mRNA export factor

Overview
NamemRNA export factor
Smed IDSMED30002898
Length (bp)1233
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of mRNA export factor (SMED30002898) t-SNE clustered cells

Violin plots show distribution of expression levels for mRNA export factor (SMED30002898) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002898

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30002898h1SMcG0001544 SmedASXL_012311SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30002898h1SMcG0001544 dd_Smed_v4_13194_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30002898h1SMcG0001544 dd_Smed_v4_13194_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of mRNA export factor vs. Ensembl Human
Match: RAE1 (ribonucleic acid export 1 [Source:HGNC Symbol;Acc:HGNC:9828])

HSP 1 Score: 199.904 bits (507), Expect = 1.158e-61
Identity = 91/184 (49.46%), Postives = 123/184 (66.85%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQ 669
            +IE+  +P D++ CL FS    P  +L+AGSW   V+ WE+   GQ I +AQQ    PVLD CWS D +K F +  D    MW++++    QIA HDAP+K I +IKA NYSCVMTGSWDK LKFWD  ++ P+ V++L ++ YCADV YPMAVV TA++ + VY L+ +P EF++  S LK Q
Sbjct:   31 DIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQ 214          
BLAST of mRNA export factor vs. Ensembl Human
Match: RAE1 (ribonucleic acid export 1 [Source:HGNC Symbol;Acc:HGNC:9828])

HSP 1 Score: 201.06 bits (510), Expect = 3.809e-60
Identity = 92/186 (49.46%), Postives = 124/186 (66.67%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            +IE+  +P D++ CL FS    P  +L+AGSW   V+ WE+   GQ I +AQQ    PVLD CWS D +K F +  D    MW++++    QIA HDAP+K I +IKA NYSCVMTGSWDK LKFWD  ++ P+ V++L ++ YCADV YPMAVV TA++ + VY L+ +P EF++  S LK Q R
Sbjct:   31 DIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHR 216          
BLAST of mRNA export factor vs. Ensembl Human
Match: RAE1 (ribonucleic acid export 1 [Source:HGNC Symbol;Acc:HGNC:9828])

HSP 1 Score: 201.06 bits (510), Expect = 3.809e-60
Identity = 92/186 (49.46%), Postives = 124/186 (66.67%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            +IE+  +P D++ CL FS    P  +L+AGSW   V+ WE+   GQ I +AQQ    PVLD CWS D +K F +  D    MW++++    QIA HDAP+K I +IKA NYSCVMTGSWDK LKFWD  ++ P+ V++L ++ YCADV YPMAVV TA++ + VY L+ +P EF++  S LK Q R
Sbjct:   31 DIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHR 216          
BLAST of mRNA export factor vs. Ensembl Human
Match: RAE1 (ribonucleic acid export 1 [Source:HGNC Symbol;Acc:HGNC:9828])

HSP 1 Score: 201.06 bits (510), Expect = 3.809e-60
Identity = 92/186 (49.46%), Postives = 124/186 (66.67%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            +IE+  +P D++ CL FS    P  +L+AGSW   V+ WE+   GQ I +AQQ    PVLD CWS D +K F +  D    MW++++    QIA HDAP+K I +IKA NYSCVMTGSWDK LKFWD  ++ P+ V++L ++ YCADV YPMAVV TA++ + VY L+ +P EF++  S LK Q R
Sbjct:   31 DIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHR 216          
BLAST of mRNA export factor vs. Ensembl Human
Match: RAE1 (ribonucleic acid export 1 [Source:HGNC Symbol;Acc:HGNC:9828])

HSP 1 Score: 201.445 bits (511), Expect = 1.432e-59
Identity = 92/186 (49.46%), Postives = 124/186 (66.67%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            +IE+  +P D++ CL FS    P  +L+AGSW   V+ WE+   GQ I +AQQ    PVLD CWS D +K F +  D    MW++++    QIA HDAP+K I +IKA NYSCVMTGSWDK LKFWD  ++ P+ V++L ++ YCADV YPMAVV TA++ + VY L+ +P EF++  S LK Q R
Sbjct:   31 DIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHR 216          
BLAST of mRNA export factor vs. Ensembl Celegans
Match: rae-1 (mRNA export factor rae-1 [Source:UniProtKB/Swiss-Prot;Acc:Q93454])

HSP 1 Score: 166.392 bits (420), Expect = 2.654e-47
Identity = 82/186 (44.09%), Postives = 112/186 (60.22%), Query Frame = 1
Query:  127 IPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVN--NQP-IKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            +  AP DT+  +KFS        L  GSWD T+++W          +AQQ+  AP+LD  W  DS+K FI+C D    +W++A+  V+ +  HD P+K   +I   NY C+MTGS+DK L+FWDM N  NQ  +  ++L ++VY ADV YPMAVV  A+K I VYNL+  P E K   SQLK Q+R
Sbjct:   37 VDGAPEDTIQVIKFSPTPQDKPMLACGSWDGTIRVWMFNDANTFEGKAQQNIPAPILDIAWIEDSSKIFIACADKEARLWDLASNQVAVVGTHDGPVKTCHWINGNNYQCLMTGSFDKTLRFWDMKNLPNQTQMAQIQLPERVYAADVLYPMAVVALANKHIKVYNLENGPTEVKDIESQLKFQIR 222          
BLAST of mRNA export factor vs. Ensembl Celegans
Match: rae-1 (mRNA export factor rae-1 [Source:UniProtKB/Swiss-Prot;Acc:Q93454])

HSP 1 Score: 166.392 bits (420), Expect = 2.654e-47
Identity = 82/186 (44.09%), Postives = 112/186 (60.22%), Query Frame = 1
Query:  127 IPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVN--NQP-IKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            +  AP DT+  +KFS        L  GSWD T+++W          +AQQ+  AP+LD  W  DS+K FI+C D    +W++A+  V+ +  HD P+K   +I   NY C+MTGS+DK L+FWDM N  NQ  +  ++L ++VY ADV YPMAVV  A+K I VYNL+  P E K   SQLK Q+R
Sbjct:   37 VDGAPEDTIQVIKFSPTPQDKPMLACGSWDGTIRVWMFNDANTFEGKAQQNIPAPILDIAWIEDSSKIFIACADKEARLWDLASNQVAVVGTHDGPVKTCHWINGNNYQCLMTGSFDKTLRFWDMKNLPNQTQMAQIQLPERVYAADVLYPMAVVALANKHIKVYNLENGPTEVKDIESQLKFQIR 222          
BLAST of mRNA export factor vs. Ensembl Celegans
Match: bub-3 (Mitotic checkpoint protein bub-3 [Source:UniProtKB/Swiss-Prot;Acc:Q9XWH0])

HSP 1 Score: 76.2554 bits (186), Expect = 4.348e-15
Identity = 51/190 (26.84%), Postives = 93/190 (48.95%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDM--VNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQ--TEPVEFKQYPSQLKCQVR 675
            E  +P  P   +S ++F  + + +  L A  WD T +++E+   G    +   +   P+L C ++  +  AF     N   + +I T   +Q+  H   ++ ++F   +  S +++G WD  +K WD     N  I+ + +S  VY  DV     +VGT D+KI++Y+ +   EP++ +  P  LK Q R
Sbjct:   15 EFRVPFPPFVQISKVQFQRE-AGSRLLAASGWDGTCRVYEVGKLGDISEKLVFTHGKPLLTCTFAGYNKVAFGGVDHNV-KLADIETGNGTQLGSHALAVRCMEFNPMS--SLIVSGGWDSSVKLWDARSYGNGAIESVNVSSSVYAMDVLKHTILVGTKDRKIFMYDSRKLREPLQVRDSP--LKYQTR 198          
BLAST of mRNA export factor vs. Ensembl Celegans
Match: wdr-5.2 (WD repeat-containing protein wdr-5.2 [Source:UniProtKB/Swiss-Prot;Acc:Q93847])

HSP 1 Score: 54.6842 bits (130), Expect = 5.378e-8
Identity = 40/160 (25.00%), Postives = 73/160 (45.62%), Query Frame = 1
Query:  187 ATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDA--PIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVME----LSDKVYCADVHYPMA-----VVGTADKKIYVYNLQTEPV 633
             T + +GS+D+T++IW     G  IF +    + PV   C++ D         D    +W+  T T  +  + +   PI  +KF     Y  ++  + +  LK WD    Q ++V++      +  YC   ++ +      V G+ D K+Y++NLQT  +
Sbjct:  202 GTLIASGSFDETIRIW-CARNGNTIF-SIPGHEDPVSSVCFNRDGAYLASGSYDGIVRIWDSTTGTCVKTLIDEEHPPITHVKFSPNGKY--ILASNLNNTLKLWDY---QKLRVLKEYTGHENSKYCVAANFSVTGGKWIVSGSEDHKVYIWNLQTREI 354          
BLAST of mRNA export factor vs. Ensembl Celegans
Match: wdr-5.1 (WD repeat-containing protein wdr-5.1 [Source:UniProtKB/Swiss-Prot;Acc:Q17963])

