B-catenin 4

Overview
NameB-catenin 4
Smed IDSMED30002900
Length (bp)2038
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of B-catenin 4 (SMED30002900) t-SNE clustered cells

Violin plots show distribution of expression levels for B-catenin 4 (SMED30002900) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of B-catenin 4 (SMED30002900) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for B-catenin 4 (SMED30002900) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002900

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
central nervous systemSMED30002900SMESG000035212.1 dd_Smed_v4_15686_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30002900SMESG000035212.1 dd_Smed_v4_15686_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30002900SMESG000035212.1 dd_Smed_v4_15686_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30002900SMESG000035212.1 dd_Smed_v4_15686_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30002900SMESG000035212.1 SmedASXL_012031SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30002900SMESG000035212.1 KY196225.1smed_ncbi_20200123PMID:28976975
Su et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
photoreceptor neuronSMED30002900SMESG000035212.1 KY196225.1smed_ncbi_20200123PMID:28976975
Su et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
trail cellSMED30002900SMESG000035212.1 KY196225.1smed_ncbi_20200123PMID:28976975
Su et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
central nervous systemSMED30002900SMESG000035212.1 KY196225.1smed_ncbi_20200123PMID:28976975
Su et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
eye cellSMED30002900SMESG000035212.1 KY196225.1smed_ncbi_20200123PMID:28976975
Su et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of B-catenin 4 vs. TrEMBL
Match: A0A1S6KMF0 (Uncharacterized protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1028.85 bits (2659), Expect = 0.000e+0
Identity = 557/557 (100.00%), Postives = 557/557 (100.00%), Query Frame = 3
Query:  153 MDEFEYFIXXXXXXXXXXXXXXXXXXXXXXXXXXXFYEEPTNDMITEIVKEINSQNPIFIREMILFSINGILSKDTRLSSSALVFIWKLFKLTSSSDYPAVEKILFNCPELLSSIKLLIFDQDNSKGLDFYVGGVFHYASKSKIGCEQILEYSIDGLLEMIKSTSPPVVYYSFTCMHNILMNIPKSRELFNKNYDLSSLIQRLICPDEIFKSKLELITIDMLSRLATENDANKQLLFDKHVAHKCVRTLLESQTTKVLIVNGQLLRIMSTNGDCKSYLIQNPEFIDFLIGQCLQINNSYNCRVFWSIILNLSDKLXXXXXXXXXXXXXXXNAMVKFVKDFRRFSISFEIVGLILCCLSNFSCHQEWVKDIIWKRGIQFTIVDFLKMERKSSSNYLSFNAIEACYRCLNHIIDKVSLTCIDFIQNNHFQIVSVLELLKIKKCEDDLHHKLICLSINDIKKMQSYSKEEVRNLLPPLRTWVILMRHILKIEFIKNPKGKSNRKVYQFMVKSIQNEVFKVLNFLRNKCLQKHQIRSQEDDEALKELMIHLNFLINLKETA 1823
