SMED30002896

Overview
NameSMED30002896
Smed IDSMED30002896
Length (bp)3983
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30002896 (SMED30002896) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30002896 (SMED30002896) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30002896 (SMED30002896) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30002896 (SMED30002896) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002896

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30002896SMESG000065225.1 SMESG000065211.1 SMESG000065210.1 dd_Smed_v4_7442_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002896SMESG000065225.1 SMESG000065211.1 SMESG000065210.1 dd_Smed_v4_7442_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30002896SMESG000065225.1 SMESG000065211.1 SMESG000065210.1 dd_Smed_v4_7442_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30002896SMESG000065225.1 SMESG000065211.1 SMESG000065210.1 dd_Smed_v4_7442_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30002896SMESG000065225.1 SMESG000065211.1 SMESG000065210.1 dd_Smed_v4_7442_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002896SMESG000065225.1 SMESG000065211.1 SMESG000065210.1 dd_Smed_v4_7442_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002896SMESG000065225.1 SMESG000065211.1 SMESG000065210.1 dd_Smed_v4_7442_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30002896SMESG000065225.1 SMESG000065211.1 SMESG000065210.1 dd_Smed_v4_7442_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002896SMESG000065225.1 SMESG000065211.1 SMESG000065210.1 Contig48047uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002896SMESG000065225.1 SMESG000065211.1 SMESG000065210.1 Contig48047newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
zeta neoblastSMED30002896SMESG000065225.1 SMESG000065211.1 SMESG000065210.1 dd_Smed_v4_7442_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30002896 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.005952:14503..22091 +15603
Homology
BLAST of SMED30002896 vs. Ensembl Human
Match: ZNF91 (zinc finger protein 91 [Source:HGNC Symbol;Acc:HGNC:13166])

HSP 1 Score: 68.9366 bits (167), Expect = 6.109e-11
Identity = 102/487 (20.94%), Postives = 170/487 (34.91%), Query Frame = 2
Query: 1340 RAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQK----------ENCSPNFIKSLNNTES----NGKPLLPIAPAQKADKWKLNPNPSDI----EKPLLTPIKSETVVIKNVISQNDTDATFQKNMKFAE---KFLNNPAITLNKGSQC-----VCNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATAKPILHFIHN---CEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSK-------KSLDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENE------SCINSIVEADGIATNDKPAAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQ 2674
            + + C  C   F N      H + H + + +KC  CD  F RL  L +H+           E C   F +S N T       G+         KA  W  +          EKP       +  +  + ++++    T +K  K  E    F  +  +T +K          C  C   F  ++++ KH ++H             + KCE   K         N  S  T   I+H        E C   F     L  H   +H  +      + G   S+       K +      + C +CG +F  + +L  H+              +  KC+ C K FR   TL EH+ +H  E       C  +  ++  +  + +   GE       K EE                 +  + T+K   +    +  ++C+EC K F   S+L+ H + H   + KP+ C  C + F  + TL  H++
Sbjct:  656 KPYKCKECGKAFSNSSTLANHKITHTEEKPYKCKECDKTFKRLSTLTKHKIIHAGEKLYKCEECGKAFNRSSNLTIHKFIHTGEKPYKCEECGKAFNWSSSLTKHKRIHTREKPFKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEECGKAFSRSSTLTKHKTIHTGEKPYKCKECGKAFKHSSALAKHKIIH---------AGEKLYKCEECGK-------AFNQSSNLTTHKIIHTKEKPSKSEECDKAFIWSSTLTEHK-RIHTREKTYKCEECGKAFSQPSHLTTHKRMHTGEKPYKCEECGKAFSQSSTLTTHK--------IIHTGEKPYKCEECGKAFRKSSTLTEHKIIHTGEKPYKCEECGKAFSQSSTLTRHTRMHTGEKP----YKCEE----------CGKAFNRSSKLTTHK---IIHTGEKPYKCEECGKAFISSSTLNGHKRIH--TREKPYKCEECGKAFSQSSTLTRHKR 1098          

HSP 2 Score: 58.9214 bits (141), Expect = 6.629e-8
Identity = 71/319 (22.26%), Postives = 118/319 (36.99%), Query Frame = 2
Query: 1772 CVCNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAK-LKPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENE------SCINSIVEADGIA------TNDKPAAGES--TTFPRIK--TEEYILXXXXXXXXXXXXXXTYSIPT-YKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQ 2674
            C C  C+  F+ ++++  H  +H         T     KCE   K  K L   T + +  A  K     I+ CE C   F     L RH                      K +      + C +CG +F  + +L  H+              +  KC+ C K F    TL +H+R+H  E       C  +   +  +A      T +KP   +     F R+   T+  I+          +    ++  +     K     +  ++C+EC K F   SSL+ H +  F+ + KPF C  C + F+ + TL  H++
Sbjct:  210 CKCKECEKTFHWSSTLTNHKEIH---------TEDKPYKCEECGKAFKQLSTLTTHKIICAKEK-----IYKCEECGKAFLWSSTLTRH----------------------KRIHTGEKPYKCEECGKAFSHSSTLAKHKR--------IHTGEKPYKCEECGKAFSRSSTLAKHKRIHTGEKPYKCKECGKAFSNSSTLANHKITHTEEKPYKCKECDKAFKRLSTLTKHKIIHAGEKLYKCEECGKAFNRSSNLTIHKFIHTGEKPYKCEECGKAFNWSSSLTKHKR--FHTREKPFKCKECGKAFIWSSTLTRHKR 482          

