPA S+ D +  EDL  LV YL  +P E V +  F+V++DMR G+ W S+KP+LK+L+E    C     IIKP+ F++KQ+    SSKF F+  +VS + L + +D SQLT  F+G+L Y++++WIE+R+  E F + A     +   L + L ++D+P  +  ++R +E+H +++ +  +A +  L+ +G +L   L        Q+ S +     D   L+ +V   + +L+  R +LQ  W   + +L+Q +QLRLFE D  +M +W+   + LFLT Y +IG     A +L  +H  F +NC +V   ++R+  V N L +SGHYAS QIQ  + +L+ +WK+F  AL++RS +L++SASFH +A+ +++    W  A  +     G++ T +  L   I   Q L++    A+ EV  +G++L   L  P+  GS  SL ++ +YS+   H   ++HEV    +++E +  HR  RL  RL L +F++DV QVL W+  HGE FL + T VGKSL RA  L   H  FEEVA NT  NA+KL+ AA++L      DPEEI Q   +LE RIQ F + VE R+  LD++V FH H K+L+ W  +L++     ++   ++E V+D ++RF  +++  L A   V+KEG  L  +L +               H + +L Q+   +    +L  ER+++L+L LQLR+FE    D+ S ++    E+   M+ +F      L + RL    ++   +       I  G+E++Q  +E+    ++ GV           + V D  E+  E+ Q L        +A D+    L+  +  R L+ + +QVL WI   + ML    +  S+L EAEQLQ EH++FQ  + + H  A+     AE  +Q   + +                             ++ AE VAD WQ+L+   E++ KL+ A+  +YKTS+QV SVL SLE+EY+R EDWC          +  ++  ++S+H EQKEAFLKAC LARR ++ F+KYL R     PG  S  +  +  +K+    L+ +E  VL  W  RK RLD+C  ++   R   +A E IH+  E  +S+
Sbjct:    1 ILKEKVAFLSGGRDRRGGPILTFPARSNHDRIRPEDLRRLVAYLATIPSEEVARHGFTVIVDMR-GSKWDSIKPLLKILQESFPTCIHVALIIKPDNFWQKQRTNFGSSKFEFETVMVSLEGLTKIVDPSQLTADFEGSLEYNHDDWIEVRLSFETFASDAARALSRLEELQEVLSQRDLPRDLEGARRLMEEHAALKKRATKASIEELDTQGRRLLQRL--------QSHSGY----SDAHSLVAKVTALLDKLHGTRQNLQQLWHMRKLKLDQCFQLRLFEQDAEKMFDWIMHNKGLFLTSYTEIGGNHQHAVELQTQHNHFAMNCMNVYVNINRIMSVGNRLLESGHYASQQIQQISGQLEQEWKAFAAALDERSTLLEMSASFHQKADQYMSKVEPWCKACGE-----GELPTELQDLEDTIHHHQGLYEHITTAYSEVSQEGKSLLDKLQRPLTPGSADSLMSSANYSKAVHHVLDIIHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYQAAHQLEDRIQDFVRRVEQRKVLLDMSVAFHTHVKELWTWLEELQKEL-LDDVYAESVEAVQDLIKRFGQQQQTTLQATVNVIKEGEDLIQQLRDSAISSNKTPHNSSMAHIESVLQQLDEAQGQMEELFQERKIKLELFLQLRIFERDAIDIISDLESWNEELSQQMN-DFDTEDLTLAEQRLQHHADKALTMNNLTFDVIHQGQELLQYVTEV----QASGVELLCDRDVDMATRVQDLLEFLHEKQQELD-------LAADQHRRHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASSLQEAEQLQKEHEQFQHAIEKTHQSALQVQQKAEALLQANHYDM--------------------------DMIRDCAEKVADHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSESDHVTPMISKHLEQKEAFLKACTLARRNADVFLKYLHRNSVNMPGMLSHVKAPETQVKNILNELLQRENRVLHFWTMRKRRLDQCQQYVVFERSAKQALEWIHDTGEFYLST 1088          

HSP 2 Score: 268.085 bits (684), Expect = 4.099e-71
Identity = 155/473 (32.77%), Postives = 250/473 (52.85%), Query Frame = 3
Query: 4224 QEKAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKID-FFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEE------------------------------------NQRTRMTSSTSDVARNADNIFYVLDDFTALEI---SQLSVQRNQRVQLIEQI---GEWASVRTICTNSDIVDDESTKVQGLVPASLLISVSTR 5513
            + K+A+++  ++ E+IQTE  YV DL   + TY   +  G+ +I  P  ++ ++ ++F N++++ EFH ++FL E+ +Y+               LPED+GHCF+ +A+ F+ +YV Y  NK +  Q+++E    +F+E+         ++ N+I S+ IKPVQRITKY + LK+L   C+ G  GE+ +  EVML + KR ND +HL  + G   D  ++S G+ IL + F VW+P+ +I+KGR+R +FLF++ LV +K+    +    Y YKS +  +E  +TEH+EGD CKFALW GR  P  + ++VLK   LE KQ W++ +RE +QER        +E                                      RT   +  SD       +  V+ DF A       +L+V+R Q V+++E++    +W  VRT         D S   +G+VP S+L    +R
Sbjct: 1210 KRKSARRKEFIMAELIQTEKAYVRDLRECMDTYLWEMTSGVEEI--PHGIINKEHIIFGNMQDLYEFHHNIFLKELEKYEQ--------------LPEDVGHCFVTWADKFQ-MYVNYCKNKPDSTQLIVEHAGAYFDEIQQ-----RHRLANSISSYLIKPVQRITKYQLLLKELLTCCEEGK-GEIKDGLEVMLSVPKRANDAMHLSMLDGF--DGNIDSQGELILQESFQVWDPKTLIRKGRERHLFLFEMSLVFSKEVKDSNGHSKYLYKSKLFTSELGVTEHVEGDPCKFALWVGRT-PTSDNKIVLKASSLENKQDWIKHIREVIQERTVHLRGALKEPIHIPKATATKHKGRRDGEDLDSQGDASSQPDTISIASRTSQNTLDSDKLSGGCELTVVIHDFVASNGGSNGELTVRRGQTVEVLERLHDKPDWCLVRTT--------DRSPAQEGIVPCSMLCIAHSR 1648          

HSP 3 Score: 112.079 bits (279), Expect = 7.443e-24
Identity = 96/358 (26.82%), Postives = 166/358 (46.37%), Query Frame = 3
Query: 4239 KKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGS--AGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWE-PRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIF----YQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEENQRTRMTSSTSDV 5291
            K+R +++ E+++TE  YV DL + ++ Y   + E      +P D+  +  ++F NI +I ++HK  FL E+ +              C   PE +   F++       +Y+ Y  NK +   I+ E ID + E +        Q+ + +    IKPVQRI KY + LKDL            EL +A EVM  + KR ND +++  ++G   +  + + G  +L D F V +    ++ + ++RRVFLF+  ++ ++    D  K F    Y +K+ I ++   + E+ + D CKF L T R       R  L      + Q WV  + + +            ENQR  + + TS +
Sbjct: 1892 KRRHYVLLELVETERDYVRDLGSVVEGYMSRMKEE----GVPDDMRGKDKIVFGNIYQIYDWHKDFFLGELEK--------------CLEDPERLATLFVKQERRL-HMYIVYCQNKPKSEHIVSEYIDTYFEDLKQRLGHRLQLTDLL----IKPVQRIMKYQLLLKDLLKVSKKAGVDTAELEKAVEVMCVVPKRCNDMMNVGRLQGF--EGKIVAQGRLLLQDTFMVSDQDGGLLSRMKERRVFLFEQIVIFSEPL--DKKKGFSTPGYLFKNSIKVSWLGLEENTD-DPCKFTL-TSRSSAGSMERYTLHSASPGVCQVWVHQVSQIL------------ENQRNFLNALTSPI 2208          

HSP 4 Score: 58.151 bits (139), Expect = 1.663e-7
Identity = 32/143 (22.38%), Postives = 63/143 (44.06%), Query Frame = 3
Query: 1248 QVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHS 1676
            QVK  + +L +    + H W   + RL+Q  Q  +FE    +  EW++     +L+ +   G +     +L  EH  F +     +E+V  L  +A+   D GH  + +I+     +D  ++ F+  ++     L+ +    S
Sbjct: 1032 QVKNILNELLQRENRVLHFWTMRKRRLDQCQQYVVFERSAKQALEWIHDTGEFYLSTHTSTGSSIHHTQELLKEHEDFQITAKQTKERVKLLIQLADGFCDKGHAHALEIKKWVSSVDKRYRDFSIRMDKYRTCLETALGISS 1174          
BLAST of Triple functional domain protein vs. Ensembl Medaka
Match: ENSORLT00000039503.1 (pep primary_assembly:ASM223467v1:2:11065029:11074963:1 gene:ENSORLG00000024973.1 transcript:ENSORLT00000039503.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.976 bits (367), Expect = 2.143e-36
Identity = 130/456 (28.51%), Postives = 212/456 (46.49%), Query Frame = 3
Query: 4230 KAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAI-AEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDI-GHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAG----ELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEP-RQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETM--QERIFSF--GPIYEENQR-------TRMTSS--------------TSDVARNADN--IFYVLDDFTALEISQLSVQRNQRVQLIEQIGEWASVRTICTNSDIVDDESTKVQGLVPASLL 5495