            MDEFEYFIDEDNDENDSVESDSGISTGSSTNSISSFYEEPTNDMITEIVKEINSQNPIFIREMILFSINGILSKDTRLSSSALVFIWKLFKLTSSSDYPAVEKILFNCPELLSSIKLLIFDQDNSKGLDFYVGGVFHYASKSKIGCEQILEYSIDGLLEMIKSTSPPVVYYSFTCMHNILMNIPKSRELFNKNYDLSSLIQRLICPDEIFKSKLELITIDMLSRLATENDANKQLLFDKHVAHKCVRTLLESQTTKVLIVNGQLLRIMSTNGDCKSYLIQNPEFIDFLIGQCLQINNSYNCRVFWSIILNLSDKLLIEIGENKGKIIELINAMVKFVKDFRRFSISFEIVGLILCCLSNFSCHQEWVKDIIWKRGIQFTIVDFLKMERKSSSNYLSFNAIEACYRCLNHIIDKVSLTCIDFIQNNHFQIVSVLELLKIKKCEDDLHHKLICLSINDIKKMQSYSKEEVRNLLPPLRTWVILMRHILKIEFIKNPKGKSNRKVYQFMVKSIQNEVFKVLNFLRNKCLQKHQIRSQEDDEALKELMIHLNFLINLKETA
Sbjct:    1 MDEFEYFIDEDNDENDSVESDSGISTGSSTNSISSFYEEPTNDMITEIVKEINSQNPIFIREMILFSINGILSKDTRLSSSALVFIWKLFKLTSSSDYPAVEKILFNCPELLSSIKLLIFDQDNSKGLDFYVGGVFHYASKSKIGCEQILEYSIDGLLEMIKSTSPPVVYYSFTCMHNILMNIPKSRELFNKNYDLSSLIQRLICPDEIFKSKLELITIDMLSRLATENDANKQLLFDKHVAHKCVRTLLESQTTKVLIVNGQLLRIMSTNGDCKSYLIQNPEFIDFLIGQCLQINNSYNCRVFWSIILNLSDKLLIEIGENKGKIIELINAMVKFVKDFRRFSISFEIVGLILCCLSNFSCHQEWVKDIIWKRGIQFTIVDFLKMERKSSSNYLSFNAIEACYRCLNHIIDKVSLTCIDFIQNNHFQIVSVLELLKIKKCEDDLHHKLICLSINDIKKMQSYSKEEVRNLLPPLRTWVILMRHILKIEFIKNPKGKSNRKVYQFMVKSIQNEVFKVLNFLRNKCLQKHQIRSQEDDEALKELMIHLNFLINLKETA 557          
BLAST of B-catenin 4 vs. TrEMBL
Match: A0A291LM10 (B-catenin 4 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 957.592 bits (2474), Expect = 0.000e+0
Identity = 522/527 (99.05%), Postives = 523/527 (99.24%), Query Frame = 3
Query:  153 MDEFEYFIXXXXXXXXXXXXXXXXXXXXXXXXXXXFYEEPTNDMITEIVKEINSQNPIFIREMILFSINGILSKDTRLSSSALVFIWKLFKLTSSSDYPAVEKILFNCPELLSSIKLLIFDQDNSKGLDFYVGGVFHYASKSKIGCEQILEYSIDGLLEMIKSTSPPVVYYSFTCMHNILMNIPKSRELFNKNYDLSSLIQRLICPDEIFKSKLELITIDMLSRLATENDANKQLLFDKHVAHKCVRTLLESQTTKVLIVNGQLLRIMSTNGDCKSYLIQNPEFIDFLIGQCLQINNSYNCRVFWSIILNLSDKLXXXXXXXXXXXXXXXNAMVKFVKDFRRFSISFEIVGLILCCLSNFSCHQEWVKDIIWKRGIQFTIVDFLKMERKSSSNYLSFNAIEACYRCLNHIIDKVSLTCIDFIQNNHFQIVSVLELLKIKKCEDDLHHKLICLSINDIKKMQSYSKEEVRNLLPPLRTWVILMRHILKIEFIKNPKGKSNRKVYQFMVKSIQNEVFKVLNFLRNKCLQ 1733
            MDEFEYFIDEDNDENDSVESDSGISTGSSTNSISSFYEEPTNDMITEIVKEINSQNPIFIREMILFSINGILSKDTRLSSSALVFIWKLFKLTSSSDYPAVEKILFNCPELLSSIKLLIFDQDNSKGLDFYVGGVFHYASKSKIGCEQILEYSIDGLLEMIKSTSPPVVYYSFTCMHNILMNIPKSRELFNKNYDLSSLIQRLICPDEIFKSKLELITIDMLSRLATENDANKQLLFDKHVAHKCVRTLLESQTTKVLIVNGQLLRIMSTNGDCKSYLIQNPEFIDFLIGQCLQINNSYNCRVFWSIILNLSDKLLIEIGENKGKIIELINAMVKFVKDFRRFSISFEIVGLILCCLSNFSCHQEWVKDIIWKRGIQFTIVDFLKMERKSSSNYLSFNAIEACYRCLNHIIDKVS+TCIDFIQNNHFQIVSVLELLKIKK EDDLHHKLICLSINDIKKMQSYSKEEVRNLLPPLRTWVILMRHILKIEFIKNPK KSNRK YQ MVKSIQNEVFKVLNFLRNKCLQ