HSP 3 Score: 56.225 bits (134), Expect = 4.409e-7
Identity = 102/488 (20.90%), Postives = 168/488 (34.43%), Query Frame = 2
Query: 1340 RAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQK----------ENCSPNFIKSLNNTES----NGKPLLPIAPAQKADKWKLNPNPSDI----EKPLLTPIKSETVVIKNVISQNDTDATFQKNMKFAE---KFLNNPAITLNK----GSQCV-CNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATAKPILHF---IHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENE------SCINSIVEADGIA------TNDKPAAGES--TTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQ 2674
            + + C  C   F N      H + H + + +KC  CD  F RL  L +H+           E C   F +S N T       G+         KA  W  +          EKP       +  +  + ++++    T +K  K  E    F  +  +T +K    G +      C   F  + ++ KH ++H R   ++ Y      KC+   K            ST T   I+H    ++ CE C   F     L  H                      K +      + C +CG +F  + +L  H+              +  KC+ C K F +   L +H+R+H  E       C  +   +  +A      T +KP   +    TF R+                          T  K K+    + L++C+EC K F   S+L+ H   H     KP+ C  C + F  + +L  H++
Sbjct:  348 KPYKCKECGKAFSNSSTLANHKITHTEEKPYKCKECDKAFKRLSTLTKHKIIHAGEKLYKCEECGKAFNRSSNLTIHKFIHTGEKPYKCEECGKAFNWSSSLTKHKRFHTREKPFKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEECGKAFRQSSTLTKHKIIHTGEKPYKFEECGKAFRQSLTLNKHKIIHSR---EKPY------KCKECGK-------AFKQFSTLTTHKIIHAGKKLYKCEECGKAFNHSSSLSTH----------------------KIIHTGEKSYKCEECGKAFLWSSTLRRHKR--------IHTGEKPYKCEECGKAFSHSSALAKHKRIHTGEKPYKCKECGKAFSNSSTLANHKITHTEEKPYKCKECDKTFKRL-------------------------STLTKHKIIHAGEKLYKCEECGKAFNRSSNLTIHKFIHTG--EKPYKCEECGKAFNWSSSLTKHKR 762          
BLAST of SMED30002896 vs. Ensembl Human
Match: ZNF91 (zinc finger protein 91 [Source:HGNC Symbol;Acc:HGNC:13166])

HSP 1 Score: 68.9366 bits (167), Expect = 6.480e-11
Identity = 102/487 (20.94%), Postives = 170/487 (34.91%), Query Frame = 2
Query: 1340 RAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQK----------ENCSPNFIKSLNNTES----NGKPLLPIAPAQKADKWKLNPNPSDI----EKPLLTPIKSETVVIKNVISQNDTDATFQKNMKFAE---KFLNNPAITLNKGSQC-----VCNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATAKPILHFIHN---CEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSK-------KSLDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENE------SCINSIVEADGIATNDKPAAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQ 2674
            + + C  C   F N      H + H + + +KC  CD  F RL  L +H+           E C   F +S N T       G+         KA  W  +          EKP       +  +  + ++++    T +K  K  E    F  +  +T +K          C  C   F  ++++ KH ++H             + KCE   K         N  S  T   I+H        E C   F     L  H   +H  +      + G   S+       K +      + C +CG +F  + +L  H+              +  KC+ C K FR   TL EH+ +H  E       C  +  ++  +  + +   GE       K EE                 +  + T+K   +    +  ++C+EC K F   S+L+ H + H   + KP+ C  C + F  + TL  H++
Sbjct:  624 KPYKCKECGKAFSNSSTLANHKITHTEEKPYKCKECDKTFKRLSTLTKHKIIHAGEKLYKCEECGKAFNRSSNLTIHKFIHTGEKPYKCEECGKAFNWSSSLTKHKRIHTREKPFKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEECGKAFSRSSTLTKHKTIHTGEKPYKCKECGKAFKHSSALAKHKIIH---------AGEKLYKCEECGK-------AFNQSSNLTTHKIIHTKEKPSKSEECDKAFIWSSTLTEHK-RIHTREKTYKCEECGKAFSQPSHLTTHKRMHTGEKPYKCEECGKAFSQSSTLTTHK--------IIHTGEKPYKCEECGKAFRKSSTLTEHKIIHTGEKPYKCEECGKAFSQSSTLTRHTRMHTGEKP----YKCEE----------CGKAFNRSSKLTTHK---IIHTGEKPYKCEECGKAFISSSTLNGHKRIH--TREKPYKCEECGKAFSQSSTLTRHKR 1066          

HSP 2 Score: 58.9214 bits (141), Expect = 8.134e-8
Identity = 71/319 (22.26%), Postives = 118/319 (36.99%), Query Frame = 2
Query: 1772 CVCNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAK-LKPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENE------SCINSIVEADGIA------TNDKPAAGES--TTFPRIK--TEEYILXXXXXXXXXXXXXXTYSIPT-YKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQ 2674
            C C  C+  F+ ++++  H  +H         T     KCE   K  K L   T + +  A  K     I+ CE C   F     L RH                      K +      + C +CG +F  + +L  H+              +  KC+ C K F    TL +H+R+H  E       C  +   +  +A      T +KP   +     F R+   T+  I+          +    ++  +     K     +  ++C+EC K F   SSL+ H +  F+ + KPF C  C + F+ + TL  H++
Sbjct:  178 CKCKECEKTFHWSSTLTNHKEIH---------TEDKPYKCEECGKAFKQLSTLTTHKIICAKEK-----IYKCEECGKAFLWSSTLTRH----------------------KRIHTGEKPYKCEECGKAFSHSSTLAKHKR--------IHTGEKPYKCEECGKAFSRSSTLAKHKRIHTGEKPYKCKECGKAFSNSSTLANHKITHTEEKPYKCKECDKAFKRLSTLTKHKIIHAGEKLYKCEECGKAFNRSSNLTIHKFIHTGEKPYKCEECGKAFNWSSSLTKHKR--FHTREKPFKCKECGKAFIWSSTLTRHKR 450          

HSP 3 Score: 56.225 bits (134), Expect = 4.808e-7
Identity = 102/488 (20.90%), Postives = 168/488 (34.43%), Query Frame = 2
Query: 1340 RAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQK----------ENCSPNFIKSLNNTES----NGKPLLPIAPAQKADKWKLNPNPSDI----EKPLLTPIKSETVVIKNVISQNDTDATFQKNMKFAE---KFLNNPAITLNK----GSQCV-CNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATAKPILHF---IHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENE------SCINSIVEADGIA------TNDKPAAGES--TTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQ 2674
            + + C  C   F N      H + H + + +KC  CD  F RL  L +H+           E C   F +S N T       G+         KA  W  +          EKP       +  +  + ++++    T +K  K  E    F  +  +T +K    G +      C   F  + ++ KH ++H R   ++ Y      KC+   K            ST T   I+H    ++ CE C   F     L  H                      K +      + C +CG +F  + +L  H+              +  KC+ C K F +   L +H+R+H  E       C  +   +  +A      T +KP   +    TF R+                          T  K K+    + L++C+EC K F   S+L+ H   H     KP+ C  C + F  + +L  H++
Sbjct:  316 KPYKCKECGKAFSNSSTLANHKITHTEEKPYKCKECDKAFKRLSTLTKHKIIHAGEKLYKCEECGKAFNRSSNLTIHKFIHTGEKPYKCEECGKAFNWSSSLTKHKRFHTREKPFKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEECGKAFRQSSTLTKHKIIHTGEKPYKFEECGKAFRQSLTLNKHKIIHSR---EKPY------KCKECGK-------AFKQFSTLTTHKIIHAGKKLYKCEECGKAFNHSSSLSTH----------------------KIIHTGEKSYKCEECGKAFLWSSTLRRHKR--------IHTGEKPYKCEECGKAFSHSSALAKHKRIHTGEKPYKCKECGKAFSNSSTLANHKITHTEEKPYKCKECDKTFKRL-------------------------STLTKHKIIHAGEKLYKCEECGKAFNRSSNLTIHKFIHTG--EKPYKCEECGKAFNWSSSLTKHKR 730          
BLAST of SMED30002896 vs. Ensembl Human
Match: ZNF418 (zinc finger protein 418 [Source:HGNC Symbol;Acc:HGNC:20647])