HSP 1 Score: 50.447 bits (119), Expect = 1.344e-6
Identity = 38/165 (23.03%), Postives = 74/165 (44.85%), Query Frame = 1
Query:  166 FSTDLSPATYLM-AGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDA--PIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIK-VMELSDKVYCADVHYPMA-----VVGTADKKIYVYNLQTEPV 633
            F  + +P + L+ +GS+D++V+IW++  +     +   +   PV    ++ D +       D    +W+ A     +  V D   P+  +KF     Y  ++  + D  LK WD    + +K      +  YC   ++ +      + G+ D KIY++NLQT  +
Sbjct:  175 FCCNFNPQSSLVVSGSFDESVRIWDV--KTGMCIKTLPAHSDPVSAVSFNRDGSLIASGSYDGLVRIWDTANGQCIKTLVDDENPPVAFVKFSPNGKY--ILASNLDSTLKLWDFSKGKTLKQYTGHENSKYCIFANFSVTGGKWIISGSEDCKIYIWNLQTREI 335          
BLAST of mRNA export factor vs. Ensembl Fly
Match: Rae1 (gene:FBgn0034646 transcript:FBtr0071683)

HSP 1 Score: 184.882 bits (468), Expect = 1.397e-54
Identity = 81/186 (43.55%), Postives = 118/186 (63.44%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            + E+   P D+VS L+FS       +L+AGSWD TV+ WE+   G  + ++ ++   PVLD CWS D +K F++  D    +W++A+  V Q+A HD P+K    +K   Y+C+MTGSWDK LKFWD  +  P+  + L ++ YCADV YPMAVVGTA++ + +Y+LQ  P E+K+  S LK Q R
Sbjct:   13 DFEVASPPDDSVSALEFSPSTVQKNFLVAGSWDSTVRCWEVEQNGATVPKSMKTMGGPVLDVCWSDDGSKVFVASCDKQVKLWDLASDQVMQVAAHDGPVKTCHMVKGPTYTCLMTGSWDKTLKFWDTRSPNPMMTINLPERCYCADVEYPMAVVGTANRGLIIYSLQNSPTEYKRQESPLKYQHR 198          
BLAST of mRNA export factor vs. Ensembl Fly
Match: CG12782 (gene:FBgn0034838 transcript:FBtr0072048)

HSP 1 Score: 102.834 bits (255), Expect = 3.129e-24
Identity = 57/188 (30.32%), Postives = 93/188 (49.47%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQY--PSQLKCQVR 675
            + E+P  P+DT+S L+FS   S    + AGSWD TV+IWE+    + + +   S +    D  W+    K ++S +      W++ +  + ++ +H    +   ++       + T SWDK ++FWD      +  MEL D+ Y ADV   +AVV   D+ I  Y L+  PVE  +   P +   QVR
Sbjct:   14 DYELPNPPNDTISALEFSPRSSSWNAICAGSWDNTVRIWEVQAD-RLVPKVMNSLEGTPFDVTWNDSGNKVYLSDSSGQVTEWDLESNQLRKVGLHARAARTCHWVGP----YLATTSWDKSIRFWDPRAAIELTRMELPDRSYAADVLNDVAVVACGDRSILAYTLRGGPVEQGRMKSPGESNTQVR 196          
BLAST of mRNA export factor vs. Ensembl Fly
Match: Bub3 (gene:FBgn0025457 transcript:FBtr0339148)

HSP 1 Score: 87.4261 bits (215), Expect = 6.525e-19
Identity = 56/189 (29.63%), Postives = 94/189 (49.74%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSF--QAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSD-KVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            E ++   P D +S +KF        Y+ A SWD T++ +++     P  + +Q F   AP+LDC +  D         DN   ++++ TQ  S I  H+ PI+ ++  +  N   ++TGSWD  +K WDM   + +   E ++ KVY   V     VV T+D+K+ +++L+       +  S LK Q R
Sbjct:    5 EFKLNNPPEDLISAVKFGP--KSNQYMAASSWDGTLRFYDV-----PANQLRQKFVQDAPLLDCAFM-DIVHVVSGSLDNQLRLFDVNTQAESIIGAHEEPIRCVEHAEYVN--GILTGSWDNTVKLWDMREKRCVGTFEQNNGKVYSMSVIDEKIVVATSDRKVLIWDLRKMDSYIMKRESSLKYQTR 183          
BLAST of mRNA export factor vs. Ensembl Fly
Match: Bub3 (gene:FBgn0025457 transcript:FBtr0085465)

HSP 1 Score: 87.4261 bits (215), Expect = 6.525e-19
Identity = 56/189 (29.63%), Postives = 94/189 (49.74%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSF--QAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSD-KVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            E ++   P D +S +KF        Y+ A SWD T++ +++     P  + +Q F   AP+LDC +  D         DN   ++++ TQ  S I  H+ PI+ ++  +  N   ++TGSWD  +K WDM   + +   E ++ KVY   V     VV T+D+K+ +++L+       +  S LK Q R
Sbjct:    5 EFKLNNPPEDLISAVKFGP--KSNQYMAASSWDGTLRFYDV-----PANQLRQKFVQDAPLLDCAFM-DIVHVVSGSLDNQLRLFDVNTQAESIIGAHEEPIRCVEHAEYVN--GILTGSWDNTVKLWDMREKRCVGTFEQNNGKVYSMSVIDEKIVVATSDRKVLIWDLRKMDSYIMKRESSLKYQTR 183          
BLAST of mRNA export factor vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0308566)

HSP 1 Score: 50.8322 bits (120), Expect = 1.235e-6
Identity = 38/175 (21.71%), Postives = 80/175 (45.71%), Query Frame = 1
Query:  133 QAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHD--APIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKV-MELSDKVYCADVHYPMA-----VVGTADKKIYVYNLQTEPV 633
            +  S+ V C  F+     +  +++GS+D++V+IW++  +     +   +   PV    ++ D +    S  D    +W+ A+    +  + D   P+  +KF     Y  ++  + D  LK WD    + +K      ++ YC   ++ +      V G+ D  +Y++NLQ++ V
Sbjct:  153 KGHSNYVFCCNFNPQ---SNLIVSGSFDESVRIWDV--RTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKY--ILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEV 320          
BLAST of mRNA export factor vs. Ensembl Zebrafish
Match: rae1 (ribonucleic acid export 1 [Source:NCBI gene;Acc:393973])

HSP 1 Score: 191.045 bits (484), Expect = 1.357e-56
Identity = 85/186 (45.70%), Postives = 119/186 (63.98%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            ++E+   P D++SCL FS    P  +L+ GSW   V+ WE+   GQ + +AQQ    PVLD CWS D +K F +  D    MW++ +    QIA H+ PI+ I +IKA NYSC+MTGSWDK LKFWD  +  P+  +++ ++ YCADV YPMAVV TA++ + VY L+ +P EF++  S LK Q R
Sbjct:   31 DVEVTSPPDDSISCLAFSPPTMPGNFLIGGSWANDVRCWEVQDNGQTVPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLNSNQAIQIAQHEGPIRTIHWIKAPNYSCIMTGSWDKTLKFWDTRSPNPMMSLQMPERCYCADVVYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHR 216          
BLAST of mRNA export factor vs. Ensembl Zebrafish
Match: rae1 (ribonucleic acid export 1 [Source:NCBI gene;Acc:393973])

HSP 1 Score: 191.045 bits (484), Expect = 1.581e-56
Identity = 85/186 (45.70%), Postives = 119/186 (63.98%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            ++E+   P D++SCL FS    P  +L+ GSW   V+ WE+   GQ + +AQQ    PVLD CWS D +K F +  D    MW++ +    QIA H+ PI+ I +IKA NYSC+MTGSWDK LKFWD  +  P+  +++ ++ YCADV YPMAVV TA++ + VY L+ +P EF++  S LK Q R
Sbjct:   31 DVEVTSPPDDSISCLAFSPPTMPGNFLIGGSWANDVRCWEVQDNGQTVPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLNSNQAIQIAQHEGPIRTIHWIKAPNYSCIMTGSWDKTLKFWDTRSPNPMMSLQMPERCYCADVVYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHR 216          
BLAST of mRNA export factor vs. Ensembl Zebrafish
Match: bub3 (BUB3 mitotic checkpoint protein [Source:ZFIN;Acc:ZDB-GENE-041010-210])

HSP 1 Score: 92.8189 bits (229), Expect = 1.527e-20
Identity = 57/186 (30.65%), Postives = 96/186 (51.61%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            E ++ Q P D+VS +KFS   S + +L+  SWD +V++++ +       R +    APVLDC +S D T A+    D+     ++ T   + +  HDAPI+ ++F    N   ++TGSWD+ ++ WD             +KVY   V     +VGTA +++ V++L+      ++  S LK Q R
Sbjct:    6 EFKLAQGPEDSVSAVKFSP--SSSQFLLVSSWDGSVRLYDASANS---MRMKYQHLAPVLDCAFS-DPTHAWSGGLDSQLKTHDLNTDQDTIVGTHDAPIRCVEFCPEVN--VLVTGSWDQSVRLWDPRTPCNAGTFTQPEKVYTLSVAGDRLIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTR 183          
BLAST of mRNA export factor vs. Ensembl Zebrafish
Match: bub3 (BUB3 mitotic checkpoint protein [Source:ZFIN;Acc:ZDB-GENE-041010-210])