Sbjct:    1 MDEFEYFIDEDNDENDSVESDSGISTGSSTNSISSFYEEPTNDMITEIVKEINSQNPIFIREMILFSINGILSKDTRLSSSALVFIWKLFKLTSSSDYPAVEKILFNCPELLSSIKLLIFDQDNSKGLDFYVGGVFHYASKSKIGCEQILEYSIDGLLEMIKSTSPPVVYYSFTCMHNILMNIPKSRELFNKNYDLSSLIQRLICPDEIFKSKLELITIDMLSRLATENDANKQLLFDKHVAHKCVRTLLESQTTKVLIVNGQLLRIMSTNGDCKSYLIQNPEFIDFLIGQCLQINNSYNCRVFWSIILNLSDKLLIEIGENKGKIIELINAMVKFVKDFRRFSISFEIVGLILCCLSNFSCHQEWVKDIIWKRGIQFTIVDFLKMERKSSSNYLSFNAIEACYRCLNHIIDKVSVTCIDFIQNNHFQIVSVLELLKIKKGEDDLHHKLICLSINDIKKMQSYSKEEVRNLLPPLRTWVILMRHILKIEFIKNPKRKSNRKAYQVMVKSIQNEVFKVLNFLRNKCLQ 527          
BLAST of B-catenin 4 vs. TrEMBL
Match: A0A159X4K9 (Uncharacterized protein (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 479.945 bits (1234), Expect = 6.804e-164
Identity = 254/255 (99.61%), Postives = 254/255 (99.61%), Query Frame = 3
Query:  954 MSTNGDCKSYLIQNPEFIDFLIGQCLQINNSYNCRVFWSIILNLSDKLXXXXXXXXXXXXXXXNAMVKFVKDFRRFSISFEIVGLILCCLSNFSCHQEWVKDIIWKRGIQFTIVDFLKMERKSSSNYLSFNAIEACYRCLNHIIDKVSLTCIDFIQNNHFQIVSVLELLKIKKCEDDLHHKLICLSINDIKKMQSYSKEEVRNLLPPLRTWVILMRHILKIEFIKNPKGKSNRKVYQFMVKSIQNEVFKVLNFLR 1718
            MSTNGDCKSYLIQNPEFIDFLIGQCLQINNSYNCRVFWSIILNLSDKLLIEIGENKGKIIELINAMVKFVKDFRRFSISFEIVGLILCCLSNFSCHQEWVKDIIWKRGIQFTIVDFLKMERKSSSNYLSFNAIEACYRCLNHIIDKVSLTCIDFIQNNHFQIVSVLELLKIKKCED LHHKLICLSINDIKKMQSYSKEEVRNLLPPLRTWVILMRHILKIEFIKNPKGKSNRKVYQFMVKSIQNEVFKVLNFLR
Sbjct:    1 MSTNGDCKSYLIQNPEFIDFLIGQCLQINNSYNCRVFWSIILNLSDKLLIEIGENKGKIIELINAMVKFVKDFRRFSISFEIVGLILCCLSNFSCHQEWVKDIIWKRGIQFTIVDFLKMERKSSSNYLSFNAIEACYRCLNHIIDKVSLTCIDFIQNNHFQIVSVLELLKIKKCEDVLHHKLICLSINDIKKMQSYSKEEVRNLLPPLRTWVILMRHILKIEFIKNPKGKSNRKVYQFMVKSIQNEVFKVLNFLR 255          
BLAST of B-catenin 4 vs. TrEMBL
Match: A0A1S6KMF7 (Uncharacterized protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 3.040e-18
Identity = 128/512 (25.00%), Postives = 234/512 (45.70%), Query Frame = 3
Query:  285 ITEIVKEINSQNPIFIREMILFSINGILSKDTRLSSSALVFIWKLFKLTSSSDYPAVEK------ILFNCPELLSSIKLLIFDQDNSKGLDFYVGGVFHYASKSKIGCEQILEYSIDGLLEMIKSTSPPVVYYSFTCMHNILMNIPKSRELFNKNYDLSSLIQRLICPDEIFKSKLEL--ITIDMLSRLATENDANKQLLFDKHVAHKCV---RTLLESQTTKVLIVNGQLLRIMSTNGDCKSYLIQNPEFIDFLIGQCLQINNSYNCRVFWSIILNLSDKLXXXXXXXXXXXXXXXNAMVKFVKDFRRFSISFEIVGLILCC---LSNFSCHQEWVKDIIWKRGIQFTIVDFLKMERKSSSNYLSFNAIEACYRCLNH----------IIDKVSLTCIDFIQNNHFQIVSVLELLKIKKCEDDLHHKLICLSINDIKKMQSYSKEEVRNLLPPLRTWVILMRHILKIEFIKNP-KGKSNRKVYQFMVKSIQNEVFKVLNFLRNKCLQKHQI 1745