HSP 1 Score: 68.5514 bits (166), Expect = 6.725e-11
Identity = 83/349 (23.78%), Postives = 123/349 (35.24%), Query Frame = 2
Query: 1778 CNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAK-LKPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLK-------FVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENE------SCINSIVEADGIATNDKPAAGE--------STTFP---------RIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVP-------------------PNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQ 2674
            C  C   F  N +++KH  +H         T     +CE   K      N   +     + +P       CE C   F+ K  L  H H VH  +      + G   S+K    N  +       + C +CG SF    +LI H+              R  +C  CRK FR    L EH+R+H  E       C  S  ++ G   + +   GE          +FP         R+ T E          + ++ +S         A+ P                      +  +EC EC KTFT RS+   H + H   + KP+ CS C + F  T +L  HR+
Sbjct:  231 CGECGKSFSQNGTLIKHQRVH---------TGERPYECEECGKCFTQKGNLIQHQRGHTSERPY-----ECEECGKCFSQKGTLTEH-HRVHTRERPYECGECGKSFSRKGHLRNHQRGHTGERPYECGECGKSFSRKGNLIQHQRS--------HTGERPYECRECRKLFRGKSHLIEHQRVHTGERPYECNECGKSFQDSSGFRVHQRVHTGEKPFECSECGKSFPQSCSLLRHRRVHTGERPYECGECGKSFHQSSSLLRHQKTHTAERPYECRECGKFFSSLLEHRRVHTGERPYECRECGKTFTRRSAHFKHQRLH--TRGKPYECSECGKSFAETFSLTEHRR 554          
BLAST of SMED30002896 vs. Ensembl Human
Match: ZNF418 (zinc finger protein 418 [Source:HGNC Symbol;Acc:HGNC:20647])

HSP 1 Score: 68.1662 bits (165), Expect = 7.923e-11
Identity = 83/349 (23.78%), Postives = 124/349 (35.53%), Query Frame = 2
Query: 1778 CNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAK-LKPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLK-------FVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENE------SCINSIVEADGIATNDKPAAGE--------STTFP---------RIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVP-------------------PNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQ 2674
            C  C   F  N +++KH  +H         T     +CE   K      N   +     + +P     + CE C   F+ K  L  H H VH  +      + G   S+K    N  +       + C +CG SF    +LI H+              R  +C  CRK FR    L EH+R+H  E       C  S  ++ G   + +   GE          +FP         R+ T E          + ++ +S         A+ P                      +  +EC EC KTFT RS+   H + H   + KP+ CS C + F  T +L  HR+
Sbjct:  337 CGECGKSFSQNGTLIKHQRVH---------TGERPYECEECGKCFTQKGNLIQHQRGHTSERP-----YECEECGKCFSQKGTLTEH-HRVHTRERPYECGECGKSFSRKGHLRNHQRGHTGERPYECGECGKSFSRKGNLIQHQRS--------HTGERPYECRECRKLFRGKSHLIEHQRVHTGERPYECNECGKSFQDSSGFRVHQRVHTGEKPFECSECGKSFPQSCSLLRHRRVHTGERPYECGECGKSFHQSSSLLRHQKTHTAERPYECRECGKFFSSLLEHRRVHTGERPYECRECGKTFTRRSAHFKHQRLH--TRGKPYECSECGKSFAETFSLTEHRR 660          
BLAST of SMED30002896 vs. Ensembl Human
Match: ZNF418 (zinc finger protein 418 [Source:HGNC Symbol;Acc:HGNC:20647])

HSP 1 Score: 68.1662 bits (165), Expect = 8.594e-11
Identity = 83/349 (23.78%), Postives = 124/349 (35.53%), Query Frame = 2
Query: 1778 CNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAK-LKPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLK-------FVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENE------SCINSIVEADGIATNDKPAAGE--------STTFP---------RIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVP-------------------PNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQ 2674
            C  C   F  N +++KH  +H         T     +CE   K      N   +     + +P     + CE C   F+ K  L  H H VH  +      + G   S+K    N  +       + C +CG SF    +LI H+              R  +C  CRK FR    L EH+R+H  E       C  S  ++ G   + +   GE          +FP         R+ T E          + ++ +S         A+ P                      +  +EC EC KTFT RS+   H + H   + KP+ CS C + F  T +L  HR+
Sbjct:  316 CGECGKSFSQNGTLIKHQRVH---------TGERPYECEECGKCFTQKGNLIQHQRGHTSERP-----YECEECGKCFSQKGTLTEH-HRVHTRERPYECGECGKSFSRKGHLRNHQRGHTGERPYECGECGKSFSRKGNLIQHQRS--------HTGERPYECRECRKLFRGKSHLIEHQRVHTGERPYECNECGKSFQDSSGFRVHQRVHTGEKPFECSECGKSFPQSCSLLRHRRVHTGERPYECGECGKSFHQSSSLLRHQKTHTAERPYECRECGKFFSSLLEHRRVHTGERPYECRECGKTFTRRSAHFKHQRLH--TRGKPYECSECGKSFAETFSLTEHRR 639          
BLAST of SMED30002896 vs. Ensembl Zebrafish
Match: si:ch73-367f21.5 (si:ch73-367f21.5 [Source:ZFIN;Acc:ZDB-GENE-120214-29])