HSP 1 Score: 92.4337 bits (228), Expect = 1.870e-20
Identity = 57/186 (30.65%), Postives = 96/186 (51.61%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            E ++ Q P D+VS +KFS   S + +L+  SWD +V++++ +       R +    APVLDC +S D T A+    D+     ++ T   + +  HDAPI+ ++F    N   ++TGSWD+ ++ WD             +KVY   V     +VGTA +++ V++L+      ++  S LK Q R
Sbjct:   18 EFKLAQGPEDSVSAVKFSP--SSSQFLLVSSWDGSVRLYDASANS---MRMKYQHLAPVLDCAFS-DPTHAWSGGLDSQLKTHDLNTDQDTIVGTHDAPIRCVEFCPEVN--VLVTGSWDQSVRLWDPRTPCNAGTFTQPEKVYTLSVAGDRLIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTR 195          
BLAST of mRNA export factor vs. Ensembl Zebrafish
Match: snrnp40 (small nuclear ribonucleoprotein 40 (U5) [Source:ZFIN;Acc:ZDB-GENE-040426-978])

HSP 1 Score: 60.077 bits (144), Expect = 1.756e-9
Identity = 37/125 (29.60%), Postives = 62/125 (49.60%), Query Frame = 1
Query:  133 QAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITP-----QGQPIFRAQ-QSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQT-VSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKL 486
            Q   D+V+ L  S D    +YL++ S D +V++W+I P     +   IF+    +F+  +L C WS D +K      D F Y+W+  T+  V ++  H   +  + F        V++GS DK+L
Sbjct:  222 QGHGDSVTGLSLSAD---GSYLLSNSMDNSVRVWDIRPFAPKERCVKIFQGNVHNFEKNLLRCSWSADGSKIAAGSADRFVYIWDTTTRRIVYKLPGHAGSVNEVAF--HPEEPIVLSGSSDKRL 341          
BLAST of mRNA export factor vs. Ensembl Xenopus
Match: bub3 (BUB3 mitotic checkpoint protein [Source:NCBI gene;Acc:493224])

HSP 1 Score: 97.0561 bits (240), Expect = 6.209e-22
Identity = 58/186 (31.18%), Postives = 96/186 (51.61%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            E ++ QAP D +S +KFS + S   +L+  SWD +V+++++        R +     PVLDC + +D T A+    D+   M ++ T   S +  HDAPI+ +++    N   ++TGSWD+ +K WD             DKVY   V     +VGTA +++ V++L+      ++  S LK Q R
Sbjct:   10 EFKLNQAPEDGISAVKFSPNTS--QFLLVSSWDSSVRLYDVPAN---TLRLKYQHAGPVLDCAF-YDPTHAWSGGLDHQLKMHDLNTDGESVVGSHDAPIRCVEYCPEVN--VIVTGSWDQTVKLWDPRTPCNAGTFSQPDKVYTLSVSGDRLIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTR 187          
BLAST of mRNA export factor vs. Ensembl Xenopus
Match: bub3 (BUB3 mitotic checkpoint protein [Source:NCBI gene;Acc:493224])

HSP 1 Score: 97.0561 bits (240), Expect = 6.387e-22
Identity = 58/186 (31.18%), Postives = 96/186 (51.61%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            E ++ QAP D +S +KFS + S   +L+  SWD +V+++++        R +     PVLDC + +D T A+    D+   M ++ T   S +  HDAPI+ +++    N   ++TGSWD+ +K WD             DKVY   V     +VGTA +++ V++L+      ++  S LK Q R
Sbjct:   12 EFKLNQAPEDGISAVKFSPNTS--QFLLVSSWDSSVRLYDVPAN---TLRLKYQHAGPVLDCAF-YDPTHAWSGGLDHQLKMHDLNTDGESVVGSHDAPIRCVEYCPEVN--VIVTGSWDQTVKLWDPRTPCNAGTFSQPDKVYTLSVSGDRLIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTR 189          
BLAST of mRNA export factor vs. Ensembl Xenopus
Match: bub3 (BUB3 mitotic checkpoint protein [Source:NCBI gene;Acc:493224])

HSP 1 Score: 96.6709 bits (239), Expect = 9.963e-22
Identity = 58/186 (31.18%), Postives = 96/186 (51.61%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            E ++ QAP D +S +KFS + S   +L+  SWD +V+++++        R +     PVLDC + +D T A+    D+   M ++ T   S +  HDAPI+ +++    N   ++TGSWD+ +K WD             DKVY   V     +VGTA +++ V++L+      ++  S LK Q R
Sbjct:    6 EFKLNQAPEDGISAVKFSPNTS--QFLLVSSWDSSVRLYDVPAN---TLRLKYQHAGPVLDCAF-YDPTHAWSGGLDHQLKMHDLNTDGESVVGSHDAPIRCVEYCPEVN--VIVTGSWDQTVKLWDPRTPCNAGTFSQPDKVYTLSVSGDRLIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTR 183          
BLAST of mRNA export factor vs. Ensembl Xenopus
Match: bub3 (BUB3 mitotic checkpoint protein [Source:NCBI gene;Acc:493224])

HSP 1 Score: 96.6709 bits (239), Expect = 1.065e-21
Identity = 58/186 (31.18%), Postives = 96/186 (51.61%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            E ++ QAP D +S +KFS + S   +L+  SWD +V+++++        R +     PVLDC + +D T A+    D+   M ++ T   S +  HDAPI+ +++    N   ++TGSWD+ +K WD             DKVY   V     +VGTA +++ V++L+      ++  S LK Q R
Sbjct:   12 EFKLNQAPEDGISAVKFSPNTS--QFLLVSSWDSSVRLYDVPAN---TLRLKYQHAGPVLDCAF-YDPTHAWSGGLDHQLKMHDLNTDGESVVGSHDAPIRCVEYCPEVN--VIVTGSWDQTVKLWDPRTPCNAGTFSQPDKVYTLSVSGDRLIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTR 189          
BLAST of mRNA export factor vs. Ensembl Xenopus
Match: mindy4 (MINDY lysine 48 deubiquitinase 4 [Source:Xenbase;Acc:XB-GENE-6456867])

HSP 1 Score: 55.4546 bits (132), Expect = 5.998e-8
Identity = 40/177 (22.60%), Postives = 78/177 (44.07%), Query Frame = 1
Query:  124 EIPQAPSDTVSC-------LKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIA-TQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQP--IKVM-ELSDKVYCADVHYPMAVVGTADKKIYVYNLQ 621
            E+PQ     + C       ++F+ D     Y M    DKT+K+W   P    + +        VLD   S+D+++     +D    +W++A  Q V +   H   +  ++F +      +M+GS D  ++ WD  + +P  I+++ E  D +    +     + G+ D  +  Y+L+
Sbjct:   12 ELPQKLQHKLECNQGAVRAVRFNVD---GNYCMTCGSDKTLKLW--NPHKGTLLKTYSGHGYEVLDTAGSYDNSQMCSCSSDKTVILWDVAQGQVVRKFRGHAGKVNCVQFNEEATV--IMSGSIDSSIRCWDCRSRRPEAIQILDEAKDGISSIKISDHEILAGSVDGNLRRYDLR 181          
BLAST of mRNA export factor vs. Ensembl Mouse
Match: Rae1 (ribonucleic acid export 1 [Source:MGI Symbol;Acc:MGI:1913929])

HSP 1 Score: 199.904 bits (507), Expect = 6.188e-60
Identity = 92/186 (49.46%), Postives = 123/186 (66.13%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            +IE+  +P D++ CL FS    P  +L+AGSW   V+ WE+   GQ I +AQQ    PVLD CWS D +K F +  D    MW++ +    QIA HDAP+K I +IKA NYSCVMTGSWDK LKFWD  ++ P+ V++L ++ YCADV YPMAVV TA++ + VY L+ +P EF++  S LK Q R
Sbjct:   31 DIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLNSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHR 216          
BLAST of mRNA export factor vs. Ensembl Mouse
Match: Rae1 (ribonucleic acid export 1 [Source:MGI Symbol;Acc:MGI:1913929])

HSP 1 Score: 189.504 bits (480), Expect = 4.732e-58
Identity = 86/173 (49.71%), Postives = 115/173 (66.47%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVE 636
            +IE+  +P D++ CL FS    P  +L+AGSW   V+ WE+   GQ I +AQQ    PVLD CWS D +K F +  D    MW++ +    QIA HDAP+K I +IKA NYSCVMTGSWDK LKFWD  ++ P+ V++L ++ YCADV YPMAVV TA++ + VY L+ +P E
Sbjct:   31 DIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLNSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSE 203          
BLAST of mRNA export factor vs. Ensembl Mouse
Match: Bub3 (BUB3 mitotic checkpoint protein [Source:MGI Symbol;Acc:MGI:1343463])

HSP 1 Score: 88.1965 bits (217), Expect = 6.052e-19
Identity = 54/186 (29.03%), Postives = 94/186 (50.54%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            E ++ Q P D +S +KFS + S   +L+  SWD +V+++++        R +      VLDC + +D T A+    D+   M ++ T   + +  HDAPI+ +++    N   ++TGSWD+ +K WD             +KVY   V     +VGTA +++ V++L+      ++  S LK Q R
Sbjct:    6 EFKLNQPPEDGISSVKFSPNTS--QFLLVSSWDTSVRLYDVPANS---MRLKYQHTGAVLDCAF-YDPTHAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVN--VMVTGSWDQTVKLWDPRTPCNAGTFSQPEKVYTLSVSGDRLIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTR 183          
BLAST of mRNA export factor vs. Ensembl Mouse
Match: Bub3 (BUB3 mitotic checkpoint protein [Source:MGI Symbol;Acc:MGI:1343463])