            +T I K+I+ Q+  + + +I F+I+G++S DT +  SA VF+W+L +  +   Y  +E       +L    +L+ S++  +     S  + ++V G FHY S++  GCE +L+ + D L+ M+      VV+YS T +HNIL+  P      +    ++++I ++  P  + ++K +L  I ID LS L+  N+A K +   +H++   +     +  S   K+L++  +LL+I+ST+   K  +  N  F   L+    +  +  N  V+  + L L +   I             + + +    F   S   E  GL+ C    L+N SC     K ++ K  +  +I+  L +       + S   +EA YRCL+H          +I+K  ++ ++F+ N    I+       +   +D     ++  S+ DI    S            LR W+ L+RH+  I    NP K K+  K   F+     N +  +L+  R +    +QI
Sbjct:   51 VTNIAKDISLQSSSYSKALIDFTISGLISNDTFIRRSAAVFLWQLLRACNMPFYDGIETKEKMMLLLKASDDLIVSLEAALKLDSFSNQMLYWVSGCFHYISRTPFGCEMLLKNNSDILISMLNCELQAVVFYSITTLHNILLTCPCPYRGVHLTNCINNIIDKIHKPSNLGETKFKLLAICIDCLSNLSYHNNAVK-IQISRHISAIQIIISNLVAYSNNEKLLLLGLKLLKILSTDQSAKFKISSNSNFA-ILVLNLFKSKSKMNSNVWLVMFLTLRNLSDILFQPKSDFWKVYHDVLYQICLRFDEIS-CLENDGLLQCAVGILANASCDCPQNKSLLVKTKVLDSILKTLSVTTDKFKLW-SGETLEAMYRCLHHLCSNHERSLYVINKCLMSDMNFLTNASHIII-------LNSSKDISFANILSQSLTDIPISWSI-----------LRAWLGLVRHLF-IHINNNPTKFKTQLKQTNFI-----NRIIDLLSGFRRQIENNYQI 534          
BLAST of B-catenin 4 vs. TrEMBL
Match: A0A291LM11 (B-catenin 3 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 3.793e-18
Identity = 127/512 (24.80%), Postives = 234/512 (45.70%), Query Frame = 3
Query:  285 ITEIVKEINSQNPIFIREMILFSINGILSKDTRLSSSALVFIWKLFKLTSSSDYPAVEK------ILFNCPELLSSIKLLIFDQDNSKGLDFYVGGVFHYASKSKIGCEQILEYSIDGLLEMIKSTSPPVVYYSFTCMHNILMNIPKSRELFNKNYDLSSLIQRLICPDEIFKSKLEL--ITIDMLSRLATENDANKQLLFDKHVAHKCV---RTLLESQTTKVLIVNGQLLRIMSTNGDCKSYLIQNPEFIDFLIGQCLQINNSYNCRVFWSIILNLSDKLXXXXXXXXXXXXXXXNAMVKFVKDFRRFSISFEIVGLILCC---LSNFSCHQEWVKDIIWKRGIQFTIVDFLKMERKSSSNYLSFNAIEACYRCLNH----------IIDKVSLTCIDFIQNNHFQIVSVLELLKIKKCEDDLHHKLICLSINDIKKMQSYSKEEVRNLLPPLRTWVILMRHILKIEFIKNP-KGKSNRKVYQFMVKSIQNEVFKVLNFLRNKCLQKHQI 1745
            +T I K+I+ Q+  + + +I F+I+G++S DT +  SA VF+W+L +  +   Y  +E       +L    +L+ S++  +     S  + ++V G FHY S++  GCE +L+ + D L+ M+      VV+YS T +HNIL+  P      +    ++++I ++  P  + ++K +L  I ID LS L+  N+A K +   +H++   +     +  S   K+L++  +LL+I+ST+   K  +  N  F   L+    +  +  N  V+  + L L +   I             + + +    F   S   E  GL+ C    L+N SC     K ++ K  +  +I+  L +       + S   +EA YRCL+H          +I+K  ++ ++F+ N    I+       +   +D     ++  S+ DI    S            LR W+ L+RH+  I    NP K K+  K   F+     N +  +L+  R +    +Q+