            KA + R+ ++NEM+Q+E  YV DL   ++ +   +   GI     P+D+  +  ++F NI++I ++H+  FL E+ +               C    D+    FIR+      +YV Y  NK +   I++E   FF E+       E   + +I  + IKP+QRITKY + LKD      T  AG    E+ +A E+M  + KR ND ++L  ++G   +  L S G  +  + F VWE    ++ + ++RRVFLF+  ++ ++      N   YQ+K+ I ++   + + ++GD CKF LW+         R  L+     IK  WV  +   +  Q    S    PI  E QR       TR  SS              T   A + D+  +  VL DF A+   ++SV R ++VQ++    +  S+     N+D     S   +G VP S+L
Sbjct:   29 KALRGRMFVVNEMVQSEKDYVKDLGVIVEGFMSRLEVRGI-----PEDMRGKDKIVFGNIQQIYDWHRDFFLVELER---------------CIQNHDLLADLFIRHERRLH-MYVVYCQNKPKSEFIVIEYETFFEEIQH-----EISCRMSISDYLIKPIQRITKYQLLLKDFFKY--TTKAGLDTEEIEKAVELMSLVPKRCNDMMNLGRLQGY--EGKLTSQGKLLQQETFCVWEQDGGVLSRSKERRVFLFEQIIIFSELLRKGSNNPGYQFKNSIKVSYLAMQDSVDGDPCKFVLWSRG----SAERFTLQASSASIKMTWVETIATLLDAQNNFLSALQSPI--EYQRKEGGISVTRPLSSGRPPSAPPTPNGHATQPPADSEDDQELVQVLQDFVAVREDEISVFRGEKVQILSSNQQGQSLVYRPANTD-----SPAAEGWVPRSVL 443          
BLAST of Triple functional domain protein vs. Ensembl Medaka
Match: ENSORLT00000044042.1 (pep primary_assembly:ASM223467v1:2:11065029:11074963:1 gene:ENSORLG00000024973.1 transcript:ENSORLT00000044042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.976 bits (367), Expect = 2.143e-36
Identity = 130/456 (28.51%), Postives = 212/456 (46.49%), Query Frame = 3
Query: 4230 KAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAI-AEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDI-GHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAG----ELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEP-RQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETM--QERIFSF--GPIYEENQR-------TRMTSS--------------TSDVARNADN--IFYVLDDFTALEISQLSVQRNQRVQLIEQIGEWASVRTICTNSDIVDDESTKVQGLVPASLL 5495
            KA + R+ ++NEM+Q+E  YV DL   ++ +   +   GI     P+D+  +  ++F NI++I ++H+  FL E+ +               C    D+    FIR+      +YV Y  NK +   I++E   FF E+       E   + +I  + IKP+QRITKY + LKD      T  AG    E+ +A E+M  + KR ND ++L  ++G   +  L S G  +  + F VWE    ++ + ++RRVFLF+  ++ ++      N   YQ+K+ I ++   + + ++GD CKF LW+         R  L+     IK  WV  +   +  Q    S    PI  E QR       TR  SS              T   A + D+  +  VL DF A+   ++SV R ++VQ++    +  S+     N+D     S   +G VP S+L
Sbjct:   29 KALRGRMFVVNEMVQSEKDYVKDLGVIVEGFMSRLEVRGI-----PEDMRGKDKIVFGNIQQIYDWHRDFFLVELER---------------CIQNHDLLADLFIRHERRLH-MYVVYCQNKPKSEFIVIEYETFFEEIQH-----EISCRMSISDYLIKPIQRITKYQLLLKDFFKY--TTKAGLDTEEIEKAVELMSLVPKRCNDMMNLGRLQGY--EGKLTSQGKLLQQETFCVWEQDGGVLSRSKERRVFLFEQIIIFSELLRKGSNNPGYQFKNSIKVSYLAMQDSVDGDPCKFVLWSRG----SAERFTLQASSASIKMTWVETIATLLDAQNNFLSALQSPI--EYQRKEGGISVTRPLSSGRPPSAPPTPNGHATQPPADSEDDQELVQVLQDFVAVREDEISVFRGEKVQILSSNQQGQSLVYRPANTD-----SPAAEGWVPRSVL 443          
BLAST of Triple functional domain protein vs. Ensembl Medaka
Match: ENSORLT00000001838.2 (pep primary_assembly:ASM223467v1:2:11037727:11051750:1 gene:ENSORLG00000001484.2 transcript:ENSORLT00000001838.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 144.05 bits (362), Expect = 2.990e-34
Identity = 133/446 (29.82%), Postives = 207/446 (46.41%), Query Frame = 3
Query: 2568 HFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFEA---DVASAIDCLKHEVPTPMSYNFLNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESV---GVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYE-LTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPI---------LNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAK-TPGKSSVQE-KVDASIKDLMVKEQAVLQAWAARKSRLDECLDFIRVKAEADELIHNFDEAG 3851
            H + +L Q++       +L  +R++R+D+ LQ R+      +V + +D  K ++    S  F ++   +    E        I       EVIQ+G +L +    V   G+       G +           VE +QRL  +   +L    D  +  L+  L  R L+ Q +QVL WIS+ + ML    L  S L+EAEQLQ EH++ Q           L   H  A+     AE+ ++  S    P++                         ++ A+ VA  WQ L+   E++ KL+ A+  +Y+TS QV  VL SLE+EYRR EDWC   +      Q   L  L+++H EQKEAFLKAC LARR +E F+KY+ R       G S V E +V   + +L+ +E  VL  W  +K RLD+C  ++  +  A + +    ++G
Sbjct:   75 HVESVLQQLEESHVQLEELFHQRKIRVDIFLQFRILHQCTLEVTAEMDAWKMDLE-KQSQEFSSEKVASNRHMERRLAMNNMIY------EVIQQGHDLQQYISEVQASGIELSDVEGGLSSQ---------VEELQRLLQDKQKELQQIADHTHTLLEQNLQLRHLQSQVKQVLGWISEGEVMLSSCMLNSSCLSEAEQLQKEHERLQQAIEALLHADSLQRTHQVALALQQRAELLVR--SGHYDPDA------------------------VRSCAQTVALHWQTLMLRIEDRLKLVNASAAFYRTSQQVCGVLESLEQEYRREEDWCAGGER-----QPEQLLPLINKHMEQKEAFLKACTLARRNAEVFLKYIHRNSVTMVTGHSRVPEQQVKGILSELLQRENRVLHFWTLKKRRLDQCQQYLMFQTHAQQALDWLQQSG 473          

HSP 2 Score: 109.383 bits (272), Expect = 2.052e-23
Identity = 63/172 (36.63%), Postives = 93/172 (54.07%), Query Frame = 3
Query: 4230 KAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNK-DEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLK 4742
            ++A+K+ +++ E++QTE  YV DL+  ++TY   +  G  D  +P  L      +F NI++I EFH S+FL E+  Y+               LPED+GHCF+ +A+ F  +YV Y  NK D    I    + FF E+          + N+I S  IKPVQRITKY + LK
Sbjct:  602 RSARKKEYIMAELLQTERVYVRDLQECIETYLWEMTSGSED--VPLGLANSHYTVFGNIQDIYEFHNSIFLKELENYEQ--------------LPEDVGHCFVTWADKF-HMYVTYCRNKPDSSLLIQQHGVGFFEEVQR-----RHGLANSISSALIKPVQRITKYQLLLK 751          

HSP 3 Score: 55.8398 bits (133), Expect = 6.382e-7
Identity = 82/387 (21.19%), Postives = 166/387 (42.89%), Query Frame = 3
Query: 1239 LIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQF------LVNCSDVR--EQVS-RLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQME-----TVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAHDPE-EILQEQTELERRIQAFTKAVENRRNTLDLAVG 2354
            L  QV++  + L + +  LQ   D   + LEQ  QLR  +  + ++  W+++   + L+         S+A  L  EH +       L++   ++   QV+  L   A +L  SGHY    +++ A  +   W++    +EDR  ++  SA+F+  ++         E   +++       E      +  +N+++        E + A  + C+  R  A      + + S T +       E  +    ++ E+     RV      + +RL      LMF+    Q L WL + G+ +L   TS G ++   ++L N + +F   A +T      LI  A+ ++++ H    E+ +  + +++R + F+  +   R+ L+ A+G