HSP 1 Score: 88.1965 bits (217), Expect = 6.322e-19
Identity = 54/186 (29.03%), Postives = 94/186 (50.54%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            E ++ Q P D +S +KFS + S   +L+  SWD +V+++++        R +      VLDC + +D T A+    D+   M ++ T   + +  HDAPI+ +++    N   ++TGSWD+ +K WD             +KVY   V     +VGTA +++ V++L+      ++  S LK Q R
Sbjct:    6 EFKLNQPPEDGISSVKFSPNTS--QFLLVSSWDTSVRLYDVPANS---MRLKYQHTGAVLDCAF-YDPTHAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVN--VMVTGSWDQTVKLWDPRTPCNAGTFSQPEKVYTLSVSGDRLIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTR 183          
BLAST of mRNA export factor vs. Ensembl Mouse
Match: Bub3 (BUB3 mitotic checkpoint protein [Source:MGI Symbol;Acc:MGI:1343463])

HSP 1 Score: 72.0182 bits (175), Expect = 5.180e-14
Identity = 43/150 (28.67%), Postives = 77/150 (51.33%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVN-------NQPIKVMELSDKV 546
            E ++ Q P D +S +KFS + S   +L+  SWD +V+++++        R +      VLDC + +D T A+    D+   M ++ T   + +  HDAPI+ +++    N   ++TGSWD+ +K WD          +QP K++ L  + 
Sbjct:    6 EFKLNQPPEDGISSVKFSPNTS--QFLLVSSWDTSVRLYDVPANS---MRLKYQHTGAVLDCAF-YDPTHAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNV--MVTGSWDQTVKLWDPRTPCNAGTFSQPEKLLNLGRRA 147          
BLAST of mRNA export factor vs. UniProt/SwissProt
Match: sp|Q5RF99|RAEL1_PONAB (mRNA export factor OS=Pongo abelii OX=9601 GN=RAE1 PE=2 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 1.829e-59
Identity = 92/186 (49.46%), Postives = 124/186 (66.67%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            +IE+  +P D++ CL FS    P  +L+AGSW   V+ WE+   GQ I +AQQ    PVLD CWS D +K F +  D    MW++++    QIA HDAP+K I +IKA NYSCVMTGSWDK LKFWD  ++ P+ V++L ++ YCADV YPMAVV TA++ + VY L+ +P EF++  S LK Q R
Sbjct:   31 DIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHR 216          
BLAST of mRNA export factor vs. UniProt/SwissProt
Match: sp|P78406|RAE1L_HUMAN (mRNA export factor OS=Homo sapiens OX=9606 GN=RAE1 PE=1 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 1.829e-59
Identity = 92/186 (49.46%), Postives = 124/186 (66.67%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            +IE+  +P D++ CL FS    P  +L+AGSW   V+ WE+   GQ I +AQQ    PVLD CWS D +K F +  D    MW++++    QIA HDAP+K I +IKA NYSCVMTGSWDK LKFWD  ++ P+ V++L ++ YCADV YPMAVV TA++ + VY L+ +P EF++  S LK Q R
Sbjct:   31 DIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHR 216          
BLAST of mRNA export factor vs. UniProt/SwissProt
Match: sp|Q4R6D2|RAE1L_MACFA (mRNA export factor OS=Macaca fascicularis OX=9541 GN=RAE1 PE=2 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 3.426e-59
Identity = 92/186 (49.46%), Postives = 123/186 (66.13%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            +IE+  +P D++ CL FS    P  +L+AGSW   V+ WE+   GQ I +AQQ    PVLD CWS D +K F +  D    MW++++    QIA HDAP+K I +IKA NYSCVMTGSWDK LKFWD  ++ P+ V++L ++ YCADV YPMAVV TA + + VY L+ +P EF++  S LK Q R
Sbjct:   31 DIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERYYCADVIYPMAVVATAGRGLIVYQLENQPSEFRRIESPLKHQHR 216          
BLAST of mRNA export factor vs. UniProt/SwissProt
Match: sp|Q3SWS8|RAE1L_RAT (mRNA export factor OS=Rattus norvegicus OX=10116 GN=Rae1 PE=1 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 3.613e-59
Identity = 92/186 (49.46%), Postives = 123/186 (66.13%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            +IE+  +P D++ CL FS    P  +L+AGSW   V+ WE+   GQ I +AQQ    PVLD CWS D +K F +  D    MW++ +    QIA HDAP+K I +IKA NYSCVMTGSWDK LKFWD  ++ P+ V++L ++ YCADV YPMAVV TA++ + VY L+ +P EF++  S LK Q R
Sbjct:   31 DIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLNSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHR 216          
BLAST of mRNA export factor vs. UniProt/SwissProt
Match: sp|A5GFN6|RAEL1_PIG (mRNA export factor OS=Sus scrofa OX=9823 GN=RAE1 PE=3 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 3.892e-59
Identity = 92/186 (49.46%), Postives = 123/186 (66.13%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            +IE+  +P D++ CL FS    P  +L+AGSW   V+ WE+   GQ I +AQQ    PVLD CWS D +K F +  D    MW++ +    QIA HDAP+K I +IKA NYSCVMTGSWDK LKFWD  ++ P+ V++L ++ YCADV YPMAVV TA++ + VY L+ +P EF++  S LK Q R
Sbjct:   31 DIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLNSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHR 216          
BLAST of mRNA export factor vs. TrEMBL
Match: A0A430QT51 (mRNA export factor OS=Schistosoma bovis OX=6184 GN=DC041_0003444 PE=4 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 5.457e-62
Identity = 91/183 (49.73%), Postives = 122/183 (66.67%), Query Frame = 1
Query:  124 EIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQV 672
            E+   P DTVSCL+FS +    T+L A SWD  ++IWE+   G  I +A+Q  Q PV   CWS D +K F    D    MW++ + T +Q+ VHDAP+K   FI A NYSC+MTGSWDK+L+FWD    QPI  ++L +++YCADVHYP+A+VGTA ++I+VYNL+  P +F Q  S LK QV
Sbjct:   31 EVQSPPGDTVSCLRFSPESMQTTFLAATSWDNRIRIWEVQANGSTIPKAEQMHQGPVFGACWSTDGSKIFSVSADKTAQMWDLGSNTFAQVGVHDAPVKTAHFITAPNYSCLMTGSWDKRLRFWDTRQPQPILNLDLPERIYCADVHYPLALVGTAGRQIFVYNLENGPTQFNQLESPLKFQV 213          
BLAST of mRNA export factor vs. TrEMBL
Match: V4A6N0 (WD_REPEATS_REGION domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_216798 PE=4 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 4.535e-61
Identity = 99/186 (53.23%), Postives = 128/186 (68.82%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            + E+   P D+VSCLKFS    P+T+L+AGSWD  V+ WEI   GQ + +AQQS   PVL   WS D TK F +  D    MW++++    Q+AVHDAPIK + +IKA NYSC+MTGSWDK LKFWD  +  PI  ++L +KVYCADV YPMAVVGT+++ I +Y L+ +P EFK+  SQLK Q R
Sbjct:   32 DFEVTSPPDDSVSCLKFSPGTLPSTFLIAGSWDNNVRCWEIQQNGQTVPKAQQSHTGPVLGVDWSDDGTKVFTASCDKTAKMWDLSSNQFMQVAVHDAPIKTVHWIKAQNYSCLMTGSWDKTLKFWDTRSPNPILSIQLPEKVYCADVKYPMAVVGTSNRGIIIYQLENQPREFKRVESQLKYQSR 217          
BLAST of mRNA export factor vs. TrEMBL
Match: A0A2H1BWF4 (Nucleoporin GLE2 domain protein OS=Fasciola hepatica OX=6192 GN=D915_13695 PE=4 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 2.011e-60
Identity = 91/186 (48.92%), Postives = 123/186 (66.13%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            E++ P  PSDTVSCL+FS +     +L A SWD  V+IWE+   G  I +A+Q  Q P L  CWS D  + F    D    MW++   T +Q+A HDAPIK +  I A NY+C+MTGSWDK+L+FWD+   QPI  ++L ++VYCADVHYP+A+VGTA++++  YNL+  P EF +  S LK QVR
Sbjct:   30 EVQCP--PSDTVSCLRFSPESLQTVFLAATSWDNRVRIWEVQGNGTTIPKAEQMHQGPALSACWSKDGAQLFSVSADKSAQMWDLGANTFTQVAAHDAPIKTVHLISAPNYTCLMTGSWDKRLRFWDLRQPQPILNLDLPERVYCADVHYPLAIVGTANRQVIAYNLENGPTEFTRIESPLKFQVR 213          
BLAST of mRNA export factor vs. TrEMBL
Match: A0A2K5ISV6 (Ribonucleic acid export 1 OS=Colobus angolensis palliatus OX=336983 GN=RAE1 PE=4 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 4.846e-60
Identity = 93/186 (50.00%), Postives = 125/186 (67.20%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            +IE+  +P D++ CL FS    P  +L+AGSW   V+ WE+   GQ I +AQQ    PVLD CWS D +K F +  D    MW++++    QIA HDAP+K I +IKA NYSCVMTGSWDK LKFWD  ++ P+ V++L ++ YCADV YPMAVV TA++ + VY L+ +P EF++  S LK QVR
Sbjct:   31 DIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQVR 216          
BLAST of mRNA export factor vs. TrEMBL
Match: A0A2K6DZM3 (Ribonucleic acid export 1 OS=Macaca nemestrina OX=9545 GN=RAE1 PE=4 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 4.846e-60
Identity = 93/186 (50.00%), Postives = 125/186 (67.20%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            +IE+  +P D++ CL FS    P  +L+AGSW   V+ WE+   GQ I +AQQ    PVLD CWS D +K F +  D    MW++++    QIA HDAP+K I +IKA NYSCVMTGSWDK LKFWD  ++ P+ V++L ++ YCADV YPMAVV TA++ + VY L+ +P EF++  S LK QVR
Sbjct:   31 DIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQVR 216          
BLAST of mRNA export factor vs. Ensembl Cavefish
Match: rae1 (ribonucleic acid export 1 [Source:NCBI gene;Acc:103040569])