Sbjct:   51 VTNIAKDISLQSSSYSKALIDFTISGLISNDTFIRRSAAVFLWQLLRACNMPFYDGIETKEKMMLLLKASDDLIVSLEAALKLDSFSNQMLYWVSGCFHYISRTPFGCEMLLKNNSDILISMLNCELQAVVFYSITTLHNILLTCPCPYRGVHLTNCINNIIDKIHKPSNLGETKFKLLAICIDCLSNLSYHNNAVK-IQISRHISAIQIIISNLVAYSNNEKLLLLGLKLLKILSTDQSAKFKISSNSNFA-ILVLNLFKSKSKMNSNVWLVMFLTLRNLSDILFQPKSDFWKVYHDVLYQICLRFDEIS-CLENDGLLQCAVGILANASCDCPQNKSLLVKTKVLDSILKTLSVTTDKFKLW-SGETLEAMYRCLHHLCSNHERSLYVINKCLMSDMNFLTNASHIII-------LNSSKDISFANILSQSLTDIPISWSI-----------LRAWLGLVRHLF-IHINNNPTKFKTQLKQTNFI-----NRIIDLLSGFRRQIENNYQV 534          
BLAST of B-catenin 4 vs. Planmine SMEST
Match: SMESG000035212.1 (SMESG000035212.1)

HSP 1 Score: 1018.45 bits (2632), Expect = 0.000e+0
Identity = 552/557 (99.10%), Postives = 553/557 (99.28%), Query Frame = 3
Query:  153 MDEFEYFIXXXXXXXXXXXXXXXXXXXXXXXXXXXFYEEPTNDMITEIVKEINSQNPIFIREMILFSINGILSKDTRLSSSALVFIWKLFKLTSSSDYPAVEKILFNCPELLSSIKLLIFDQDNSKGLDFYVGGVFHYASKSKIGCEQILEYSIDGLLEMIKSTSPPVVYYSFTCMHNILMNIPKSRELFNKNYDLSSLIQRLICPDEIFKSKLELITIDMLSRLATENDANKQLLFDKHVAHKCVRTLLESQTTKVLIVNGQLLRIMSTNGDCKSYLIQNPEFIDFLIGQCLQINNSYNCRVFWSIILNLSDKLXXXXXXXXXXXXXXXNAMVKFVKDFRRFSISFEIVGLILCCLSNFSCHQEWVKDIIWKRGIQFTIVDFLKMERKSSSNYLSFNAIEACYRCLNHIIDKVSLTCIDFIQNNHFQIVSVLELLKIKKCEDDLHHKLICLSINDIKKMQSYSKEEVRNLLPPLRTWVILMRHILKIEFIKNPKGKSNRKVYQFMVKSIQNEVFKVLNFLRNKCLQKHQIRSQEDDEALKELMIHLNFLINLKETA 1823
            MDEFEYFIDEDNDENDSVESDSGISTGSSTNSISSFYEEPTNDMITEIVKEINSQNPIFIREMILFSINGILSKDTRLSSSALVFIWKLFKLTSSSDYPAVEKILFNCPELLSSIKLLIFDQDNSKGLDFYVGGVFHYASKSKIGCEQILEYSIDGLLEMIKSTSPPVVYYSFTCMHNILMNIPKSRELFNKNYDLSSLIQRLICPDEIFKSKLELITIDMLSRLATENDANKQLLFDKHVAHKCVRTLLESQTTKVLIVNGQLLRIMSTNGDCKSYLIQNPEFIDFLIGQCLQINNSYNCRVFWSIILNLSDKLLIEIGENKGKIIELINAMVKFVKDFRRFSISFEIVGLILCCLSNFSCHQEWVKDIIWKRGIQFTIVDFLKMERKSSSNYLSFNAIEACYRCLNHIIDKVS+TCIDFIQNNHFQIVSVLELLKIKK EDDLHHKLICLSINDIKKMQSYSKEEVRNLLPPLRTWVILMRHILKIEFIKNPK KSNRK YQ MVKSIQNEVFKVLNFLRNKCLQKHQIRSQEDDEALKELMIHLNFLINLKETA
Sbjct:    1 MDEFEYFIDEDNDENDSVESDSGISTGSSTNSISSFYEEPTNDMITEIVKEINSQNPIFIREMILFSINGILSKDTRLSSSALVFIWKLFKLTSSSDYPAVEKILFNCPELLSSIKLLIFDQDNSKGLDFYVGGVFHYASKSKIGCEQILEYSIDGLLEMIKSTSPPVVYYSFTCMHNILMNIPKSRELFNKNYDLSSLIQRLICPDEIFKSKLELITIDMLSRLATENDANKQLLFDKHVAHKCVRTLLESQTTKVLIVNGQLLRIMSTNGDCKSYLIQNPEFIDFLIGQCLQINNSYNCRVFWSIILNLSDKLLIEIGENKGKIIELINAMVKFVKDFRRFSISFEIVGLILCCLSNFSCHQEWVKDIIWKRGIQFTIVDFLKMERKSSSNYLSFNAIEACYRCLNHIIDKVSVTCIDFIQNNHFQIVSVLELLKIKKGEDDLHHKLICLSINDIKKMQSYSKEEVRNLLPPLRTWVILMRHILKIEFIKNPKRKSNRKAYQVMVKSIQNEVFKVLNFLRNKCLQKHQIRSQEDDEALKELMIHLNFLINLKETA 557          