Sbjct:  187 LSSQVEELQRLLQDKQKELQQIADHTHTLLEQNLQLRHLQSQVKQVLGWISEGE-VMLSSCMLNSSCLSEAEQLQKEHERLQQAIEALLHADSLQRTHQVALALQQRAELLVRSGHYDPDAVRSCAQTVALHWQTLMLRIEDRLKLVNASAAFYRTSQQVCGVLESLEQEYRREEDWCAGGERQPEQLLPLINKHM--------EQKEAFLKACTLARRNAEVFLKYIHRNSVTMVTGHSRVPE--QQVKGILSELLQRENRVLHFWTLKKRRLDQCQQYLMFQTHAQQALDWLQQSGDHYLATHTSPGATMAETQELLNQYREFCISAKHTQEKVHLLIQLAESMLAKGHTHRTELRRCVSTVDKRYRDFSVRMGQYRHLLETALG 562          
BLAST of Triple functional domain protein vs. Planmine SMEST
Match: SMESG000061508.1 (SMESG000061508.1)

HSP 1 Score: 4468.3 bits (11588), Expect = 0.000e+0
Identity = 2386/2390 (99.83%), Postives = 2387/2390 (99.87%), Query Frame = 3
Query:   99 MNFNDANIDPDVIEFYRTKSKSSSQPPNRTSIPVSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLKRQQPSGQIYYQKQNMPVQQQQLPINPQANKQSKVYRTSDYHPTSTTPHXXXXXXXXXXXXXXLKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAHDPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRLVEEDEKNHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFEADVASAIDCLKHEVPTPMSYNFLNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGKSSVQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFIRVKAEADELIHNFDEAGVSSPKLDEIYKRLIHNLESKNLNQHTEVIKLIRNRLNLRFANQYLLKPNQVQTGQPGQAVPTTGQLIGQSQPAKLRTQLSSGSNYGSGDLNRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQIQEKAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEENQRTRMTSSTSDVARNADNIFYVLDDFTALEISQLSVQRNQRVQLIEQIGEWASVRTICTNSDIVDDESTKVQGLVPASLLISVSTRRYLVDDKSINGSSMKKWLRDRRHGPVRRGSKVESQXXXXXXXXXXXXXXXXXXXASSDINIENNLLDNVSEESVDVELPPPMALQEFPVVLXXXXXXXXXXXXXXXXXXQTIDSNFIEPIKESQLEIHDSQESNSTIISCNTPIKEEPRSLESISNSQNTDHFSIDDQDKRASSLTIKEFTVSPSPGNNKASAFTSVSNQSPSPGCTLPSELDELGMALEKNLRLSRQARQENERYQAWQQHITSGQHTGTLDXXXXXXXXXXXXXXRALSTSEMSQSSCSAAFPGLEEDEFDDSNHSPILIAPQILDLPGNGDEKLLGELRLSDDMNVAGRLWSPSDDEMVEDVTYNFISRRLLLYETGLILINEVLETCPSINSDLNSNSMPSVVRCKHILSLARLSIKEDVDMSEGRRSANKLLWFCLYEEVSSNQSVLCHIIDPITPDVRARWLTELTQMIQMEKSKQYAXXXXXXXXXXXXXXXXXIGALSSANGSIASFNMASNNIKVQPLFQLKTDPIEIDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENKSTFGLLRKHLSLHFHGKYRISSGGIKKPR 7268
            MNFNDANIDPDVIEFYRTKSKSSSQPPNRTSIPVSQQQQQQQQQHQQQQILYHQQMQKIQHNQQILKRQQPSGQIYYQKQNMPVQQQQLPINPQANKQSKVYRTSDYHPTS+TPHSSNDSNTNTGSGTSLKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAHDPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRLVEEDEKNHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFEADVASAIDCLKHEVPTPMSYNFLNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAGGSGSNDSGVVDSAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPESDSNAANADSSTHNLTSTIYSRRKEAQNIAELVADQWQKLVYAAEEKHKLLLAAGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGKSSVQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFIRVKAEADELIHNFDEAGVSSPKLDEIYKRLIHNLESKNLNQHTEVIKLIRNRLNLRFANQYLLKPNQVQTGQPGQAVPTTGQLIGQSQPAKLRTQLSSGSNYGSGDLNRSSMSSTGSGSSSKTSDTTTTGISSMSSGVSQIQEKAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEENQRTRMTSSTSDVARNADNIFYVLDDFTALEISQLSVQRNQRVQLIEQIGEWASVRTI TNSDIVDDESTKVQGLVPASLLISVSTRRYLVDDKSINGSSMKKWLRDRRHGPVRRGSKVESQSVRPIPTPIIPSIVSQTS ASSDINIENNLLDNVSEESVDVELPPPMALQEFPVVLSPNTNENSSNTSSNAPSSQTIDSNFIEPIKESQLEIHDSQESNSTIISCNTPIKEEPRSLESISNSQNTDHFSIDDQDKRASSLTIKEFTVSPSPGNNKASAFTSVSNQSPSPGCTLPSELDELGMALEKNLRLSRQARQENERYQAWQQHITSGQHTGTLDSISSKASKASQESERALSTSEMSQSSCSAAFPGLEEDEFDDSNHSPILIAPQILDLPGNGDEKLLGELRLSDDMNVAGRLWSPSDDEMVEDVTYNFISRRLLLYETGLILINEVLETCPSINSDLNSNSMPSVVRCKHILSLARLSIKEDVDMSEGRRSANKLLWFCLYEEVSSNQSVLCHIIDPITPDVRARWLTELTQMIQMEKSKQYANNNSLSNNSNIPNNSSNIGALSSANGSIASFNMASNNIKVQPLFQLKTDPIEIDFKAKSSSKLHKKSEKSLSSSKK NKSDASTSASKKENKSTFGLLRKHLSLHFHGKYRISSGGIKKPR
Sbjct:    1 MNFNDANIDPDVIEFYRTKSKSSSQPPNRTSIPVSQQQQQQQQQHQQQQILYHQQMQKIQHNQQILKRQQPSGQIYYQKQNMPVQQQQLPINPQANKQSKVYRTSDYHPTSSTPHSSNDSNTNTGSGTSLKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAHDPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRLVEEDEKNHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFEADVASAIDCLKHEVPTPMSYNFLNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAGGSGSNDSGVVDSAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPESDSNAANADSSTHNLTSTIYSRRKEAQNIAELVADQWQKLVYAAEEKHKLLLAAGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGKSSVQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFIRVKAEADELIHNFDEAGVSSPKLDEIYKRLIHNLESKNLNQHTEVIKLIRNRLNLRFANQYLLKPNQVQTGQPGQAVPTTGQLIGQSQPAKLRTQLSSGSNYGSGDLNRSSMSSTGSGSSSKTSDTTTTGISSMSSGVSQIQEKAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEENQRTRMTSSTSDVARNADNIFYVLDDFTALEISQLSVQRNQRVQLIEQIGEWASVRTIGTNSDIVDDESTKVQGLVPASLLISVSTRRYLVDDKSINGSSMKKWLRDRRHGPVRRGSKVESQSVRPIPTPIIPSIVSQTSAASSDINIENNLLDNVSEESVDVELPPPMALQEFPVVLSPNTNENSSNTSSNAPSSQTIDSNFIEPIKESQLEIHDSQESNSTIISCNTPIKEEPRSLESISNSQNTDHFSIDDQDKRASSLTIKEFTVSPSPGNNKASAFTSVSNQSPSPGCTLPSELDELGMALEKNLRLSRQARQENERYQAWQQHITSGQHTGTLDSISSKASKASQESERALSTSEMSQSSCSAAFPGLEEDEFDDSNHSPILIAPQILDLPGNGDEKLLGELRLSDDMNVAGRLWSPSDDEMVEDVTYNFISRRLLLYETGLILINEVLETCPSINSDLNSNSMPSVVRCKHILSLARLSIKEDVDMSEGRRSANKLLWFCLYEEVSSNQSVLCHIIDPITPDVRARWLTELTQMIQMEKSKQYANNNSLSNNSNIPNNSSNIGALSSANGSIASFNMASNNIKVQPLFQLKTDPIEIDFKAKSSSKLHKKSEKSLSSSKKPNKSDASTSASKKENKSTFGLLRKHLSLHFHGKYRISSGGIKKPR 2390          
BLAST of Triple functional domain protein vs. Planmine SMEST
Match: SMESG000061508.1 (SMESG000061508.1)

HSP 1 Score: 4424 bits (11473), Expect = 0.000e+0
Identity = 2369/2390 (99.12%), Postives = 2370/2390 (99.16%), Query Frame = 3