HSP 1 Score: 191.815 bits (486), Expect = 6.420e-57
Identity = 86/186 (46.24%), Postives = 119/186 (63.98%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            ++E+   P D++SCL FS    P  +L+ GSW   V+ WE+   GQ + +AQQ    PVLD CWS D +K F +  D    MW++ +    QIA H+ PI+ I +IKA NYSCVMTGSWDK LKFWD  +  P+  +++ ++ YCADV YPMAVV TA++ + VY L+ +P EF++  S LK Q R
Sbjct:   31 DVEVTSPPDDSISCLAFSPPTMPGNFLIGGSWANDVRCWEVQDNGQTVPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLNSNQAMQIAQHEGPIRTIHWIKAPNYSCVMTGSWDKTLKFWDTRSPNPMMSLQMPERCYCADVVYPMAVVATAERGLIVYQLENQPSEFRRIDSPLKHQHR 216          
BLAST of mRNA export factor vs. Ensembl Cavefish
Match: bub3 (BUB3 mitotic checkpoint protein [Source:NCBI gene;Acc:103028940])

HSP 1 Score: 94.3597 bits (233), Expect = 3.008e-21
Identity = 58/186 (31.18%), Postives = 96/186 (51.61%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            E ++ Q P D++S +KFS   S   +L+  SWD TV+++++   G    R +    APVLDC + +D T A+    DN   M ++ T   + +  HDAPI+ +++    N   ++TGSWD  ++ WD             +KVY   V     +VGTA +++ V++L+      ++  S LK Q R
Sbjct:    6 EFKLNQLPDDSISAVKFSPTTS--QFLLVSSWDSTVRLYDV---GGNSMRMKYQHLAPVLDCAF-YDPTHAWSGGLDNQLKMHDLNTDQDTIVGTHDAPIRCVEYCPEVN--VMVTGSWDMSVRLWDPRTPCNAGTFTQPEKVYTLSVAGDRLIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTR 183          
BLAST of mRNA export factor vs. Ensembl Cavefish
Match: snrnp40 (small nuclear ribonucleoprotein U5 subunit 40 [Source:NCBI gene;Acc:103032740])

HSP 1 Score: 57.3806 bits (137), Expect = 1.095e-8
Identity = 34/125 (27.20%), Postives = 63/125 (50.40%), Query Frame = 1
Query:  133 QAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITP-----QGQPIFRAQ-QSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTV-SQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKL 486
            Q   D+V+ L  S++    +YL++ S D +V++W+I P     +   IF+    +F+  +L C WS D +K      D F Y+W+  ++ +  ++  H   +  + F        V++GS DK+L
Sbjct:  222 QGHGDSVTGLSLSSE---GSYLLSNSMDNSVRVWDIRPFAPKERCVKIFQGNVHNFEKNLLRCSWSSDGSKIAAGSADRFVYVWDTTSRRILYKLPGHAGSVNEVAF--HPEEPIVLSGSSDKRL 341          
BLAST of mRNA export factor vs. Ensembl Cavefish
Match: wdr83 (WD repeat domain containing 83 [Source:NCBI gene;Acc:436702])

HSP 1 Score: 53.9138 bits (128), Expect = 8.683e-8
Identity = 37/161 (22.98%), Postives = 77/161 (47.83%), Query Frame = 1
Query:  151 VSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIAT-QTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNN--QPIKVM-ELSDKVYCADVHYPMAVVGTADKKIYVYNLQ 621
            V  + F+ D     YL+    DK++K+W ++     + +        VLD   S+D+++     +D    +W++AT Q   ++  H   +  ++F +    + +++GS D  ++ WD  +   +PI+V+ E  D V    V     + G+ D ++  Y+L+
Sbjct:   28 VRAVHFNAD---GNYLLTCGSDKSLKLWSVSRG--ALLKTYTGHGYEVLDADGSYDNSQLCSCSSDKTVILWDVATGQVTRKLRGHAGKVNCVRFNEEA--TVMLSGSIDGTVRCWDTRSRRMEPIQVLDEARDGVSSLKVSEHELLTGSVDGRLRRYDLR 181          
BLAST of mRNA export factor vs. Ensembl Cavefish
Match: snrnp40 (small nuclear ribonucleoprotein U5 subunit 40 [Source:NCBI gene;Acc:103032740])

HSP 1 Score: 52.7582 bits (125), Expect = 3.702e-7
Identity = 28/107 (26.17%), Postives = 54/107 (50.47%), Query Frame = 1
Query:  133 QAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITP-----QGQPIFRAQ-QSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTV-SQIAVHDAPIKIIKF 432
            Q   D+V+ L  S++    +YL++ S D +V++W+I P     +   IF+    +F+  +L C WS D +K      D F Y+W+  ++ +  ++  H   +  + F
Sbjct:  222 QGHGDSVTGLSLSSE---GSYLLSNSMDNSVRVWDIRPFAPKERCVKIFQGNVHNFEKNLLRCSWSSDGSKIAAGSADRFVYVWDTTSRRILYKLPGHAGSVNEVAF 325          
BLAST of mRNA export factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007594.1 (pep scaffold:Pmarinus_7.0:GL477618:2658:11743:-1 gene:ENSPMAG00000006850.1 transcript:ENSPMAT00000007594.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 196.052 bits (497), Expect = 2.548e-59
Identity = 90/186 (48.39%), Postives = 120/186 (64.52%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            +IE+   P D++SCL FS    P  YL+AGSW   V+ WE+   GQ I +AQQ    P+LD CWS D TK F + +D    MW++ +    Q+A HD PIK I +IKA +YSC+MTGSWDK LKFWD     P+  ++L ++ YCADV YPMAVV TA++ + VY L+ +P E+K+  S LK Q R
Sbjct:   29 DIEVTSPPDDSISCLSFSPAALPGNYLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPILDVCWSDDGTKVFTASSDKTAKMWDLNSNQAIQVAQHDGPIKTIHWIKAPSYSCIMTGSWDKSLKFWDTRTPNPLLTIQLPERCYCADVVYPMAVVATAERGLVVYQLENQPSEYKRIDSPLKHQHR 214          
BLAST of mRNA export factor vs. Ensembl Sea Lamprey
Match: bub3 (BUB3 mitotic checkpoint protein [Source:ZFIN;Acc:ZDB-GENE-041010-210])

HSP 1 Score: 87.4261 bits (215), Expect = 1.698e-19
Identity = 52/186 (27.96%), Postives = 96/186 (51.61%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            E ++ Q+P D ++ +KF  + S   +L+  SWD TV++ ++T   Q   R + +   PVLDC +  D T A+    DN   ++++ ++    +  H+A ++ ++F    N   ++TGSWD+ +K WD             ++VY   V     +VGTA +++ V++L+      ++  S LK Q R
Sbjct:    9 EFKLSQSPEDGITAVKFGPNSS--QFLLVSSWDCTVRLHDVTGNTQ---RVKYTHAGPVLDCAF-QDMTHAWSGGLDNTVKLYDLNSEQEIMVGTHEAAVRCVEFCPEVN--VMVTGSWDQTVKLWDPRTPCNAGSFPQPERVYTMAVSGDRLIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTR 186          
BLAST of mRNA export factor vs. Ensembl Sea Lamprey
Match: snrnp40 (small nuclear ribonucleoprotein 40 (U5) [Source:ZFIN;Acc:ZDB-GENE-040426-978])