HSP 1 Score: 72.7886 bits (177), Expect = 1.772e-12
Identity = 107/491 (21.79%), Postives = 160/491 (32.59%), Query Frame = 2
Query: 1262 SRVYSITNQNELNIN-GSSNRYGRFRKRAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQKENCSPNFIKSLNNTESNGKPLL-PIAPAQKADKWKLNPNPS--DIEKPLLTPIKSETVVIKNVISQNDTDATFQKNMKFAEKFLNNPAITLNKGSQCVCNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATA-KPILHFIHNCEHCSSQFASKKGLQRHLH---------SVHVDQGIDVKYDSGVDLSKKSLDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENE------SCINSIVEADGIATNDKPAAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQ 2674
            SR++  T+Q  L I+ G S          F C  C  IF   +  + H ++H   ++F C  C   F +++ LK H K               S   P   P        K  L  +      EKP + P   +   IK+ +  +    T +K                       C +C   F    S+ KHL +H       G    S  +C    ++K  L    N +   T  KP     + C+ C   F  K+ L+RH+            H  +   V  D  + +    +      F C  CG SF +NK L  H               +   C  C KRFR    L+ H RLH  E       C  S  E   +  + +   GE                                               F CD+C K+F  +  L  H++ H     KPF+C  C + F+    L+ H++
Sbjct:   13 SRMH-FTDQPSLKIHTGESGE-------PFTCKQCGEIFTTNQSHECHTMIHNGEQTFICSECGKSFTQMRYLKNHMK-------------IHSGDHPFTCPECDKCFTVKQSLETHLKIHTGEKPFICPYCGKNFRIKHSLEGHMRIHTGEKPYP--------------------CQVCGKSFREKQSLEKHLTIH------TGEKPYSCPECGKSFRVKNCLE---NHIKIHTGEKP-----YTCQECGKSFTEKQNLKRHMRIHTGEKPFTCSHCGKSFRVSKDLKIHVR---IHTGEKPFSCQQCGKSFSENKKLTSH--------MRIHTGEKPFVCSHCGKRFRGKQNLESHIRLHTGEKRYTCPQCGKSYNEQKSLENHIRSHTGEKP---------------------------------------------FACDQCGKSFRQQRILKGHIRIHTG--EKPFTCPQCGKSFIEKTKLERHKK 390          
BLAST of SMED30002896 vs. Ensembl Zebrafish
Match: si:ch73-367f21.4 (si:ch73-367f21.4 [Source:ZFIN;Acc:ZDB-GENE-120214-27])

HSP 1 Score: 72.0182 bits (175), Expect = 2.375e-12
Identity = 113/487 (23.20%), Postives = 162/487 (33.26%), Query Frame = 2
Query: 1280 TNQNELNIN-GSSNRYGRFRKRAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQKENCSPNFIKSLNNTESNGKPLL-PIAPAQKADKWKLNPNPS--DIEKPLLTPIKSETVVIKNVISQNDTDATFQKNMKFAEKFLNNPAITLNKGSQCVCNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATA-KPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKS-------LDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENESCINSIVEADGIATNDKPAAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSIP----TYKKAKVPPN------ADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQ 2674
            T Q+ L I+ G S         +F C  C  IF   +  + H ++H     F C  C   F +++ LK H+K               +   P   P        K  L  +      EKP   P   +   IK+ +  +    T +K  K                    C  C   F     + KHL +H       G    S  +C    ++K  L    N + T T  KP     + C+ C   FA K+ L+RH+  +H  +      + G     K        +      F C  CG SF +NK+L  H               +   C  C K FR    L  H RLH                T DKP                                 YS P    +Y + K   N       +  F CD+C KTFT +S+L  H+K H     KPF+C  C + F+    L+ H++
Sbjct:   21 TEQSSLKIHTGESGE-------SFTCKQCGEIFTTNQSLESHKVIHTGEHIFICSECGKSFTQMRYLKNHRK-------------IHTGDHPFTCPECDKCFTMKHSLESHLKIHTGEKPFTCPDCGKKFRIKHSLEGHMRIHTGEKPYK--------------------CRECGKNFREKQILDKHLTIH------TGEKPYSCPECGRNFRVKKCLE---NHIKTHTGEKP-----YTCQDCGISFAVKQNLKRHM-RIHTGEKPYSCPECGRSFRVKQDLKSHVRIHTGEKPFSCQQCGKSFSENKTLESH--------MRIHTGEKPFTCSQCGKNFRRKQNLKSHMRLH----------------TGDKP---------------------------------YSCPQCGKSYNEQKSLENHIRTHTGEKPFACDQCGKTFTQQSTLRGHIKIHTG--EKPFTCPQCGKSFIERTKLERHKK 393          
BLAST of SMED30002896 vs. Ensembl Zebrafish
Match: si:ch73-367f21.4 (si:ch73-367f21.4 [Source:ZFIN;Acc:ZDB-GENE-120214-27])

HSP 1 Score: 72.0182 bits (175), Expect = 2.728e-12
Identity = 113/487 (23.20%), Postives = 162/487 (33.26%), Query Frame = 2
Query: 1280 TNQNELNIN-GSSNRYGRFRKRAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQKENCSPNFIKSLNNTESNGKPLL-PIAPAQKADKWKLNPNPS--DIEKPLLTPIKSETVVIKNVISQNDTDATFQKNMKFAEKFLNNPAITLNKGSQCVCNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATA-KPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKS-------LDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENESCINSIVEADGIATNDKPAAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSIP----TYKKAKVPPN------ADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQ 2674
            T Q+ L I+ G S         +F C  C  IF   +  + H ++H     F C  C   F +++ LK H+K               +   P   P        K  L  +      EKP   P   +   IK+ +  +    T +K  K                    C  C   F     + KHL +H       G    S  +C    ++K  L    N + T T  KP     + C+ C   FA K+ L+RH+  +H  +      + G     K        +      F C  CG SF +NK+L  H               +   C  C K FR    L  H RLH                T DKP                                 YS P    +Y + K   N       +  F CD+C KTFT +S+L  H+K H     KPF+C  C + F+    L+ H++
Sbjct:   21 TEQSSLKIHTGESGE-------SFTCKQCGEIFTTNQSLESHKVIHTGEHIFICSECGKSFTQMRYLKNHRK-------------IHTGDHPFTCPECDKCFTMKHSLESHLKIHTGEKPFTCPDCGKKFRIKHSLEGHMRIHTGEKPYK--------------------CRECGKNFREKQILDKHLTIH------TGEKPYSCPECGRNFRVKKCLE---NHIKTHTGEKP-----YTCQDCGISFAVKQNLKRHM-RIHTGEKPYSCPECGRSFRVKQDLKSHVRIHTGEKPFSCQQCGKSFSENKTLESH--------MRIHTGEKPFTCSQCGKNFRRKQNLKSHMRLH----------------TGDKP---------------------------------YSCPQCGKSYNEQKSLENHIRTHTGEKPFACDQCGKTFTQQSTLRGHIKIHTG--EKPFTCPQCGKSFIERTKLERHKK 393          
BLAST of SMED30002896 vs. Ensembl Zebrafish
Match: si:ch73-367f21.6 (si:ch73-367f21.6 [Source:ZFIN;Acc:ZDB-GENE-120214-31])