BLAST of B-catenin 4 vs. Planmine SMEST
Match: SMESG000022923.1 (SMESG000022923.1)

HSP 1 Score: 100.138 bits (248), Expect = 8.454e-22
Identity = 128/512 (25.00%), Postives = 234/512 (45.70%), Query Frame = 3
Query:  285 ITEIVKEINSQNPIFIREMILFSINGILSKDTRLSSSALVFIWKLFKLTSSSDYPAVEK------ILFNCPELLSSIKLLIFDQDNSKGLDFYVGGVFHYASKSKIGCEQILEYSIDGLLEMIKSTSPPVVYYSFTCMHNILMNIPKSRELFNKNYDLSSLIQRLICPDEIFKSKLEL--ITIDMLSRLATENDANKQLLFDKHVAHKCV---RTLLESQTTKVLIVNGQLLRIMSTNGDCKSYLIQNPEFIDFLIGQCLQINNSYNCRVFWSIILNLSDKLXXXXXXXXXXXXXXXNAMVKFVKDFRRFSISFEIVGLILCC---LSNFSCHQEWVKDIIWKRGIQFTIVDFLKMERKSSSNYLSFNAIEACYRCLNH----------IIDKVSLTCIDFIQNNHFQIVSVLELLKIKKCEDDLHHKLICLSINDIKKMQSYSKEEVRNLLPPLRTWVILMRHILKIEFIKNP-KGKSNRKVYQFMVKSIQNEVFKVLNFLRNKCLQKHQI 1745
            +T I K+I+ Q+  + + +I F+I+G++S DT +  SA VF+W+L +  +   Y  +E       +L    +L+ S++  +     S  + ++V G FHY S++  GCE +L+ + D L+ M+      VV+YS T +HNIL+  P      +    ++++I ++  P  + ++K +L  I ID LS L+  N+A K +   +H++   +     +  S   K+L++  +LL+I+ST+   K  +  N  F   L+    +  +  N  V+  + L L +   I             + + +    F   S   E  GL+ C    L+N SC     K ++ K  +  +I+  L +       + S   +EA YRCL+H          +I+K  ++ ++F+ N    I+       +   +D     ++  S+ DI    S            LR W+ L+RH+  I    NP K K+  K   F+     N +  +L+  R +    +QI
Sbjct:   51 VTNIAKDISLQSSSYSKALIDFTISGLISNDTFIRRSAAVFLWQLLRACNMPFYDGIETKEKMMLLLKASDDLIVSLEAALKLDSFSNQMLYWVSGCFHYISRTPFGCEMLLKNNSDILISMLNCELQAVVFYSITTLHNILLTCPCPYRGVHLTNCINNIIDKIHKPSNLGETKFKLLAICIDCLSNLSYHNNAVK-IQISRHISAIQIIISNLVAYSNNEKLLLLGLKLLKILSTDQSAKFKISSNSNFA-ILVLNLFKSKSKMNSNVWLVMFLTLRNLSDILFQPKSDFWKVYHDVLYQICLRFDEIS-CLENDGLLQCAVGILANASCDCPQNKSLLVKTKVLDSILKTLSVTTDKFKLW-SGETLEAMYRCLHHLCSNHERSLYVINKCLMSDMNFLTNASHIII-------LNSSKDISFANILSQSLTDIPISWSI-----------LRAWLGLVRHLF-IHINNNPTKFKTQLKQTNFI-----NRIIDLLSGFRRQIENNYQI 534          
The following BLAST results are available for this feature:
BLAST of B-catenin 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of B-catenin 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of B-catenin 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of B-catenin 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of B-catenin 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of B-catenin 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of B-catenin 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of B-catenin 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S6KMF00.000e+0100.00Uncharacterized protein OS=Schmidtea mediterranea ... [more]
A0A291LM100.000e+099.05B-catenin 4 (Fragment) OS=Schmidtea mediterranea O... [more]
A0A159X4K96.804e-16499.61Uncharacterized protein (Fragment) OS=Schmidtea me... [more]
A0A1S6KMF73.040e-1825.00Uncharacterized protein OS=Schmidtea mediterranea ... [more]
A0A291LM113.793e-1824.80B-catenin 3 OS=Schmidtea mediterranea OX=79327 PE=... [more]
back to top
BLAST of B-catenin 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of B-catenin 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of B-catenin 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of B-catenin 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of B-catenin 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of B-catenin 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000035212.10.000e+099.10SMESG000035212.1[more]
SMESG000022923.18.454e-2225.00SMESG000022923.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002900 ID=SMED30002900|Name=B-catenin 4|organism=Schmidtea mediterranea sexual|type=transcript|length=2038bp
GTCCAAACTACAAACTGACAAATTAGAATGAAAGAAACTTTTTACTGGAT
TTCTATTGGTGGAAATCAACAAACTAGAAATGATCAACTTACTATTGCAA
TGAGCTAAATATAAATCAATTAAATAATGTCGTAGAATTCTTATTTCCGG
GAATGGATGAATTTGAATATTTCATCGATGAAGACAATGATGAAAATGAT
TCAGTCGAATCTGATTCGGGAATTTCAACGGGGTCATCAACGAATTCTAT
TTCATCATTCTATGAAGAGCCGACAAATGACATGATAACAGAAATTGTGA
AAGAGATCAATTCTCAGAATCCAATTTTTATTCGAGAAATGATTTTATTT
TCAATCAATGGAATTTTATCCAAAGACACTCGACTGTCTTCCAGTGCCCT
TGTGTTTATATGGAAATTATTCAAGTTAACCTCATCCTCGGATTATCCTG
CTGTGGAAAAGATTTTATTTAACTGTCCGGAACTGTTGTCAAGTATAAAG
CTGTTGATTTTCGATCAAGACAACTCAAAGGGACTCGATTTCTATGTCGG
TGGCGTATTTCATTATGCATCGAAATCGAAAATCGGTTGCGAACAAATCC
TTGAATATTCGATTGACGGATTGCTGGAAATGATCAAATCAACCAGTCCA
CCGGTCGTTTACTACAGTTTCACGTGTATGCATAACATTCTGATGAATAT
TCCAAAAAGTCGAGAACTGTTCAACAAAAATTACGATTTGTCTTCGTTGA
TTCAGCGTCTGATTTGTCCGGACGAGATATTCAAATCGAAACTCGAACTC
ATCACGATAGACATGTTGTCGAGATTGGCGACGGAAAATGATGCAAACAA
ACAACTGCTATTCGACAAGCATGTCGCTCACAAATGCGTTCGGACTCTAT
TGGAAAGTCAAACGACAAAGGTGTTAATTGTCAACGGACAGTTGCTACGG
ATCATGAGTACAAATGGCGATTGTAAGTCCTATCTCATTCAGAATCCGGA
ATTCATTGATTTCCTCATTGGACAATGTCTACAAATCAACAATTCCTATA