Query:   99 MNFNDANIDPDVIEFYRTKSKSSSQPPNRTSIPVSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLKRQQPSGQIYYQKQNMPVQQQQLPINPQANKQSKVYRTSDYHPTSTTPHXXXXXXXXXXXXXXLKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAHDPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRLVEEDEKNHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFEADVASAIDCLKHEVPTPMSYNFLNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAXXXXXXXXXXXXXAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPEXXXXXXXXXXXTHNLTSTIYSRRKEAQNIAELVADQWQKLVYXXXXXXXXXXXXGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGKSSVQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFIRVKAEADELIHNFDEAGVSSPKLDEIYKRLIHNLESKNLNQHTEVIKLIRNRLNLRFANQYLLKPNQVQTGQPGQAVPTTGQLIGQSQPAKLRTQLSSGSNYGSGDLNRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQIQEKAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEENQRTRMTSSTSDVARNADNIFYVLDDFTALEISQLSVQRNQRVQLIEQIGEWASVRTICTNSDIVDDESTKVQGLVPASLLISVSTRRYLVDDKSINGSSMKKWLRDRRHGPVRRGSKVESQXXXXXXXXXXXXXXXXXXXASSDINIENNLLDNVSEESVDVELPPPMALQEFPVVLXXXXXXXXXXXXXXXXXXQTIDSNFIEPIKESQLEIHDSQESNSTIISCNTPIKEEPRSLESISNSQNTDHFSIDDQDKRASSLTIKEFTVSPSPGNNKASAFTSVSNQSPSPGCTLPSELDELGMALEKNLRLSRQARQENERYQAWQQHITSGQHTGTLDXXXXXXXXXXXXXXRALSTSEMSQSSCSAAFPGLEEDEFDDSNHSPILIAPQILDLPGNGDEKLLGELRLSDDMNVAGRLWSPSDDEMVEDVTYNFISRRLLLYETGLILINEVLETCPSINSDLNSNSMPSVVRCKHILSLARLSIKEDVDMSEGRRSANKLLWFCLYEEVSSNQSVLCHIIDPITPDVRARWLTELTQMIQMEKSKQYAXXXXXXXXXXXXXXXXXIGALSSANGSIASFNMASNNIKVQPLFQLKTDPIEIDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENKSTFGLLRKHLSLHFHGKYRISSGGIKKPR 7268
            MNFNDANIDPDVIEFYRTKSKSSSQPPNRTSIPVSQQQQQQQQQHQQQQILYHQQMQKIQHNQQILKRQQPSGQIYYQKQNMPVQQQQLPINPQANKQSKVYRTSDYHPTS+TPHSSNDSNTNTGSGTSLKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAHDPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRLVEEDEKNHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFEADVASAIDCLKHEVPTPMSYNFLNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAGGSGSNDSGVVDSAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPESDSNAANADSSTHNLTSTIYSRRKEAQNIAELVADQWQKLVYAAEEKHKLLLAAGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGKSSVQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFIRVKAEADELIHNFDEAGVSSPKLDEIYKRLIHNLESKNLNQHTEVIKLIRNRLNLRFANQYLLKPNQVQTGQPGQAVPTTGQLIGQSQPAKLRTQLSSGSNYGSGDLNRSSMSSTGSGSSSKTSDTTTTGISSMSSGVSQIQEKAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEENQRTRMTSSTSDVARNADNIFYVLDDFTALEISQLSVQRNQRVQLIEQIGEWASVRTI TNSDIVDDESTKVQGLVPASLLISVSTRRYLVDDKSINGSSMKKWLRDRRHGPVRRGSKVESQSVRPIPTPIIPSIVSQTS ASSDINIENNLLDNVSEESVDVELPPPMALQEFPVVLSPNTNENSSNTSSNAPSSQTIDSNFIEPIKESQLEIHDSQESNSTIISCNTPIKEEPRSLESISNSQNTDHFSIDDQDKRASSLTIKEFTVSPSPGNNKASAFTSVSNQSPSPGCTLPSELDELGMALEKNLRLSRQARQENERYQAWQQHITSGQHTGTLDSISSKASKASQESERALSTSEMSQSSCSAAFPGLEEDEFDDSNHSPILIAPQILDLPGNGDEKLLGELRLSDDMNVAGRLWSPSDDEMVEDVTYNFISRRLLLYETGLILINEVLETCPSINSDLNSNSMPSVVRCKHILSLARLSIKEDVDMSEGRRSANKLLWFCLYEEVSSNQSVLCHIIDPITPDVRARWLTELTQMIQMEKSKQYANNNSLSNNSNIPNNSSNIGALSSANGSIASFNMASNNIKVQPLFQLKTDPIEIDFKAKSSSKLHKKSEKSLSSSKK NKSDASTSASKKE                 GKYRISSGGIKKPR
Sbjct:    1 MNFNDANIDPDVIEFYRTKSKSSSQPPNRTSIPVSQQQQQQQQQHQQQQILYHQQMQKIQHNQQILKRQQPSGQIYYQKQNMPVQQQQLPINPQANKQSKVYRTSDYHPTSSTPHSSNDSNTNTGSGTSLKAKDLLTLLKHGIALLPGSRDKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDMRAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTFDIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHDMSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEGDKLGHWLRYGLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQHKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLGQMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLINAEKLILAADELVSQAHDPEEILQEQTELERRIQAFTKAVENRRNTLDLAVGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLKEGSTLCSRLVEEDEKNHFKVLLMQVQSDKETATDLLTERQVRLDLCLQLRLFEADVASAIDCLKHEVPTPMSYNFLNDPRLARSMNELEEVTATFIAAIKSGEEVIQKGSELSRAFESVGVNFPAGGSGSNDSGVVDSAEYAVERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEMLRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQISFQLGPESDSNAANADSSTHNLTSTIYSRRKEAQNIAELVADQWQKLVYAAEEKHKLLLAAGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQVTYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGKSSVQEKVDASIKDLMVKEQAVLQAWAARKSRLDECLDFIRVKAEADELIHNFDEAGVSSPKLDEIYKRLIHNLESKNLNQHTEVIKLIRNRLNLRFANQYLLKPNQVQTGQPGQAVPTTGQLIGQSQPAKLRTQLSSGSNYGSGDLNRSSMSSTGSGSSSKTSDTTTTGISSMSSGVSQIQEKAAKKRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDFILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSHILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRALRETMQERIFSFGPIYEENQRTRMTSSTSDVARNADNIFYVLDDFTALEISQLSVQRNQRVQLIEQIGEWASVRTIGTNSDIVDDESTKVQGLVPASLLISVSTRRYLVDDKSINGSSMKKWLRDRRHGPVRRGSKVESQSVRPIPTPIIPSIVSQTSAASSDINIENNLLDNVSEESVDVELPPPMALQEFPVVLSPNTNENSSNTSSNAPSSQTIDSNFIEPIKESQLEIHDSQESNSTIISCNTPIKEEPRSLESISNSQNTDHFSIDDQDKRASSLTIKEFTVSPSPGNNKASAFTSVSNQSPSPGCTLPSELDELGMALEKNLRLSRQARQENERYQAWQQHITSGQHTGTLDSISSKASKASQESERALSTSEMSQSSCSAAFPGLEEDEFDDSNHSPILIAPQILDLPGNGDEKLLGELRLSDDMNVAGRLWSPSDDEMVEDVTYNFISRRLLLYETGLILINEVLETCPSINSDLNSNSMPSVVRCKHILSLARLSIKEDVDMSEGRRSANKLLWFCLYEEVSSNQSVLCHIIDPITPDVRARWLTELTQMIQMEKSKQYANNNSLSNNSNIPNNSSNIGALSSANGSIASFNMASNNIKVQPLFQLKTDPIEIDFKAKSSSKLHKKSEKSLSSSKKPNKSDASTSASKKE-----------------GKYRISSGGIKKPR 2373          
BLAST of Triple functional domain protein vs. Planmine SMEST
Match: SMESG000047210.1 (SMESG000047210.1)

HSP 1 Score: 54.6842 bits (130), Expect = 5.023e-7
Identity = 66/268 (24.63%), Postives = 123/268 (45.90%), Query Frame = 3
Query: 4242 KRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHL----KDIKGLPEDRPLESLGDFILMDDFTVW--EPRQIIKKG--------RDRRVFLFDVCLVLTKK 5003
            +R+  INE++ +E  YV+ L+   + Y   I +   ++ +P+DL  +  +L+ N  ++ E+H S FL  I +    +             P+ I   F+   +  + IY KY  N  + + I  +  D+F+E       G++Q    + S  ++PVQRI +Y + +  +       S   L   WE  L++ K I  +  L      I G P+   + +LG   +  + +V      ++ ++G         DR+VFLFD  L++T++
Sbjct:   42 RRMEPINELVVSERNYVSRLKIVSEKYMPLIDD--PNVFVPEDLSNKWRILWGNWVQLDEWHTS-FLERIEKIVLDD-------------PDLIPKLFLDSRSRLRTIYSKYCENHRKASVIAEQYRDYFDE--RRIVIGDKQ---DVVSHLMQPVQRIMRYQLPMSLIVKLTKRASLPSL-HMWEKALDIMKEIPKDTQLILEAARIDGFPQS--ITALGYIRMRGELSVAVSSKAELEREGFSVSDLKFLDRKVFLFDQMLLMTEE 285          
BLAST of Triple functional domain protein vs. Planmine SMEST
Match: SMESG000005289.1 (SMESG000005289.1)

HSP 1 Score: 55.8398 bits (133), Expect = 7.187e-7
Identity = 114/484 (23.55%), Postives = 206/484 (42.56%), Query Frame = 3