HSP 1 Score: 67.3958 bits (163), Expect = 6.802e-11
Identity = 99/463 (21.38%), Postives = 152/463 (32.83%), Query Frame = 2
Query: 1346 FVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQKENCS------PNFIKSLNNTESNGKPLLPIAPAQKADKWKLNPNPSDIEKPLLTPIKSETVVIKNVISQNDTDATFQKNMKFAEKFLNNPAITLNKGSQCVCNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATA-KPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKS-------LDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENE------SCINSIVEADGIATNDKPAAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQ 2674
            F C     I    +  + H ++H  +++F CV C   F + + LK H K +        P   K     +S    L            K++      EKP + P   +   IK+ +  +    T +K                       C  C   F    ++ KHL +H       G    S  +C    ++K  L    N +   T  KP     + C+ C   F  K+ L+RH+  +H  +      + G     K        +      F C  CG SF +NK+L  H               +   C  C +RFR    L+ H RLH  E       C  S  E   +  + +   GE                                               F CDEC K+F  +S+L  H+K H     KPF+C  C + F+    L+ H++
Sbjct:   35 FTCKQRGEILTTNQSLESHTVIHTGDQNFNCVVCGKSFTQRRYLKNHMKIHTGDHPFTCPECDKCFTVKQSLETHL------------KIHTG----EKPFICPDCGKKFRIKHSLEGHMRIHTGEKPY--------------------TCQECGKRFTEKQTLDKHLTIH------TGEKPYSCPECGKSFRVKFCLE---NHIKIHTGEKP-----YTCQECGKSFTEKQNLERHM-RIHTGEKPFACPECGRSFRVKQDLKSHVRIHTGEKPFSCQQCGKSFSENKTLESH--------MRIHTGEKPFVCSHCGRRFRGKQNLESHMRLHTGEKRYTCPQCGKSYNEQKSLQIHIRTHTGEKP---------------------------------------------FACDECGKSFRQQSTLRGHIKIHTG--EKPFTCPQCGKSFIEKTKLERHKK 391          

HSP 2 Score: 62.003 bits (149), Expect = 3.681e-9
Identity = 98/465 (21.08%), Postives = 155/465 (33.33%), Query Frame = 2
Query: 1346 FVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQKENCSPNFIKSLNNTESNGKPLL-PIAPAQKADKWKLNPNPS--DIEKPLLTPIKSETVVIKNVISQNDTDATFQK-------NMKFAEKFLNNPAITLNKGSQ-CVCNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKS-------LDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENE------SCINSIVEADGIATNDKPAAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYH 2668
            F C  C   F  R   K H+ +H  +  F C  CD  F   + L+ H K               +  KP + P    +   K  L  +      EKP       +    K  + ++ T  T +K          F  KF     I ++ G +   C  C   F    ++ +H+ +H       G    +  +C    ++K  L   V  + T   KP      +C+ C   F+  K L+ H+  +H  +   V    G     K        L     ++ C  CG S+++ KSL +H          +    +   CD C K FR   TL  H ++H  E       C  S +E   +  + K  +GE                                               F+C  C K+FT + SL  H++ H     K ++C  C + F     L+ H
Sbjct:   63 FNCVVCGKSFTQRRYLKNHMKIHTGDHPFTCPECDKCFTVKQSLETHLK-------------IHTGEKPFICPDCGKKFRIKHSLEGHMRIHTGEKPYTCQECGKRFTEKQTLDKHLTIHTGEKPYSCPECGKSFRVKFCLENHIKIHTGEKPYTCQECGKSFTEKQNLERHMRIH------TGEKPFACPECGRSFRVKQDLKSHVR-IHTG-EKPF-----SCQQCGKSFSENKTLESHM-RIHTGEKPFVCSHCGRRFRGKQNLESHMRLHTGEKRYTCPQCGKSYNEQKSLQIH--------IRTHTGEKPFACDECGKSFRQQSTLRGHIKIHTGEKPFTCPQCGKSFIEKTKLERHKKIHSGEKP---------------------------------------------FDCHHCKKSFTMKQSLDIHMRIHTG--EKLYTCQQCGKSFTVKHKLERH 445          
BLAST of SMED30002896 vs. Ensembl Zebrafish
Match: BX000702.2 (pep chromosome:GRCz11:CHR_ALT_CTG3_1_29:62283301:62304265:1 gene:ENSDARG00000113351.1 transcript:ENSDART00000172286.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX000702.2)