HSP 1 Score: 55.0694 bits (131), Expect = 1.192e-8
Identity = 29/107 (27.10%), Postives = 55/107 (51.40%), Query Frame = 1
Query:  133 QAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITP-----QGQPIFRAQ-QSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTV-SQIAVHDAPIKIIKF 432
            +  +D+V+ L  S D    +YL++ + D +V+IW+I P     +   IF+    +F+  +L C WSHD +K      D F Y+W+  ++ +  ++  H   +  + F
Sbjct:  223 KGHNDSVTGLSLSPD---GSYLLSNAMDNSVRIWDIRPFAPMERCVKIFQGNVHNFEKNLLKCSWSHDGSKVSAGSADRFVYIWDTTSRRILYKLPGHAGSVNDVAF 326          
BLAST of mRNA export factor vs. Ensembl Yeast
Match: GLE2 (RNA export factor associated with the nuclear pore complex (NPC); associates with NUP116p; required for polyadenylated RNA export but not for protein import; homologous to S. pombe Rae1p and human RAE1 [Source:SGD;Acc:S000000909])

HSP 1 Score: 124.405 bits (311), Expect = 1.569e-32
Identity = 71/190 (37.37%), Postives = 104/190 (54.74%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLM--AGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKA--TNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            +I I     D++S + FS    P    M  A SWD  V+IW++   G P  RAQ    +PVL   WS+D TK      DN   +++IA+    QI +H APIK+++F++   +N  C++TGSWDK +K+WDM   QP+  + + ++VY  D    + VV TA++ I + NL      FK   S LK Q R
Sbjct:   28 DIVINSPAEDSISDIAFS----PQQDFMFSASSWDGKVRIWDVQ-NGVPQGRAQHESSSPVLCTRWSNDGTKVASGGCDNALKLYDIASGQTQQIGMHSAPIKVLRFVQCGPSNTECIVTGSWDKTIKYWDMRQPQPVSTVMMPERVYSMDNKQSLLVVATAERHIAIINLANPTTIFKATTSPLKWQTR 212          
BLAST of mRNA export factor vs. Ensembl Nematostella
Match: EDO47476 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMB7])

HSP 1 Score: 179.874 bits (455), Expect = 3.756e-53
Identity = 86/186 (46.24%), Postives = 118/186 (63.44%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            +IE+   P DT++ LKF      A +L+A SW   V+ WE+   GQ + +AQQ+   P+LDC W  D TK F +  D    MW++ +    Q+A HDAPIK   +I+A NYSC+MTGSWDKKLKFWD  +  P+  ++L ++ YCADV YPMA+VGTA + I  Y L+ +P E+K+  S LK Q R
Sbjct:    3 DIEVQSPPDDTITSLKF---CPKADFLIASSWANDVRCWEVKENGQTVPKAQQTHTGPILDCTWHDDGTKVFTASADKQCKMWDLNSNQAVQVAQHDAPIKTCNWIQAPNYSCLMTGSWDKKLKFWDTRSPNPMLSIDLPERCYCADVVYPMAIVGTAQRGIICYQLENQPSEYKRMDSPLKYQNR 185          
BLAST of mRNA export factor vs. Ensembl Nematostella
Match: EDO43356 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYP7])

HSP 1 Score: 92.4337 bits (228), Expect = 5.729e-21
Identity = 56/186 (30.11%), Postives = 94/186 (50.54%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            E ++ QAP D +S +KFS   + +++L+  SWD +V+++++        R + +    VLDCC+  D+  AF    DN   M ++    V  I  HD PI+ + + +      +++GSWD  +K WD    Q     +   KVY   +     VVGTA +K+ V++L+      ++  S LK Q R
Sbjct:    8 EFKLGQAPEDGISAVKFSP--TSSSFLLVSSWDTSVRLYDVQNDD---MRLKYNHSYSVLDCCF-QDAVHAFSGGLDNNLKMCDLNQNQVQTIGSHDDPIRCVDYCQPLGL--IVSGSWDSSIKLWDPRQKQCTGTYKQPAKVYTLALAGERLVVGTAGRKVMVWDLRNMGYVQQRRESSLKYQTR 185          
BLAST of mRNA export factor vs. Ensembl Nematostella
Match: EDO26155 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TCR0])

HSP 1 Score: 81.6481 bits (200), Expect = 7.219e-19
Identity = 40/87 (45.98%), Postives = 55/87 (63.22%), Query Frame = 1
Query:  418 KIIKFIKATNYSC-VMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            +I+  +   NY      GSWDKKLKFWD  +  P+  ++L ++ YCADV YPMA+VGTA + I  Y L+ +P E+K+  S LK Q R
Sbjct:    1 QIVALMSFMNYKRECFRGSWDKKLKFWDTRSPNPMLSIDLPERCYCADVVYPMAIVGTAQRGIICYQLENQPSEYKRMDSPLKYQNR 87          
BLAST of mRNA export factor vs. Ensembl Nematostella
Match: EDO33297 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL6])

HSP 1 Score: 52.7582 bits (125), Expect = 1.217e-7
Identity = 39/179 (21.79%), Postives = 82/179 (45.81%), Query Frame = 1
Query:  121 IEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDA--PIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKV-MELSDKVYCADVHYPMA-----VVGTADKKIYVYNLQTEPV 633
            ++  +  S+ V C  F+     +  +++GS+D++V+IW++  +     +   +   PV    ++ D      S  D    +W+ A+    +  + D   P+  +KF     Y  ++  + D  LK WD    + +K      ++ YC   ++ +      V G+ D K+Y++NLQ++ V
Sbjct:  142 LKTLKGHSNYVFCCNFN---PQSNLIVSGSFDESVRIWDV--KTGKCLKTLPAHSDPVTAVHFNRDGALIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKY--ILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCVFANFSVTGGKWIVSGSEDHKVYIWNLQSKEV 313          
BLAST of mRNA export factor vs. Ensembl Nematostella
Match: EDO44093 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWV7])

HSP 1 Score: 51.2174 bits (121), Expect = 4.446e-7
Identity = 39/169 (23.08%), Postives = 80/169 (47.34%), Query Frame = 1
Query:  124 EIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAV-HDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDK-VYCADVHYPMAVVGTADKKIYVYNLQT 624
             + +   D V CL+F         ++ GS D+T+++W++   G+ I R  +  +  V   C   D+ +      D    +W+I   T   +   H   +  ++F + T    +++GS D  ++ WDM   + + V++  +  V C +   P  + G+ADK I ++N+++
Sbjct:  143 NVLKGHMDVVLCLQFDR-----RRVVTGSSDRTIRMWDVRS-GRSI-RKMKGHKGGVR--CLQFDNERIISGSWDMTIMVWHIVKFTRLHVLYGHKGCVSCLRFDENT----LVSGSHDSTIRVWDMRTWECVLVLQGHEGAVSCLEFDAPFVLSGSADKTIKLWNVES 298          
BLAST of mRNA export factor vs. Ensembl Medaka
Match: rae1 (ribonucleic acid export 1 [Source:NCBI gene;Acc:101160646])

HSP 1 Score: 194.512 bits (493), Expect = 6.390e-58
Identity = 88/186 (47.31%), Postives = 120/186 (64.52%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            ++E+   P D++SCL FS    P  +L+AGSW   V+ WE+   GQ + +AQQ    PVLD CWS D +K F +  D    MW++ +    QIA HD PIK I +IKA NYSC+MTGSWDK LKFWD  +  P+  +++ ++ YCADV YPMAVV TA++ + VY L+ +P EF++  S LK Q R
Sbjct:   31 DVEVTSPPDDSISCLAFSPPTMPGNFLIAGSWANDVRCWEVQDNGQTVPKAQQMHTGPVLDACWSDDGSKVFTASCDKTAKMWDLNSNQAMQIAQHDGPIKAIHWIKAPNYSCIMTGSWDKTLKFWDTRSPTPMMSLQMPERCYCADVVYPMAVVATAERGLIVYQLENQPSEFRRIDSPLKHQHR 216          
BLAST of mRNA export factor vs. Ensembl Medaka
Match: rae1 (ribonucleic acid export 1 [Source:NCBI gene;Acc:101160646])

HSP 1 Score: 164.081 bits (414), Expect = 1.765e-46
Identity = 80/186 (43.01%), Postives = 109/186 (58.60%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            ++E+   P D++SCL FS    P  +L+AGSW   V+ WE+   GQ + +AQQ    PVLD CWS D +K F +  D    MW++ +    QIA HD PIK I +IKA NYSC+MTGSWDK LK    ++   ++           D  YPMAVV TA++ + VY L+ +P EF++  S LK Q R
Sbjct:   31 DVEVTSPPDDSISCLAFSPPTMPGNFLIAGSWANDVRCWEVQDNGQTVPKAQQMHTGPVLDACWSDDGSKVFTASCDKTAKMWDLNSNQAMQIAQHDGPIKAIHWIKAPNYSCIMTGSWDKTLKVRQFIHRFHVERR-------APDSVYPMAVVATAERGLIVYQLENQPSEFRRIDSPLKHQHR 209          
BLAST of mRNA export factor vs. Ensembl Medaka
Match: bub3 (BUB3 mitotic checkpoint protein [Source:NCBI gene;Acc:101164351])