ATTGTAGAGTTTTCTGGTCGATTATTCTCAATTTATCCGATAAGCTGCTG
ATTGAAATCGGAGAAAACAAAGGCAAAATTATTGAATTAATCAATGCGAT
GGTGAAATTTGTGAAAGATTTTCGAAGGTTTTCGATTTCTTTTGAAATTG
TCGGATTGATTTTGTGCTGCTTGTCAAATTTCTCATGCCATCAAGAATGG
GTCAAGGATATTATTTGGAAGAGAGGGATTCAATTTACAATAGTGGATTT
CTTAAAAATGGAGCGGAAAAGTAGTTCAAATTACTTGTCATTTAACGCCA
TAGAAGCGTGCTACAGGTGTCTAAATCATATTATTGACAAAGTTTCACTG
ACATGTATAGATTTTATACAAAATAATCATTTCCAAATCGTTTCAGTATT
GGAGCTTTTAAAAATTAAAAAATGTGAAGATGATTTACACCATAAACTTA
TTTGCCTATCAATTAATGATATTAAAAAAATGCAGTCATATTCAAAAGAA
GAAGTCCGCAATTTATTACCTCCTCTTCGCACTTGGGTCATTCTAATGAG
GCATATCTTAAAAATTGAATTCATCAAAAATCCGAAGGGAAAATCAAATC
GAAAAGTCTACCAATTTATGGTGAAATCGATTCAGAACGAAGTGTTTAAA
GTGCTGAATTTCCTGCGAAACAAATGTCTTCAGAAACATCAAATCAGATC
TCAAGAGGATGATGAAGCATTAAAAGAATTGATGATTCATTTAAATTTTT
TGATTAATCTTAAAGAAACTGCTTGAGGCTTTGATTCCCTTTTCCTTTAC
TTTGTTAGTAAACCAAATCGTATATTTTCCCTCGTAATCTATATGATGTT
GTCGATTTGCTAGATTTGCTTTTGTATATAAACAATCAATTCCATGTTTT
AATGTTATTTTAAATACATAAATATCATATTGTAGGGGGTGGTTAAAGGA
AAACCCATCAAAATAAGAGTAATTTGAGGAAATAATAT
back to top

protein sequence of SMED30002900-orf-1

>SMED30002900-orf-1 ID=SMED30002900-orf-1|Name=SMED30002900-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=558bp
MDEFEYFIDEDNDENDSVESDSGISTGSSTNSISSFYEEPTNDMITEIVK
EINSQNPIFIREMILFSINGILSKDTRLSSSALVFIWKLFKLTSSSDYPA
VEKILFNCPELLSSIKLLIFDQDNSKGLDFYVGGVFHYASKSKIGCEQIL
EYSIDGLLEMIKSTSPPVVYYSFTCMHNILMNIPKSRELFNKNYDLSSLI
QRLICPDEIFKSKLELITIDMLSRLATENDANKQLLFDKHVAHKCVRTLL
ESQTTKVLIVNGQLLRIMSTNGDCKSYLIQNPEFIDFLIGQCLQINNSYN
CRVFWSIILNLSDKLLIEIGENKGKIIELINAMVKFVKDFRRFSISFEIV
GLILCCLSNFSCHQEWVKDIIWKRGIQFTIVDFLKMERKSSSNYLSFNAI
EACYRCLNHIIDKVSLTCIDFIQNNHFQIVSVLELLKIKKCEDDLHHKLI
CLSINDIKKMQSYSKEEVRNLLPPLRTWVILMRHILKIEFIKNPKGKSNR
KVYQFMVKSIQNEVFKVLNFLRNKCLQKHQIRSQEDDEALKELMIHLNFL
INLKETA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000095trail cell
PLANA:0000103central nervous system
PLANA:0000142posterior region of the whole animal
PLANA:0000421tail
PLANA:0003103eye cell
Vocabulary: INTERPRO
TermDefinition
IPR011989ARM-like
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005488binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 71..460
e-value: 1.3E-17
score: 65.7
NoneNo IPR availablePANTHERPTHR45976:SF1ARMADILLO SEGMENT POLARITY PROTEINcoord: 131..375
NoneNo IPR availablePANTHERPTHR45976FAMILY NOT NAMEDcoord: 131..375
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 46..440