HSP 1 Score: 65.0846 bits (157), Expect = 4.618e-10
Identity = 101/489 (20.65%), Postives = 183/489 (37.42%), Query Frame = 2
Query: 1337 KRAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQKEN----------CSPNFIKS--LN---NTESNGKPLLPIAPAQKADKWKLNPNPSDIEKPLLTPIKSETVVIKNVISQNDTDATFQK-------NMKFAEKFLNNPAITLNKGSQ-CVCNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATA-KPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKS-LDDNTLK------FVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENE------SCINSIVEADGIATNDKPAAGE--------STTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYH 2668
            ++ + C  C   F     + +H+++H   + F C  C   FI+L  L QH K +          C  +F +S  LN      +  KP      +Q ++  KL+      EKP       ++ ++ + ++Q+    T +K        M F++ +  +    ++ G +  +C  C   F  ++ + +H+ +H       G    + ++CE   +    L   +  +   T  KP      +C  C   F     L +H+  +H  +        G   ++ S L+ + +       F C+ CG SF    +L  H+              +   C  C +RF     L++H R+H  E       C  S  +   ++ ++K   GE          TF        +L++               I T KK          F C +C K+F+  S L  H++ H     KPF+C+ C + F  +  L  H
Sbjct:  119 EKPYTCTQCGKSFCQSSSYNQHVMIHTGEKQFTCTQCGKSFIQLSNLNQHMKTHTGEKPFTCTQCGRSFSQSSHLNKHMKIHTGEKPFTCTHFSQSSN-LKLHMKIHTGEKPFTCTQCGKSYILLSQLNQHMNIHTGEKPFTCTQCGMSFSQMYALSRHKKVHTGEKPFLCTQCGRSFIMSSHLNQHMRIH------NGEKPYTCTQCEKSFRKSSHL---IQHMRIHTGEKPF-----SCTQCGKSFTCLTHLNQHM-RIHTGEKPYTCTQCGKSFNQSSNLNIHMITHTGEKPFTCTQCGKSFSQISALNKHKK--------IHTGEKPFTCTQCERRFSQSSHLNQHMRIHTGEKPFTCTQCTKSFSQIYALSRHEKIHTGEKPFTCTHCGKTFVSNNHHTLLLTRHMM------------IHTGKKP---------FTCTQCRKSFSKSSLLYTHMRIHTG--EKPFTCTQCGKSFSKSSNLNRH 560          
BLAST of SMED30002896 vs. Ensembl Xenopus
Match: ENSXETT00000036778.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:757546:796076:-1 gene:ENSXETG00000015770.1 transcript:ENSXETT00000036778.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.4698 bits (158), Expect = 7.189e-10
Identity = 106/475 (22.32%), Postives = 172/475 (36.21%), Query Frame = 2
Query: 1337 KRAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQKENCSPNFIKSLNNTESNGKPLLPIAPAQKADKWKLNPNP---SDIEKPLLTPIKSETVVIKNVISQNDTDATFQKNMKFAEKFLNNPAITLNKGSQ-CVCNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQ-------GIDVKYDSGVDLSKKSLDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENE------SCINSIVEADGIATNDKPAAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSIP--TYKKAKVPPNADGL------------FECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYH 2668
            ++ F C  C + F +REG K H  +H   + F C  C   F     LK H++ +      K     E  GK  +         +      P   S   K    P  S+  V +   +     +  +    F + +     + ++ G +   C+ C+ CF   +++ +HL LH R          S S+C      +  LN     L +   +       +C  C   F+    L  HL S   ++       G   KY S + + +++       F C +CG  F +  SL  H+              +   C  C K FRN + L  H R+H  E       C      +  +  + +   GE    P   TE     + +     + ++ T   P    +  K   N+ GL            F C EC K F   +SL  H + H   K KPFSC+ C + F ++  L++H
Sbjct:  792 EKPFSCTECGNCFRDREGLKSHTRIHTGEKPFSCSECGKCFSDRTSLKSHKRIH---TGEKPFACNEC-GKCFMYRYQLTAHSQTHTGEKPYSCSHCGKRFNCP--SKLTVHQRSHTGERPYSCSECGKGFKDSWNLRAHLRIHTGEKPFTCSQCEKCFTHRSALKRHLALHKREKT------FSCSRCGKCFTHRSDLN---RHLKSHKGEKTF----SCSQCGKCFSCTSALNVHLRSHSGERPYSCSECGKCFKYYSNLTVHQRT-HTGEKPFSCPECGKCFTNGASLTYHKK--------CHTGEKPFTCTECGKCFRNSMGLKFHTRIHTGEKPFTCTECGKCFRNSTDLKFHTRIHTGEK---PFTCTECGKCFRNSTDLKFHTRSHTGEKPFTCTECGKCFRNSSGLKFHTRIHTGEKPFTCIECGKCFRDCTSLKIHTRIHTGEKVKPFSCTECGKCFCNSTGLKFH 1235          

HSP 2 Score: 53.1434 bits (126), Expect = 4.435e-6
Identity = 78/291 (26.80%), Postives = 103/291 (35.40%), Query Frame = 2
Query: 1829 LVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLK-------FVCSDCGMSFHD----NKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENESCINSIVEADGIATNDKPAAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYH 2668
            L +H RI    G    S S+C    K +  LN  +   S    KP       C  C   F  +  L RHL ++H  +        G   + +S  +  LK       F CS CG  F      N+ L  HR+             R   C  C K F +   L  H R+H  ES  +      G        A +     RI T E   S           A  YS       K P      F C EC K F+  +SL+ H K H     KPFSC+ C + +     L++H
Sbjct:  307 LTIHERI--HTGERPYSCSECGKGFKERTTLNAHLR--SHTGEKPF-----TCSQCEKCFTHRSDLNRHL-ALHKGEKPFSCSQCGKCFTHRSDLNRHLKSHKGEKPFSCSQCGKCFTHRSDLNRHLKSHRE-------------RPFSCSQCLKNFTSSSQLTAHLRVHSGESPYSCTECGKGFKHPSYLVAHQ-----RIHTGEKPFSCSECGKCYRDHAGLYSHKKSHAGKKP------FSCTECGKCFSKAASLTYHKKIHTG--EKPFSCTECGKCYRDHAALKFH 561          
BLAST of SMED30002896 vs. Ensembl Xenopus
Match: stk31 (serine/threonine kinase 31 [Source:Xenbase;Acc:XB-GENE-983236])