HSP 1 Score: 93.5893 bits (231), Expect = 6.801e-21
Identity = 57/186 (30.65%), Postives = 97/186 (52.15%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            E ++ Q P D++S +KFS   S A +L+  SWD TV+++++   G    R +    APVLDC + +D T ++    D    M ++ T   + +  HDAPI+ +++    N   ++TGSWD+ ++ WD             +KVY   V     +VGTA +++ V++L+      ++  S LK Q R
Sbjct:    6 EYKLNQGPEDSISAVKFSP--STAQFLLVSSWDCTVRLFDV---GGNTMRMKYQHTAPVLDCAF-YDPTHSWSGGLDAQLKMHDLNTDQDTIVGAHDAPIRCVEYCPEVN--VMVTGSWDRSVRLWDPRTPCNAGTFTQPEKVYTLSVAGDRLIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTR 183          
BLAST of mRNA export factor vs. Ensembl Medaka
Match: bub3 (BUB3 mitotic checkpoint protein [Source:NCBI gene;Acc:101164351])

HSP 1 Score: 93.5893 bits (231), Expect = 6.801e-21
Identity = 57/186 (30.65%), Postives = 97/186 (52.15%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            E ++ Q P D++S +KFS   S A +L+  SWD TV+++++   G    R +    APVLDC + +D T ++    D    M ++ T   + +  HDAPI+ +++    N   ++TGSWD+ ++ WD             +KVY   V     +VGTA +++ V++L+      ++  S LK Q R
Sbjct:    6 EYKLNQGPEDSISAVKFSP--STAQFLLVSSWDCTVRLFDV---GGNTMRMKYQHTAPVLDCAF-YDPTHSWSGGLDAQLKMHDLNTDQDTIVGAHDAPIRCVEYCPEVN--VMVTGSWDRSVRLWDPRTPCNAGTFTQPEKVYTLSVAGDRLIVGTAGRRVLVWDLRNMGYVQQRRESSLKYQTR 183          
BLAST of mRNA export factor vs. Ensembl Medaka
Match: snrnp40 (small nuclear ribonucleoprotein U5 subunit 40 [Source:NCBI gene;Acc:101156339])

HSP 1 Score: 57.3806 bits (137), Expect = 9.773e-9
Identity = 36/125 (28.80%), Postives = 62/125 (49.60%), Query Frame = 1
Query:  133 QAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITP-----QGQPIFRAQ-QSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTV-SQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKL 486
               SD+V+ L  S   S  +YL++ S D TV+IW++ P     +   IF+    +F+  +L C WS D +K      D F Y+W+  ++ +  ++  H   +  + F        V++GS DK+L
Sbjct:  222 HGHSDSVTGLSLS---SEGSYLLSNSMDNTVRIWDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSTDGSKIAAGSADRFVYIWDTTSRRILYKLPGHAGSVNEVVF--HPEEPVVLSGSSDKRL 341          
BLAST of mRNA export factor vs. Planmine SMEST
Match: SMESG000032008.1 (SMESG000032008.1)

HSP 1 Score: 405.216 bits (1040), Expect = 1.931e-140
Identity = 209/210 (99.52%), Postives = 210/210 (100.00%), Query Frame = 1
Query:   46 MSFNNSFFKXXXXXXXXXXXXXXXEIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            MSFNNSFFKNGQNANQNTNQSNAQEIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQ+R
Sbjct:    1 MSFNNSFFKNGQNANQNTNQSNAQEIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQLR 210          
BLAST of mRNA export factor vs. Planmine SMEST
Match: SMESG000032005.1 (SMESG000032005.1)

HSP 1 Score: 141.354 bits (355), Expect = 4.315e-39
Identity = 60/105 (57.14%), Postives = 80/105 (76.19%), Query Frame = 1
Query:  361 MWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            MW++A    ++IA HDAPIK I +I+A +Y+CVMTG WDKKLKFWD+ +  P+  ++LSD++YCA VHYPMA V T DK ++VYNL+  PVE+K+  SQLK Q R
Sbjct:    1 MWDLAANQTTKIAAHDAPIKTIHYIQAPSYTCVMTGGWDKKLKFWDLRSQNPMSSIDLSDRIYCAAVHYPMAAVATGDKSVFVYNLENGPVEYKRLESQLKYQSR 105          
BLAST of mRNA export factor vs. Planmine SMEST
Match: SMESG000016111.1 (SMESG000016111.1)

HSP 1 Score: 84.7297 bits (208), Expect = 6.360e-18
Identity = 55/193 (28.50%), Postives = 94/193 (48.70%), Query Frame = 1
Query:  118 EIEIPQAPSDTVSCLKFSTDLSPATYLMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWD-MVNNQ--PIKVMELSDKVYCADVHYPMA----VVGTADKKIYVYNLQTEPVEFKQYPSQLKCQVR 675
            + ++   P+DT+S + F  + S   YL+A SWD  + ++++   G+   R +  ++ P+LDCC+S D+  AF     N    ++  T   + +  H  PI  + F  +TN S ++TGSWD  +  WD  VN     +K +     VY  D          VVGT  + +Y+++++      +   S LK Q R
Sbjct:    4 QFKLSNPPTDTISNVTFQPNSS--QYLLASSWDTYLHLYDVNTNGK---RLKLDYEYPILDCCFS-DANSAFAGGIGNALKFYDCNTGKSNVVGYHKQPISQVHF--STNESLLITGSWDSTVGLWDPRVNGHQSAVKFLSQPGDVYTLDTASTSGGTYLVVGTEKRYVYIWDMRKLDQAVQMRDSSLKYQTR 188          
BLAST of mRNA export factor vs. Planmine SMEST
Match: SMESG000008529.1 (SMESG000008529.1)

HSP 1 Score: 51.6026 bits (122), Expect = 4.906e-7
Identity = 36/148 (24.32%), Postives = 72/148 (48.65%), Query Frame = 1
Query:  196 LMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNIAT-QTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVM-----ELSDKVYCADVHYPMAVVGTADKKIYVYNLQ 621
            ++ GS+DKT K+W  +     ++   +   A V+   ++  ST       D    +W++ + + VS +  H A +  ++F +A N   ++TGS+D  +  WD+ N + +  +     E+S  V+  D  Y      + DK I +++L+
Sbjct:  150 IVTGSFDKTAKMW--SANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTY--VATASMDKSIKIWDLR 293          
BLAST of mRNA export factor vs. Planmine SMEST
Match: SMESG000008519.1 (SMESG000008519.1)