Query: 1317 RSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTE-YHDIGQTASQAADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKLDHDWKSFTTALEDRSNVLQLS---ASFHSRAEAFLANCPHWETAMKQQNIQLGQ-METVNSL----NQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHTSLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFREDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEE--VAANTLINAEKLILAADELVSQAHDPEEILQEQTE--LERRIQAFTKAVENRRNTLDLAVGFH---NHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILDAADKVLK----EGSTLCS--RLVEEDEKNHFKVLLMQVQSDKETA--TDLLTERQVRLDLCLQLRLFEADVASA 2696
            R +LE   + + F+ D   +  W+ ++   +  E + D+    S+      +H+   +  +   E ++ L      + ++ HYAS  IQT+  +L   W+      +++S +L+L+     F  R +  L      ET +  +  + GQ +E V  L    N+++  L+  +QE + A  E+ S     A HL                D+ E ++   +   +V    +R++ +   R ++L     +  F  D  + ++W+NE   P        G+ L   + L   H   +   +A    +N  +L   ADEL ++  D ++ +Q++ E  L        K+VE R   LD++   H   +  +DL  W   +K    AA+ L   + GVE  + R HNE ++ +D+ D+  K    EG  L +    + ED  N  + L      DKE      L  ER+V  +  + L+LF  D   A
Sbjct:   41 RKKLEDAKKYQYFKRDADELESWILEKIQTYSDENFKDLTNLQSKNQ----KHQALELEIAAQSENLNALDKNGYDMIENHHYASEIIQTRLDQLHALWEKLLNMFKEKSRLLKLTLDYVQFLRRVDEILFWTKEKETFVTSE--EFGQDLEHVEVLQKKFNEFMKDLE--YQEEKAA--EIYSK----ADHLLQE-------------DFPE-QESLINKKKDVEDALERLKNLAKKRQQKLFEAHEIQKFFRDTDKTISWVNEKSIPLTSE--DFGRDLASVQALKRKHEALDRDLIALEEKVN--QLTKDADELSNKHPDSKDTIQDKKEALLSAWSHLKKKSVE-RNEQLDVSYSLHRFLSDYRDLLSWLTDMKAVI-AADELAKDVAGVEALMER-HNEHKSEIDSRDESFKSCKNEGEELITMNHPLSEDIVNKLERL------DKERVILIQLWNERRVLYEQNMDLQLFYRDTEQA 483          
BLAST of Triple functional domain protein vs. Planmine SMEST
Match: SMESG000045388.1 (SMESG000045388.1)

HSP 1 Score: 54.6842 bits (130), Expect = 7.276e-7
Identity = 66/268 (24.63%), Postives = 123/268 (45.90%), Query Frame = 3
Query: 4242 KRIHLINEMIQTEIYYVNDLETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPEISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEGNQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDLCNNCDTGSAGELSEAWEVMLEMNKRINDEIHL----KDIKGLPEDRPLESLGDFILMDDFTVW--EPRQIIKKG--------RDRRVFLFDVCLVLTKK 5003
            +R+  INE++ +E  YV+ L+   + Y   I +   ++ +P+DL  +  +L+ N  ++ E+H S FL  I +    +             P+ I   F+   +  + IY KY  N  + + I  +  D+F+E       G++Q    + S  ++PVQRI +Y + +  +       S   L   WE  L++ K I  +  L      I G P+   + +LG   +  + +V      ++ ++G         DR+VFLFD  L++T++
Sbjct:   82 RRMEPINELVVSERNYVSRLKIVSEKYMPLIDD--PNVFVPEDLSNKWRILWGNWVQLDEWHTS-FLERIEKIVLDD-------------PDLIPKLFLDSRSRLRTIYSKYCENHRKASVIAEQYRDYFDE--RRIVIGDKQ---DVVSHLMQPVQRIMRYQLPMSLIVKLTKRASLPSL-HMWEKALDIMKEIPKDTQLILEAARIDGFPQS--ITALGYIRMRGELSVAVSSKAELEREGFSVSDLKFLDRKVFLFDQMLLMTEE 325          
The following BLAST results are available for this feature:
BLAST of Triple functional domain protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRIO1.330e-4934.98trio Rho guanine nucleotide exchange factor [Sourc... [more]
TRIO5.248e-7334.98trio Rho guanine nucleotide exchange factor [Sourc... [more]
TRIO3.840e-7334.98trio Rho guanine nucleotide exchange factor [Sourc... [more]
KALRN2.052e-7535.41kalirin RhoGEF kinase [Source:HGNC Symbol;Acc:HGNC... [more]
KALRN2.073e-7035.41kalirin RhoGEF kinase [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Triple functional domain protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-731.031e-7824.50Guanine nucleotide exchange factor UNC-73B [Sourc... [more]
unc-735.901e-6626.14Guanine nucleotide exchange factor UNC-73B [Sourc... [more]
unc-731.089e-6526.14Guanine nucleotide exchange factor UNC-73B [Sourc... [more]
unc-731.691e-2223.85Guanine nucleotide exchange factor UNC-73B [Sourc... [more]
unc-731.691e-2223.85Guanine nucleotide exchange factor UNC-73B [Sourc... [more]
back to top
BLAST of Triple functional domain protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trio1.328e-15532.24gene:FBgn0024277 transcript:FBtr0072645[more]
trio1.328e-15532.24gene:FBgn0024277 transcript:FBtr0072644[more]
CG304401.723e-2930.99gene:FBgn0050440 transcript:FBtr0086076[more]
Pura1.926e-1927.93gene:FBgn0035802 transcript:FBtr0089849[more]
Pura2.078e-1927.93gene:FBgn0035802 transcript:FBtr0089850[more]
back to top
BLAST of Triple functional domain protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trioa1.958e-7334.25trio Rho guanine nucleotide exchange factor a [Sou... [more]
trioa2.019e-7334.25trio Rho guanine nucleotide exchange factor a [Sou... [more]
kalrna2.433e-7534.40kalirin RhoGEF kinase a [Source:ZFIN;Acc:ZDB-GENE-... [more]
kalrna2.751e-7034.38kalirin RhoGEF kinase a [Source:ZFIN;Acc:ZDB-GENE-... [more]
triob7.682e-6634.54trio Rho guanine nucleotide exchange factor b [Sou... [more]
back to top
BLAST of Triple functional domain protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
not1.920e-6935.42notochord homeobox [Source:Xenbase;Acc:XB-GENE-478... [more]
not3.570e-7435.42notochord homeobox [Source:Xenbase;Acc:XB-GENE-478... [more]
not2.285e-7435.42notochord homeobox [Source:Xenbase;Acc:XB-GENE-478... [more]
not2.846e-7435.42notochord homeobox [Source:Xenbase;Acc:XB-GENE-478... [more]
not2.344e-5035.28notochord homeobox [Source:Xenbase;Acc:XB-GENE-478... [more]
back to top
BLAST of Triple functional domain protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trio5.005e-7334.81triple functional domain (PTPRF interacting) [Sour... [more]
Trio2.109e-7334.81triple functional domain (PTPRF interacting) [Sour... [more]
Kalrn1.515e-7535.32kalirin, RhoGEF kinase [Source:MGI Symbol;Acc:MGI:... [more]
Kalrn2.046e-7535.32kalirin, RhoGEF kinase [Source:MGI Symbol;Acc:MGI:... [more]
Kalrn2.018e-7035.32kalirin, RhoGEF kinase [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Triple functional domain protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O75962|TRIO_HUMAN1.844e-7234.98Triple functional domain protein OS=Homo sapiens O... [more]
sp|F1M0Z1|TRIO_RAT3.136e-7234.90Triple functional domain protein OS=Rattus norvegi... [more]
sp|Q0KL02|TRIO_MOUSE3.713e-7234.81Triple functional domain protein OS=Mus musculus O... [more]
sp|Q1LUA6|TRIO_DANRE1.328e-7234.25Triple functional domain protein OS=Danio rerio OX... [more]
sp|A2CG49|KALRN_MOUSE1.431e-7435.32Kalirin OS=Mus musculus OX=10090 GN=Kalrn PE=1 SV=... [more]