HSP 1 Score: 62.7734 bits (151), Expect = 3.677e-9
Identity = 101/449 (22.49%), Postives = 157/449 (34.97%), Query Frame = 2
Query: 1340 RAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQKENCSPNFIKSLNNTESNGKPLLPIAPAQKADKWKLNPNPSDIEKPLLTPIKSETVVIKNVISQNDTDATFQKNMKFAEKFLNNPAITLNKGSQCV-CNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATA-KPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLK-------FVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENE------SCINSIVEADGIATNDKPAAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGF 2641
            + F C  C   F  R     H+ +H + ++F C  C  KF R   L  H K +         N     GK    I    + D +   PN      PL      ET  +     +N T A  ++   F    L +    ++ G + + C  C   F   + ++ H+ +H         T      C    K     N  V+ ++  T  KP       C  C   FA K  L  H+  +H  +      + G   ++KS   + +K       F C++CG  F  N SL+ H               +   C  C + F +      H ++H  E       C N   + + + ++ K   GE    P   TE         +  ++ K  T   P              F C EC K F  + SL +H+K H     KPF+C+ C + F
Sbjct:  274 KPFTCSECGKGFAKRSSLVSHMKLHTEGKNFSCAECGKKFARKDCLVNHLKIH-----TGEKNICTECGK---GICSKSQLD-FGTEPN------PLTGTECGETSSLTKDWERNITCAQCKETQSFRSSRLTH--FVIHTGEKTITCTECGKGFAQKSKLVSHMKIH---------TGEKPFTCTECGKGFAHKNYLVSHMNIHTGEKPF-----TCTECGKGFAHKNYLVSHM-KIHTGEKPFTCTECGKGFAQKSQLVSHMKIHTGEKPFTCTECGKGFAHNHSLVSHMK--------IHTGEKPFTCTECGRHFAHKCHFLCHLKIHTGEKPFTCTECGNGFAQKNNLVSHMKIHTGEK---PFTCTECGNGFAQKNNLVSHMKIHTGEKP--------------FTCTECGKGFAHKHSLVSHMKIHTG--EKPFTCTECGRHF 663          
BLAST of SMED30002896 vs. Ensembl Xenopus
Match: ENSXETT00000031742.1 (zinc finger protein Xfin-like [Source:NCBI gene;Acc:101731232])

HSP 1 Score: 63.1586 bits (152), Expect = 3.692e-9
Identity = 107/501 (21.36%), Postives = 186/501 (37.13%), Query Frame = 2
Query: 1274 SITNQNELNINGSSNRYG-RFRKRAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIR----LKMLKQHQKE------NCSPNFIKSLNNTESNGKPLLPIAPAQKADKWKLNPNPSDIEKPLLT-----PIKSETVVIKNVISQNDTDATFQKNMKFAEKFLNNP--AITLNKGSQCV-------------CNLCQSCFYSNNSILKHLVLH--HRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENESCI-NSIVEADGIATNDKPAAGESTTFPR-IKTEEYILXXXXXXXXXXXXXXTYSI-PTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYH 2668
            + T  +E+ I   +   G R R  ++ C  C  +F  R    +H   H+  + + C  CD  F +    +K L+ H  E       C+  FI++ ++   + +      P   A+  K     S + K + T     P K E    +    QN +D    + +   EK  + P       +GS  +             CN+C   F  + ++LKHL  H      +  G     +SK +       +  +T  + +  + +     +  C  C   FA +  L +H+  +H  +                       + C+ C  SF     L+ H          +    R  KC +C + F     L  H+R+H N+S + +S  E   +        GES   P+ +  + +++ +          +   S  P   KAK+ P     + C EC K+FT RS    H +SH     +P++C  C +GF  +  L  H
Sbjct:  755 AATAFHEILIKQETGSEGLRSRLVSYPCPECDKVFCQRPALVKHQRTHKAEKRYPCNECDKSFFQTSDLVKHLRTHTGERPYHCSECNKGFIQN-SDLVKHQRTHTGERPYTCAECNKGFVQRSALTKHMRTHTGEKPYKCEQC--QKCFIQN-SDLVKHQRIHTGEKPYHCPDCGKRFTEGSSLIKHQRIHSRIKPYPCNVCGKSFSQSCNLLKHLKCHSEQNPPVVLGSGPGLVSKTQPDPPDNMVYGDTAENTNYVSPEAARERLFKCNDCGKCFAHRSVLIKHI-RIHTGE---------------------RPYKCTQCARSFIQKSDLVKH--------YRTHTGERPYKCGLCERSFVEKSALSRHQRVHNNKSPVPDSAAEQHQVT-----YWGESEDDPKSLVPQLHVVKEEDPRVMYGPLSLLQSCCPPAIKAKLTPP----YMCSECGKSFTHRSVFLKHWRSHTG--EQPYTCKECGKGFSQSSALVKH 1210          