HSP 1 Score: 51.2174 bits (121), Expect = 5.916e-7
Identity = 36/148 (24.32%), Postives = 72/148 (48.65%), Query Frame = 1
Query:  196 LMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCTDNFGYMWNI-ATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFWDMVNNQPIKVM-----ELSDKVYCADVHYPMAVVGTADKKIYVYNLQ 621
            ++ GS+DKT K+W  +     ++   +   A V+   ++  ST       D    +W++ + + VS +  H A +  ++F +A N   ++TGS+D  +  WD+ N + +  +     E+S  V+  D  Y      + DK I +++L+
Sbjct:   28 IVTGSFDKTAKMW--SANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTY--VATASMDKSIKIWDLR 171          
The following BLAST results are available for this feature:
BLAST of mRNA export factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAE11.158e-6149.46ribonucleic acid export 1 [Source:HGNC Symbol;Acc:... [more]
RAE13.809e-6049.46ribonucleic acid export 1 [Source:HGNC Symbol;Acc:... [more]
RAE13.809e-6049.46ribonucleic acid export 1 [Source:HGNC Symbol;Acc:... [more]
RAE13.809e-6049.46ribonucleic acid export 1 [Source:HGNC Symbol;Acc:... [more]
RAE11.432e-5949.46ribonucleic acid export 1 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of mRNA export factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rae-12.654e-4744.09mRNA export factor rae-1 [Source:UniProtKB/Swiss-... [more]
rae-12.654e-4744.09mRNA export factor rae-1 [Source:UniProtKB/Swiss-... [more]
bub-34.348e-1526.84Mitotic checkpoint protein bub-3 [Source:UniProtK... [more]
wdr-5.25.378e-825.00WD repeat-containing protein wdr-5.2 [Source:UniP... [more]
wdr-5.11.344e-623.03WD repeat-containing protein wdr-5.1 [Source:UniP... [more]
back to top
BLAST of mRNA export factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rae11.397e-5443.55gene:FBgn0034646 transcript:FBtr0071683[more]
CG127823.129e-2430.32gene:FBgn0034838 transcript:FBtr0072048[more]
Bub36.525e-1929.63gene:FBgn0025457 transcript:FBtr0339148[more]
Bub36.525e-1929.63gene:FBgn0025457 transcript:FBtr0085465[more]
wds1.235e-621.71gene:FBgn0040066 transcript:FBtr0308566[more]
back to top
BLAST of mRNA export factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rae11.357e-5645.70ribonucleic acid export 1 [Source:NCBI gene;Acc:39... [more]
rae11.581e-5645.70ribonucleic acid export 1 [Source:NCBI gene;Acc:39... [more]
bub31.527e-2030.65BUB3 mitotic checkpoint protein [Source:ZFIN;Acc:Z... [more]
bub31.870e-2030.65BUB3 mitotic checkpoint protein [Source:ZFIN;Acc:Z... [more]
snrnp401.756e-929.60small nuclear ribonucleoprotein 40 (U5) [Source:ZF... [more]
back to top
BLAST of mRNA export factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bub36.209e-2231.18BUB3 mitotic checkpoint protein [Source:NCBI gene;... [more]
bub36.387e-2231.18BUB3 mitotic checkpoint protein [Source:NCBI gene;... [more]
bub39.963e-2231.18BUB3 mitotic checkpoint protein [Source:NCBI gene;... [more]
bub31.065e-2131.18BUB3 mitotic checkpoint protein [Source:NCBI gene;... [more]
mindy45.998e-822.60MINDY lysine 48 deubiquitinase 4 [Source:Xenbase;A... [more]
back to top
BLAST of mRNA export factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rae16.188e-6049.46ribonucleic acid export 1 [Source:MGI Symbol;Acc:M... [more]
Rae14.732e-5849.71ribonucleic acid export 1 [Source:MGI Symbol;Acc:M... [more]
Bub36.052e-1929.03BUB3 mitotic checkpoint protein [Source:MGI Symbol... [more]
Bub36.322e-1929.03BUB3 mitotic checkpoint protein [Source:MGI Symbol... [more]
Bub35.180e-1428.67BUB3 mitotic checkpoint protein [Source:MGI Symbol... [more]
back to top
BLAST of mRNA export factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5RF99|RAEL1_PONAB1.829e-5949.46mRNA export factor OS=Pongo abelii OX=9601 GN=RAE1... [more]
sp|P78406|RAE1L_HUMAN1.829e-5949.46mRNA export factor OS=Homo sapiens OX=9606 GN=RAE1... [more]
sp|Q4R6D2|RAE1L_MACFA3.426e-5949.46mRNA export factor OS=Macaca fascicularis OX=9541 ... [more]
sp|Q3SWS8|RAE1L_RAT3.613e-5949.46mRNA export factor OS=Rattus norvegicus OX=10116 G... [more]
sp|A5GFN6|RAEL1_PIG3.892e-5949.46mRNA export factor OS=Sus scrofa OX=9823 GN=RAE1 P... [more]
back to top
BLAST of mRNA export factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A430QT515.457e-6249.73mRNA export factor OS=Schistosoma bovis OX=6184 GN... [more]
V4A6N04.535e-6153.23WD_REPEATS_REGION domain-containing protein OS=Lot... [more]
A0A2H1BWF42.011e-6048.92Nucleoporin GLE2 domain protein OS=Fasciola hepati... [more]
A0A2K5ISV64.846e-6050.00Ribonucleic acid export 1 OS=Colobus angolensis pa... [more]
A0A2K6DZM34.846e-6050.00Ribonucleic acid export 1 OS=Macaca nemestrina OX=... [more]
back to top
BLAST of mRNA export factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rae16.420e-5746.24ribonucleic acid export 1 [Source:NCBI gene;Acc:10... [more]
bub33.008e-2131.18BUB3 mitotic checkpoint protein [Source:NCBI gene;... [more]
snrnp401.095e-827.20small nuclear ribonucleoprotein U5 subunit 40 [Sou... [more]
wdr838.683e-822.98WD repeat domain containing 83 [Source:NCBI gene;A... [more]
snrnp403.702e-726.17small nuclear ribonucleoprotein U5 subunit 40 [Sou... [more]
back to top
BLAST of mRNA export factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000007594.12.548e-5948.39pep scaffold:Pmarinus_7.0:GL477618:2658:11743:-1 g... [more]
bub31.698e-1927.96BUB3 mitotic checkpoint protein [Source:ZFIN;Acc:Z... [more]
snrnp401.192e-827.10small nuclear ribonucleoprotein 40 (U5) [Source:ZF... [more]
back to top
BLAST of mRNA export factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
GLE21.569e-3237.37RNA export factor associated with the nuclear pore... [more]
back to top
BLAST of mRNA export factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO474763.756e-5346.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433565.729e-2130.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO261557.219e-1945.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332971.217e-721.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO440934.446e-723.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of mRNA export factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rae16.390e-5847.31ribonucleic acid export 1 [Source:NCBI gene;Acc:10... [more]
rae11.765e-4643.01ribonucleic acid export 1 [Source:NCBI gene;Acc:10... [more]
bub36.801e-2130.65BUB3 mitotic checkpoint protein [Source:NCBI gene;... [more]
bub36.801e-2130.65BUB3 mitotic checkpoint protein [Source:NCBI gene;... [more]
snrnp409.773e-928.80small nuclear ribonucleoprotein U5 subunit 40 [Sou... [more]
back to top
BLAST of mRNA export factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000032008.11.931e-14099.52SMESG000032008.1[more]
SMESG000032005.14.315e-3957.14SMESG000032005.1[more]
SMESG000016111.16.360e-1828.50SMESG000016111.1[more]
SMESG000008529.14.906e-724.32SMESG000008529.1[more]
SMESG000008519.15.916e-724.32SMESG000008519.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002898 ID=SMED30002898|Name=mRNA export factor|organism=Schmidtea mediterranea sexual|type=transcript|length=1233bp
GTACTTTGCTTAAAACTTTAAGTTAAAAGTGTAATTTTGAGTAAAATGTC
TTTTAACAATAGCTTCTTTAAAAATGGCCAGAATGCAAATCAAAATACAA
ACCAATCTAACGCACAAGAAATTGAAATTCCTCAAGCTCCTTCTGATACT
GTTTCATGCTTAAAGTTTAGCACTGATTTATCTCCTGCTACTTACTTAAT
GGCGGGCAGTTGGGATAAGACTGTAAAAATATGGGAAATAACACCGCAAG
GCCAACCAATCTTTCGTGCTCAGCAGAGTTTCCAAGCTCCGGTTTTAGAT
TGTTGTTGGAGTCATGATTCAACAAAAGCATTTATTTCTTGTACAGATAA
TTTCGGTTACATGTGGAATATCGCCACACAAACTGTTTCTCAAATTGCAG
TTCACGATGCACCAATTAAAATAATAAAGTTTATAAAAGCAACTAATTAT
TCTTGTGTTATGACTGGAAGTTGGGATAAAAAACTAAAATTTTGGGATAT
GGTGAATAATCAACCAATTAAAGTAATGGAACTTTCTGACAAAGTCTATT
GTGCTGATGTTCATTATCCCATGGCTGTAGTTGGTACAGCTGATAAAAAG
ATTTATGTTTACAATTTGCAAACTGAACCTGTTGAATTCAAACAATATCC
ATCGCAATTAAAATGTCAAGTAAGGTTTCTAGATGACTTTATTTTAAGTT
AAATATCATTATTAATTCAAATTAAATGTATTTTTAAATTCAAATATTTC
GTTATATATTAACCTTAAAAAGTTATTAAATTACAGTAAAAATGAGTTAT
TGAGTCAGAGAGATACTGTTACTAATATAAATAGTAAGGTGGGATAAAGT
TTCTTAGCTTAATGCAACTCCTACCATAATCAGGCTTACATCACTTTTTT
AAAAATTTCAGTATCATTTTAAAGAACAAGTTTTCCTATAATATTCCTAT
TAAAAGGTATGAGTAAAAAATGTGGTTCATTTGTTCGAATGGTAACTCGG
TAACCGAATTTTAGAATTCCTTGAAATTTACTGGAATGGACTAAAGGGCT
TTCTATCAATATCTAAATATTCCTGAGAGGATATTTAAAGTTCTTTCCAG
CAAACTAATCGATCTGATTGTGCATTTCCTGCTACGGCGCCTATTTGTAC
TTTTTTCTAACCCTTTTACTATCAATTCCTTTGAAATTCAATTTTTCATT
TTTTATCACGCTATAGTGCGGGGATTTGAGATT
back to top

protein sequence of SMED30002898-orf-1

>SMED30002898-orf-1 ID=SMED30002898-orf-1|Name=SMED30002898-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=219bp
MSFNNSFFKNGQNANQNTNQSNAQEIEIPQAPSDTVSCLKFSTDLSPATY
LMAGSWDKTVKIWEITPQGQPIFRAQQSFQAPVLDCCWSHDSTKAFISCT
DNFGYMWNIATQTVSQIAVHDAPIKIIKFIKATNYSCVMTGSWDKKLKFW
DMVNNQPIKVMELSDKVYCADVHYPMAVVGTADKKIYVYNLQTEPVEFKQ
YPSQLKCQVRFLDDFILS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006406mRNA export from nucleus
GO:0071407cellular response to organic cyclic compound
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR037631Gle2/RAE1
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003723RNA binding
Vocabulary: cellular component
TermDefinition
GO:0001650fibrillar center
GO:0005634nucleus
GO:0005635nuclear envelope
GO:0005643nuclear pore
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 154..190
e-value: 10.0
score: 10.6
coord: 110..151
e-value: 0.42
score: 19.4
coord: 22..64
e-value: 0.0017
score: 27.6
coord: 68..108
e-value: 1.5
score: 15.9
IPR001680WD40 repeatPFAMPF00400WD40coord: 136..151
e-value: 0.15
score: 13.0
coord: 36..63
e-value: 0.0042
score: 17.9
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 29..65
score: 9.573
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 3..218
e-value: 1.2E-54
score: 188.1
IPR037631mRNA export factor Gle2/RAE1PANTHERPTHR10971:SF11MRNA EXPORT FACTORcoord: 13..211
NoneNo IPR availablePANTHERPTHR10971MRNA EXPORT FACTOR AND BUB3coord: 13..211
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 138..152
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 51..65
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 29..160
score: 12.763
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 27..193