back to top
BLAST of Triple functional domain protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4V6RGT31.776e-1447.79Uncharacterized protein OS=Opisthorchis felineus O... [more]
H2KVC78.196e-1447.69Kalirin OS=Clonorchis sinensis OX=79923 GN=CLF_111... [more]
A0A0X3PU002.004e-1047.45Triple functional domain protein OS=Schistocephalu... [more]
A0A5K3FCH92.405e-847.19Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3UMD62.649e-847.19Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Triple functional domain protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trioa2.622e-7334.60trio Rho guanine nucleotide exchange factor a [Sou... [more]
kalrna3.401e-6734.03kalirin RhoGEF kinase a [Source:ZFIN;Acc:ZDB-GENE-... [more]
triob3.696e-5334.63trio Rho guanine nucleotide exchange factor b [Sou... [more]
kalrnb4.454e-3429.04kalirin RhoGEF kinase b [Source:ZFIN;Acc:ZDB-GENE-... [more]
mcf2la7.977e-3330.87mcf.2 cell line derived transforming sequence-like... [more]
back to top
BLAST of Triple functional domain protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001772.13.936e-5234.54pep scaffold:Pmarinus_7.0:GL478212:9652:51053:-1 g... [more]
ENSPMAT00000009375.14.446e-15831.51pep scaffold:Pmarinus_7.0:GL476851:10100:39210:1 g... [more]
ENSPMAT00000001767.13.219e-15432.38pep scaffold:Pmarinus_7.0:GL478212:7918:46552:-1 g... [more]
ENSPMAT00000009380.15.129e-8234.11pep scaffold:Pmarinus_7.0:GL476851:10109:39210:1 g... [more]
ENSPMAT00000000080.11.154e-2130.86pep scaffold:Pmarinus_7.0:GL476403:365803:389077:1... [more]
back to top
BLAST of Triple functional domain protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Triple functional domain protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO437521.541e-17828.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO323284.643e-3129.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO314206.832e-2227.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375587.908e-1824.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437532.143e-1427.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Triple functional domain protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000018136.24.309e-7634.26triple functional domain protein [Source:NCBI gene... [more]
ENSORLT00000006661.22.248e-17834.32triple functional domain protein [Source:NCBI gene... [more]
ENSORLT00000039503.12.143e-3628.51pep primary_assembly:ASM223467v1:2:11065029:110749... [more]
ENSORLT00000044042.12.143e-3628.51pep primary_assembly:ASM223467v1:2:11065029:110749... [more]
ENSORLT00000001838.22.990e-3429.82pep primary_assembly:ASM223467v1:2:11037727:110517... [more]
back to top
BLAST of Triple functional domain protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000061508.10.000e+099.83SMESG000061508.1[more]
SMESG000061508.10.000e+099.12SMESG000061508.1[more]
SMESG000047210.15.023e-724.63SMESG000047210.1[more]
SMESG000005289.17.187e-723.55SMESG000005289.1[more]
SMESG000045388.17.276e-724.63SMESG000045388.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002902 ID=SMED30002902|Name=Triple functional domain protein|organism=Schmidtea mediterranea sexual|type=transcript|length=8033bp
CAACTCCATTAGATTGTAAAATAATCTGCTATTTTACATTCTTAAATCTA
AAAATTATGGAAAATTATTAATTTTAACTTTTAGGATATTTTAAAATAAT
GAATTTCAACGACGCAAATATTGATCCAGATGTTATTGAATTTTATAGAA
CGAAATCTAAATCATCTAGTCAACCACCAAATCGTACATCAATTCCAGTG
TCCCAGCAACAACAACAGCAGCAGCAACAACACCAACAACAGCAAATTTT
GTATCATCAACAAATGCAAAAAATACAGCACAATCAGCAAATTTTAAAAA
GGCAACAGCCTTCAGGACAAATATATTACCAAAAACAAAATATGCCTGTA
CAACAGCAACAATTACCTATCAATCCACAAGCTAATAAACAAAGTAAAGT
GTATAGAACATCAGATTATCATCCGACATCAACCACTCCTCACTCCAGTA
ATGATAGCAATACTAATACCGGTAGTGGAACCAGTCTTAAAGCCAAAGAT
CTCTTAACTTTACTGAAACACGGTATAGCTCTTTTGCCAGGAAGTAGAGA
TAAACGCGGTGGTCCAGTTTTATGTTTTCCAGCAAATTCACATGCCGATG
AATTAGATATTGAGGATTTATATATACTCGTTCGCTATCTAACTTTCTTA
CCAGATGAAAATGTTAAAAAATTAAAATTTTCTGTCGTGATCGATATGAG
AGCAGGAACCACATGGCATAGTGTCAAACCAATATTGAAAGTGTTAGAAG
AATGTATCGGCCAATGTACATCGTCTGTGTTCATTATTAAACCAGAAAAG
TTCTTTGAAAAACAAAAAGCTTTAATGGCGTCCAGCAAATTTACATTTGA
TATTCAAATCGTGTCTGCCAAAGAATTGCATCAAGAAATTGATAAATCGC
AATTGACTCAACATTTCGATGGTACTCTGCCATATAGCAATGAAGAATGG
ATTGAAATTAGAATTTGCTTGGAGGATTTTTTCACATTAGCTCATGATAT
GTCAGATAAATTTACGAGCCTCTATAAATTTCTTGATAGAAAAGATATAC
CAGAAACTGTTGTTGAATCGAAACGTCGAGTAGAAGATCATAAGTCAGTG
AGATTGAAAATCATTCAAGCCCCCGTGCATGTGCTAGAAGCAGAAGGCGA
TAAATTGGGCCATTGGCTGCGTTATGGATTAAATTCCCAGAACCAAACCA
GATCTTCATGGGTTACTATGAACCCAGATTATCAGCAGTTGATACCACAA
GTCAAAAAAACTGTGCAACAATTATATGAATATCGAGCTCATTTGCAGCA
TAAGTGGGATGCTGGTCGAAGTCGATTGGAACAAATTTATCAGTTAAGGC
TTTTTGAAGATGACATTGGCCGAATGTCGGAGTGGCTGAATCAACAGCGT
CATCTATTTTTGACTGAATATCATGACATTGGCCAAACTGCATCCCAGGC
CGCAGATTTGTACGCAGAACATCGCCAATTCCTGGTAAATTGTAGTGATG
TCAGAGAACAGGTATCCCGATTGACTGGTGTTGCAAACATGTTGACAGAT
TCTGGGCATTACGCGAGTGCTCAAATACAAACCCAGGCAATAAAGCTCGA
CCACGACTGGAAATCTTTCACTACAGCATTGGAAGATCGTAGTAATGTCC
TTCAATTGTCAGCGAGCTTTCATTCAAGAGCAGAAGCTTTTCTTGCCAAT
TGTCCTCACTGGGAAACCGCAATGAAACAGCAAAATATCCAACTCGGGCA
AATGGAGACTGTTAATTCGTTAAATCAATATATTACAACATTGCAACAAT
TATGGCAAGAGGCTAGAATGGCCCATGAAGAGGTTTGCTCAGATGGTCGT
GCTTTAGCCACTCATCTTAGCAGTCCAGTTCCCAAAGGTAGTCACACTTC
ATTAGCGGCGGCTGTGGATTATAGTGAAGGACGGAAACATTGTACTCATT
TAATGCACGAGGTATGGGCTTGCTTTAAACGAGTTGAAACGGTACAAGCA
CACAGATATAAACGTTTGACTGCTCGGCTTAGTTTACTGATGTTTCGTGA
GGATGTTGCCCAAGTATTGGCATGGCTGAATGAACACGGTGAACCATTTT
TAAAACGTCAAACATCGGTTGGAAAGTCGCTACAGCGAGCTGAACAACTT
TACAATGCACATATGCAGTTCGAGGAGGTGGCTGCTAACACTCTGATCAA
TGCCGAAAAATTAATTTTGGCTGCCGATGAGCTTGTCTCACAAGCTCATG
ATCCAGAAGAGATTTTACAGGAACAAACAGAATTAGAAAGACGAATTCAA
GCTTTTACTAAAGCAGTAGAAAATAGACGGAATACTCTTGATTTAGCTGT
TGGATTTCATAATCACACAAAGGATTTGTTTAAATGGTTTCATCAGTTAA
AAGAGAATCACAATGCTGCGGAAATGTTACCATTAACGATTGAAGGAGTT
GAAGACGAATTACGAAGGTTTCACAATGAAAAACGAAACATTTTAGATGC
AGCAGATAAAGTCTTGAAAGAAGGCTCCACATTATGTTCTAGATTAGTTG
AAGAAGATGAAAAAAACCATTTTAAGGTCTTATTGATGCAGGTACAGAGT
GATAAAGAAACTGCAACTGATCTACTAACTGAAAGACAAGTTCGCTTGGA
TTTGTGCTTGCAGTTGCGTCTCTTTGAGGCTGATGTTGCGTCTGCAATTG
ATTGCCTGAAACATGAAGTGCCAACTCCAATGTCATATAATTTCCTAAAC
GATCCTCGTCTTGCTAGATCAATGAATGAACTCGAAGAAGTAACAGCAAC
ATTTATAGCAGCTATAAAATCTGGCGAAGAAGTCATACAAAAAGGATCTG
AATTATCTAGAGCATTTGAATCAGTTGGAGTCAATTTTCCTGCAGGCGGG
TCAGGTTCTAATGATTCAGGAGTGGTTGATAGCGCTGAATACGCAGTTGA
AAGGATTCAGAGATTGAGTTATGAGTTGACTGACCTTGTAATGGCTGTGG
ATGAAGTTAATATCAAACTGAAAATTGAACTCGATTGGCGAAGATTGGAA
CAACAAAGTCAACAGGTTCTGACTTGGATATCTCAATGTGATGAAATGCT
CCGTCAAACCGCTCTTGTACCAAGTAATCTTACCGAGGCTGAACAATTGC
AAATGGAGCACGACAAATTCCAACCTATACTAAATGAAGCCCACCCACAA
GCAGTAACCTGTGCCGCCTTTGCTGAAATGTACATTCAACAAATTAGTTT
TCAACTTGGACCAGAAAGTGATTCTAATGCTGCTAATGCAGACTCATCTA
CTCACAATTTGACATCGACTATATATTCCCGTCGGAAAGAAGCTCAAAAC
ATAGCGGAATTAGTGGCTGATCAATGGCAGAAACTTGTTTACGCCGCAGA
AGAAAAACACAAGTTACTTCTCGCTGCAGGAAATTGGTATAAAACTTCTG
ACCAAGTTACATCAGTCCTTCGATCATTGGAAAAAGAGTATCGCCGTGCA
GAGGATTGGTGCCAAAATGAAAAAGCGTCTTCTCGTGGCGATCAAGTCAC
TTATCTCGGTGATTTACTTTCTAGACATTTTGAACAGAAAGAAGCTTTTC
TCAAAGCATGCATTTTAGCGAGACGAACATCAGAACAGTTTATTAAATAT
TTGGGTCGACAACCAGCTAAAACTCCTGGCAAATCGAGTGTCCAAGAAAA
AGTTGATGCATCTATCAAAGATTTAATGGTTAAAGAACAGGCAGTTCTCC
AAGCCTGGGCCGCACGAAAAAGTCGGCTTGATGAATGCCTTGATTTTATT
CGAGTGAAAGCAGAAGCCGATGAACTCATTCATAATTTTGATGAAGCGGG
CGTTTCATCGCCGAAATTAGATGAGATCTATAAACGCCTGATTCATAATC
TTGAGTCAAAAAATCTTAATCAACACACTGAGGTTATCAAATTGATAAGA
AATCGACTCAATTTAAGATTTGCCAACCAATATCTGTTGAAACCGAATCA
AGTGCAAACTGGTCAACCTGGGCAAGCTGTTCCTACAACAGGGCAATTAA
TTGGACAGTCTCAACCAGCAAAATTACGAACTCAACTTAGTTCTGGATCA
AATTATGGTTCCGGCGACTTAAATAGATCGTCAATGTCAAGTACTGGTAG
CGGTAGCAGCTCTAAAACCAGTGATACAACAACTACTGGAATATCTTCTA
TGTCCAGTGGGGTTTCTCAGATACAAGAAAAAGCAGCTAAGAAACGAATC
CATTTGATCAATGAAATGATTCAAACTGAAATATATTATGTGAACGATTT
GGAAACATATTTGAAGACATATTACAAAGCAATTGCTGAAGGTATTTCGG
ATATTAAAATCCCACAGGATTTAGTAATGAGAAAGGATGTTTTGTTTAGC
AATATTAAAGAAATTCTTGAATTTCACAAGAGCGTTTTTCTCCCAGAAAT
TAGCCAGTACGATCCAACCAATCAGAACAAGACTGAAAATAATACCACAT
GTTGCTTTCTACCCGAAGATATTGGCCATTGTTTCATAAGATATGCAAAT
GATTTCAAAAAGATTTATGTAAAATATTTTTCAAATAAAGATGAAGGGAA
TCAAATTATGATGGAGAAAATAGATTTTTTCAATGAACTAATGAGCTATT
GTTTTTCGGGTGAAGAGCAAATGAAAAACACTATTCAGTCTTTCTGGATT
AAACCAGTTCAAAGAATAACTAAATATACAATATTCTTGAAAGATCTATG
CAACAATTGTGATACCGGAAGTGCTGGAGAATTGAGTGAAGCATGGGAAG
TAATGCTAGAAATGAATAAGAGAATCAATGATGAAATTCATTTGAAAGAT
ATTAAAGGGCTCCCCGAAGATAGACCGCTTGAGTCTTTGGGAGACTTTAT
TCTTATGGATGATTTCACAGTATGGGAGCCGAGACAGATAATCAAAAAAG
GTCGCGATAGAAGAGTATTTCTATTTGATGTCTGTCTAGTGTTAACGAAA
AAGTACAACCACGATGATAATAAAATATTCTATCAATACAAATCCCATAT
TTTGCTAACTGAGTGCAACATTACTGAACACATAGAAGGAGACCAATGCA
AATTTGCACTGTGGACTGGTCGTGTTCCACCGTTGGGCGAATATAGATTA
GTTCTTAAAGGGAAAGATTTGGAAATTAAACAAAAATGGGTTCGAGCACT
CAGAGAAACTATGCAAGAACGTATTTTCTCATTTGGACCGATATATGAAG
AAAATCAACGCACTCGAATGACATCTAGCACATCAGATGTAGCGAGAAAC
GCGGATAATATATTCTATGTTCTTGATGATTTTACAGCATTGGAAATCTC
GCAATTGTCGGTACAAAGAAATCAACGTGTTCAGTTGATAGAACAAATTG
GAGAATGGGCATCAGTGAGAACAATATGCACAAATAGTGATATTGTTGAC
GATGAATCGACTAAAGTTCAAGGTTTGGTTCCTGCATCACTGCTCATTAG
CGTATCTACAAGGCGATACCTTGTTGATGATAAATCTATCAATGGTAGCT
CGATGAAAAAGTGGCTCAGGGATAGACGACACGGTCCTGTAAGACGAGGA
TCGAAAGTCGAATCTCAGTCAGTCAGGCCTATTCCTACTCCAATTATTCC
TTCAATCGTATCTCAGACATCTGTCGCTTCCTCAGATATCAACATTGAAA
ACAATTTACTCGATAATGTGTCGGAAGAAAGTGTCGATGTTGAATTGCCT
CCACCTATGGCCCTCCAAGAGTTTCCAGTTGTTTTATCTCCAAACACTAA
TGAGAACAGTTCCAACACAAGTTCGAATGCTCCATCAAGCCAAACTATTG
ATTCAAATTTTATCGAGCCCATCAAGGAGTCCCAATTGGAAATTCATGAC
TCGCAAGAAAGCAACAGCACGATAATTTCCTGTAATACTCCAATTAAAGA
AGAACCAAGGTCTTTAGAATCGATTTCTAACTCACAAAATACTGATCATT
TTTCGATTGATGATCAAGATAAACGAGCTTCCAGTTTGACTATTAAGGAA
TTTACCGTGTCTCCATCTCCTGGTAACAATAAAGCGTCTGCTTTTACTTC
TGTATCCAACCAATCCCCTAGTCCAGGCTGTACATTGCCGTCGGAGTTAG
ACGAGTTGGGAATGGCTCTGGAAAAGAATTTGCGACTAAGTCGACAGGCA
CGACAAGAAAATGAACGATACCAAGCTTGGCAGCAGCATATTACCTCTGG
GCAGCACACTGGAACACTGGATTCTATTTCAAGTAAAGCATCTAAAGCAA
GCCAAGAAAGTGAAAGAGCTCTTTCAACTTCTGAAATGAGTCAATCATCT
TGTTCGGCTGCATTTCCCGGTCTTGAAGAAGACGAATTCGATGACAGTAA
CCATTCACCAATTCTCATTGCTCCACAAATTCTAGATTTACCTGGAAATG
GAGATGAAAAGTTATTGGGTGAATTAAGACTTAGTGATGATATGAATGTT
GCCGGTCGGTTATGGTCTCCGAGTGATGATGAAATGGTTGAAGATGTAAC
TTATAATTTTATATCCCGTCGATTGTTGCTATACGAAACTGGATTAATAC
TGATAAATGAAGTCCTTGAGACTTGCCCATCAATTAACTCAGATTTGAAT
TCCAACTCTATGCCGTCGGTTGTCCGGTGCAAGCATATTTTATCACTGGC
ACGTCTTTCAATTAAAGAAGATGTAGATATGTCAGAAGGTAGAAGATCAG
CTAACAAACTTCTTTGGTTTTGCCTCTACGAGGAAGTCAGTTCGAACCAA
AGTGTACTTTGTCATATAATCGATCCGATCACGCCTGATGTTCGAGCTCG
TTGGCTAACAGAATTGACTCAAATGATTCAAATGGAGAAATCCAAACAAT
ATGCCAACAACAATTCCTTATCAAATAACTCAAATATCCCCAACAATAGT
TCGAATATTGGTGCACTGTCATCGGCAAATGGTTCTATTGCTTCTTTCAA
CATGGCTTCGAACAATATTAAGGTTCAACCTCTATTTCAACTGAAAACAG
ATCCAATTGAAATAGATTTTAAGGCTAAATCTTCTAGCAAGCTGCATAAA
AAATCGGAAAAGTCTCTCAGTTCGTCAAAGAAATCAAATAAATCAGATGC
AAGTACATCTGCTAGTAAGAAAGAGAACAAATCGACATTCGGATTGCTAA
GAAAGCATTTATCATTGCATTTTCACGGGAAATATCGCATATCTAGCGGT
GGCATTAAGAAGCCTCGATAATAATAAATAAAATGGTCTCTAATTTTATC
TCGTGCAATCGGATTCTGAAAGCAATAATAATAATAATAACAGTAATGAT
TATTCTCATTCGACCTCATGATTAACAATGACGTAATTCTTCTTCAAGAG
CATTTTCAGTTGATTTTCTTTAAAATTGCATTCGATTCTTTGCAACATTG
ATCGAATGACTATATTTTTATTAACTTGAGGTATCTGTGTAAATGCCTGT
GATGTACATTTGTGTCGATACATTCTATTGAAATATAATATTGTAAATGA
TGCCATTGTGCTTATTCCTCCTTTCCAGGTTATATATGAATGATTTAAAT
AACACCCTGTTCACTATAAATTAGCCGCCGCAACGAAACCCCCACAGCAT
GATGCATTATAGCTTGCTGAGTAACTATATTAACCATGGAAACGGTTTTG
GATTATTTGTAATGAATTTCACTAAACTTTCATCAATATTTATTCAGGAT
TTCTCTGTACAAATGTATTTTACTATTAAACATCTTCATTTATATATTCT
TTTCTATATTTAATCTACTCGGCGAGAATTAAGCTGTATTCGTTTGTTCT
CTGTTAATCGTAATTATTGTTATTATTAATTTGTTACGAATGTGAACCGA
CAGCTATATAGCAGGTCTGTGAGGATGGCTATGTGGAAACCCACTGATAT
ATTATACATACATGCATAGATTTATTTATAGTATGGTTTGTATTGTTTTT
TTTGTTAAAATATAAATCTCTTGCATTTCAAAA
back to top

protein sequence of SMED30002902-orf-1

>SMED30002902-orf-1 ID=SMED30002902-orf-1|Name=SMED30002902-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2391bp
MNFNDANIDPDVIEFYRTKSKSSSQPPNRTSIPVSQQQQQQQQQHQQQQI
LYHQQMQKIQHNQQILKRQQPSGQIYYQKQNMPVQQQQLPINPQANKQSK
VYRTSDYHPTSTTPHSSNDSNTNTGSGTSLKAKDLLTLLKHGIALLPGSR
DKRGGPVLCFPANSHADELDIEDLYILVRYLTFLPDENVKKLKFSVVIDM
RAGTTWHSVKPILKVLEECIGQCTSSVFIIKPEKFFEKQKALMASSKFTF
DIQIVSAKELHQEIDKSQLTQHFDGTLPYSNEEWIEIRICLEDFFTLAHD
MSDKFTSLYKFLDRKDIPETVVESKRRVEDHKSVRLKIIQAPVHVLEAEG
DKLGHWLRYGLNSQNQTRSSWVTMNPDYQQLIPQVKKTVQQLYEYRAHLQ
HKWDAGRSRLEQIYQLRLFEDDIGRMSEWLNQQRHLFLTEYHDIGQTASQ
AADLYAEHRQFLVNCSDVREQVSRLTGVANMLTDSGHYASAQIQTQAIKL
DHDWKSFTTALEDRSNVLQLSASFHSRAEAFLANCPHWETAMKQQNIQLG
QMETVNSLNQYITTLQQLWQEARMAHEEVCSDGRALATHLSSPVPKGSHT
SLAAAVDYSEGRKHCTHLMHEVWACFKRVETVQAHRYKRLTARLSLLMFR
EDVAQVLAWLNEHGEPFLKRQTSVGKSLQRAEQLYNAHMQFEEVAANTLI
NAEKLILAADELVSQAHDPEEILQEQTELERRIQAFTKAVENRRNTLDLA
VGFHNHTKDLFKWFHQLKENHNAAEMLPLTIEGVEDELRRFHNEKRNILD
AADKVLKEGSTLCSRLVEEDEKNHFKVLLMQVQSDKETATDLLTERQVRL
DLCLQLRLFEADVASAIDCLKHEVPTPMSYNFLNDPRLARSMNELEEVTA
TFIAAIKSGEEVIQKGSELSRAFESVGVNFPAGGSGSNDSGVVDSAEYAV
ERIQRLSYELTDLVMAVDEVNIKLKIELDWRRLEQQSQQVLTWISQCDEM
LRQTALVPSNLTEAEQLQMEHDKFQPILNEAHPQAVTCAAFAEMYIQQIS
FQLGPESDSNAANADSSTHNLTSTIYSRRKEAQNIAELVADQWQKLVYAA
EEKHKLLLAAGNWYKTSDQVTSVLRSLEKEYRRAEDWCQNEKASSRGDQV
TYLGDLLSRHFEQKEAFLKACILARRTSEQFIKYLGRQPAKTPGKSSVQE
KVDASIKDLMVKEQAVLQAWAARKSRLDECLDFIRVKAEADELIHNFDEA
GVSSPKLDEIYKRLIHNLESKNLNQHTEVIKLIRNRLNLRFANQYLLKPN
QVQTGQPGQAVPTTGQLIGQSQPAKLRTQLSSGSNYGSGDLNRSSMSSTG
SGSSSKTSDTTTTGISSMSSGVSQIQEKAAKKRIHLINEMIQTEIYYVND
LETYLKTYYKAIAEGISDIKIPQDLVMRKDVLFSNIKEILEFHKSVFLPE
ISQYDPTNQNKTENNTTCCFLPEDIGHCFIRYANDFKKIYVKYFSNKDEG
NQIMMEKIDFFNELMSYCFSGEEQMKNTIQSFWIKPVQRITKYTIFLKDL
CNNCDTGSAGELSEAWEVMLEMNKRINDEIHLKDIKGLPEDRPLESLGDF
ILMDDFTVWEPRQIIKKGRDRRVFLFDVCLVLTKKYNHDDNKIFYQYKSH
ILLTECNITEHIEGDQCKFALWTGRVPPLGEYRLVLKGKDLEIKQKWVRA
LRETMQERIFSFGPIYEENQRTRMTSSTSDVARNADNIFYVLDDFTALEI
SQLSVQRNQRVQLIEQIGEWASVRTICTNSDIVDDESTKVQGLVPASLLI
SVSTRRYLVDDKSINGSSMKKWLRDRRHGPVRRGSKVESQSVRPIPTPII
PSIVSQTSVASSDINIENNLLDNVSEESVDVELPPPMALQEFPVVLSPNT
NENSSNTSSNAPSSQTIDSNFIEPIKESQLEIHDSQESNSTIISCNTPIK
EEPRSLESISNSQNTDHFSIDDQDKRASSLTIKEFTVSPSPGNNKASAFT
SVSNQSPSPGCTLPSELDELGMALEKNLRLSRQARQENERYQAWQQHITS
GQHTGTLDSISSKASKASQESERALSTSEMSQSSCSAAFPGLEEDEFDDS
NHSPILIAPQILDLPGNGDEKLLGELRLSDDMNVAGRLWSPSDDEMVEDV
TYNFISRRLLLYETGLILINEVLETCPSINSDLNSNSMPSVVRCKHILSL
ARLSIKEDVDMSEGRRSANKLLWFCLYEEVSSNQSVLCHIIDPITPDVRA
RWLTELTQMIQMEKSKQYANNNSLSNNSNIPNNSSNIGALSSANGSIASF
NMASNNIKVQPLFQLKTDPIEIDFKAKSSSKLHKKSEKSLSSSKKSNKSD
ASTSASKKENKSTFGLLRKHLSLHFHGKYRISSGGIKKPR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005085guanyl-nucleotide exchange factor activity
GO:0005089Rho guanyl-nucleotide exchange factor activity
GO:0005515protein binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036865CRAL-TRIO_dom_sf
IPR035899DBL_dom_sf
IPR028569Kalirin
IPR001452SH3_domain
IPR001849PH_domain
IPR001251CRAL-TRIO_dom
IPR018159Spectrin/alpha-actinin
IPR000219DH-domain
IPR011993PH-like_dom_sf
IPR002017Spectrin_repeat
Vocabulary: biological process
TermDefinition
GO:0035023regulation of Rho protein signal transduction
GO:0043547positive regulation of GTPase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 781..801
NoneNo IPR availableGENE3DG3DSA:2.30.30.40coord: 1721..1799
e-value: 7.0E-8
score: 34.1
NoneNo IPR availableGENE3DG3DSA:1.20.58.1940coord: 648..924
e-value: 3.8E-10
score: 41.5
NoneNo IPR availableGENE3DG3DSA:1.20.58.60coord: 377..519
e-value: 2.0E-15
score: 58.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2327..2344
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 18..47
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1316..1372
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1952..1967
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1952..1972
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 97..126
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2050..2086
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1821..1840
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2327..2363
NoneNo IPR availablePANTHERPTHR22826RHO GUANINE EXCHANGE FACTOR-RELATEDcoord: 1375..1710
NoneNo IPR availablePANTHERPTHR22826RHO GUANINE EXCHANGE FACTOR-RELATEDcoord: 128..1251
NoneNo IPR availableCDDcd00176SPECcoord: 646..854
e-value: 9.32306E-13
score: 67.4707
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 1592..1708
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 946..1107
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 608..748
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 382..519
IPR000219Dbl homology (DH) domainSMARTSM00325RhoGEF_3coord: 1386..1578
e-value: 1.3E-27
score: 107.7
IPR000219Dbl homology (DH) domainPFAMPF00621RhoGEFcoord: 1387..1577
e-value: 2.6E-29
score: 102.8
IPR000219Dbl homology (DH) domainPROSITEPS50010DH_2coord: 1382..1579
score: 27.891
IPR000219Dbl homology (DH) domainCDDcd00160RhoGEFcoord: 1383..1577
e-value: 3.87206E-30
score: 117.014
IPR001251CRAL-TRIO lipid binding domainSMARTSM00516sec14_4coord: 138..278
e-value: 7.0E-8
score: 42.2
IPR001251CRAL-TRIO lipid binding domainPROSITEPS50191CRAL_TRIOcoord: 132..281
score: 8.033
IPR001251CRAL-TRIO lipid binding domainCDDcd00170SEC14coord: 138..276
e-value: 4.9182E-9
score: 55.469
IPR018159Spectrin/alpha-actininSMARTSM00150SPEC_4coord: 417..519
e-value: 2.0E-6
score: 37.4
coord: 751..851
e-value: 7.6
score: 0.6
coord: 981..1108
e-value: 0.12
score: 20.7
coord: 647..748
e-value: 7.3E-9
score: 45.5
IPR001849Pleckstrin homology domainSMARTSM00233PH_updatecoord: 1600..1708
e-value: 5.1E-5
score: 32.7
IPR001849Pleckstrin homology domainPROSITEPS50003PH_DOMAINcoord: 1593..1706
score: 7.49
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 1584..1709
e-value: 1.1E-30
score: 108.2
IPR002017Spectrin repeatPFAMPF00435Spectrincoord: 415..519
e-value: 8.6E-9
score: 35.8
coord: 646..747
e-value: 4.6E-6
score: 27.1
IPR036865CRAL-TRIO lipid binding domain superfamilyGENE3DG3DSA:3.40.525.10coord: 128..298
e-value: 5.0E-10
score: 41.0
IPR036865CRAL-TRIO lipid binding domain superfamilySUPERFAMILYSSF52087CRAL/TRIO domaincoord: 135..282
IPR035899Dbl homology (DH) domain superfamilyGENE3DG3DSA:1.20.900.10coord: 1371..1582
e-value: 8.0E-47
score: 161.4
IPR035899Dbl homology (DH) domain superfamilySUPERFAMILYSSF48065DBL homology domain (DH-domain)coord: 1360..1580
IPR028569KalirinPANTHERPTHR22826:SF49KALIRINcoord: 1375..1710
coord: 128..1251
IPR001452SH3 domainPROSITEPS50002SH3coord: 1734..1804
score: 12.116