HSP 2 Score: 58.151 bits (139), Expect = 1.112e-7
Identity = 89/475 (18.74%), Postives = 168/475 (35.37%), Query Frame = 2
Query: 1337 KRAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQKENCS--PNFIKSLNNTESNGKPLLPIAPAQKADK-------WKLNPNPSDIEKPLL-----TPIKSETVVIKNVISQNDTDATFQKNM------KFAEKFLNNPAITLNKGSQCV-----CNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVK-----YDSGVDLSK-KSLDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENESCINSIVEADGIATNDKPAAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYH 2668
            +R   C  C+  F+ +    +H+  H   + + C  C   FI+   L +HQ+ +    P      N   + G  L+        +K        K     SD+ K  +     TP  + T   + +I Q       +  +      +  + F   PA+  ++ +        CN C   F+  + ++KHL  H         T      C    K     ++ V    T T +      + C  C+  F  +  L +H+ +   ++    +     +    DL K + +      + C DCG  F +  SLI H+              +   C++C K F     L +H + H  ++    +    G+ +  +P   ++  +                  +  + + Y  P   + +       LF+C++C K F  RS L  H++ H     +P+ C+ C + F+    L  H
Sbjct:  639 ERPHKCSVCEKGFIQKSALTKHMRSHTGEKPYACAQCGKSFIQNSDLVKHQRIHTGEKPYHCTECNKCFTEGSSLVKHRRTHSGEKPYPCTQCEKTFTQSSDLVKHTMVHNGDTP-PAATAFHEILIKQETGSEGLRSRLVSYPCPECDKVFCQRPALVKHQRTHKAEKRYPCNECDKSFFQTSDLVKHLRTH---------TGERPYHCSECNKGFIQNSDLVKHQRTHTGE----RPYTCAECNKGFVQRSALTKHMRTHTGEKPYKCEQCQKCFIQNSDLVKHQRIHTGEKPYHCPDCGKRFTEGSSLIKHQ--------RIHSRIKPYPCNVCGKSFSQSCNLLKHLKCHSEQNPPVVLGSGPGLVSKTQPDPPDNMVY-----------------GDTAENTNYVSPEAARER-------LFKCNDCGKCFAHRSVLIKHIRIHTG--ERPYKCTQCARSFIQKSDLVKH 1065          
BLAST of SMED30002896 vs. Ensembl Xenopus
Match: ENSXETT00000051712.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV460416.1:219260:245970:1 gene:ENSXETG00000021309.1 transcript:ENSXETT00000051712.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 6.756e-9
Identity = 111/497 (22.33%), Postives = 181/497 (36.42%), Query Frame = 2
Query: 1340 RAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQ------KENCSPNFIKS------LNNTESNG-------KPLLPIAPAQKA---DKWKLNPNPSDIEKPLLTPIKSETVVIKNVI-------SQNDTDATFQKNMKFAEKFLNNPAITLNKGSQ-CVCNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDN-----TLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHEN------ESC-----INSIVEADGIA-TNDKP----AAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPN-ADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQ 2674
            R+FVC  C   F +++    H L+H   + F C  C+  F+  + L++HQ      K + S +  +       ++ TE N        KPLL     Q      K K +   S  +KPLL     +    K  +       ++       +    F  K   N  + ++ G Q  VC  C  CF     + +    HHR  I  G      ++C      K  L+  +   + A+      F+  C  C   +  K+ L  HL +VH  +             K++L+D+        + C++CG SF   +SL  H               +  +C  C K FR    LD H R+H          C     +  ++E   +  T +KP      G+S    R  T               +   ++ +       +  +  +  F+C EC K+F  +  L+ H+++H     KPF CS C   F     L  H Q
Sbjct:  149 RSFVCSKCGKCFSHQKMLIAHKLVHTGRKPFTCTECNKGFLWNRDLQEHQEIHKEEKPSVSQHVTQMERESTLVDTTELNAHLQTHREKPLLCNETGQSCGNKSKLKADRGISTGQKPLLCTECGKAFTSKRALKVHLRVHAEPRPFVCTECGKSFKAKCKLNVHLRIHTGEQRYVCTECGKCFRDRFGLNE----HHR--IHTGEKPFICTECGKSFCRKTHLDAHIQTHTRASL-----FV--CPECGRSYKDKRNLNDHL-NVHTGKTYPCTECGRSYKQKRNLNDHLNVHTGKTYPCTECGKSFPLKRSLQRH--------LMIHTGEKPFECTECGKSFRYKSKLDIHYRIHTGVEPFVCSECGKRFRLKHLLEYHQMGHTGEKPFVCTECGKSFRVQRQLTLHLQTHTGEKPFVCTECGKSFRVQGKLTVHLQTHTGEKPFDCSECGKSFRVKRQLTLHLQTHTG--EKPFDCSECGMSFRVKRQLTIHLQ 621          
BLAST of SMED30002896 vs. Ensembl Xenopus
Match: astn1 (astrotactin 1 [Source:Xenbase;Acc:XB-GENE-979962])

HSP 1 Score: 59.6918 bits (143), Expect = 2.393e-8
Identity = 96/479 (20.04%), Postives = 157/479 (32.78%), Query Frame = 2
Query: 1337 KRAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQK----------ENCSPNFI--KSLNNTESNGKPLLPIAPAQKADKWK------LNPNPSDIEKPLLTPIKSETVVIKNVISQNDTDATFQ--------KNMKFAEKFLNNPAITLNKGSQCVCNLCQSCFYSNNSILKHLVLHHRIAIQE-GYTALSISKCESVAKLKPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENE------SCINSIVEADGIATNDKPAAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQ 2674
            ++ F C  C   F  +    +H + HR  + FKC  C   +     L  H++            C   F    SL+  E + +   P A  +    +       ++    + EKP       ET   K  + +++ +  ++        KN    EK   + AI ++      C +C+  F        HL +H RI   E  YT     KC  + K    ++E ++       +P     + C  C   F  K  LQ+H    H  +                       F C++CG SF   +SL++H               +   C  C K F    TL+ H+++H  E       C     +  G+  +++   GE                                               F C EC K F+ + SL  H++ H     KPF+C  C + F     L  H +
Sbjct:  109 EKPFTCTECGKKFTLKSSLHKHEMSHRGEKPFKCTECGKSYTEKHALHVHERIHTGEKPFTCTECGKKFTLKSSLHKHEMSHRGEKPFACTECGKGYTEKRGLLVHERIHNGEKPFTCTKCGETFSEKRKLKRHEINHKYKPYACSECGKNYSDMEKLCRHQAIHIDD-KVFKCKVCEKGFSRKG----HLKIHERIHTGERPYTCAECGKC-FIRKSHLKIHERIH----TGERP-----YTCTECGKCFNKKNILQKH-QRTHTGE---------------------KPFTCAECGKSFAVKRSLLVHE--------RIHTGEKPCICTECGKSFSEKSTLNRHQKIHTGEKPYACTECEKCFTDKGGLRIHERTHTGEKP---------------------------------------------FTCTECGKGFSDKGSLRTHLRIHTGV--KPFTCKECGKKFTVKRALLKHER 495          
BLAST of SMED30002896 vs. Ensembl Mouse
Match: Zfp658 (zinc finger protein 658 [Source:MGI Symbol;Acc:MGI:2652821])

HSP 1 Score: 66.6254 bits (161), Expect = 2.285e-10
Identity = 99/453 (21.85%), Postives = 157/453 (34.66%), Query Frame = 2
Query: 1346 FVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQKENCSP------NFIKSLNNTESNGKPLLPIAPAQKADKWKLNPNPSDIEKPLLTPIKSETVVIKNVISQNDTDATFQKNMKFAEKFLNNPAITLNKGSQCVCNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENES------CINSIVEADGIATNDKPAAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYH 2668
            FVC  C   FL +  F  H   H   + ++C +C   F R   L+ H + +         +  KS NNT                 + K++      E+P + P+  +    K+++S ++T  T +K  K                    C +C   F    S    L +H++I ++E         C    K K       + L+      I    H C  C   F  K  L  H                     +  L  N+ +  CSDCG SF     L +HR              +  KC  C K F    TL+ HRR+H+ E       C  ++     +  +++   GE    P + TE                   +    + + ++    D  F C +C K F  RS L++H ++H     KP++C  C + F  T  L  H
Sbjct:  301 FVCHKCGEAFLQKTEFASHQETH-PEKPYECPDCGKSFSRTSNLQVHHRIHTGEKPYECRDCGKSFNNT----------------SQLKVHYRIHTGERPYVCPVCGKAFKQKSILSTHETIHTGEKPYK--------------------CTVCGKLF----SCTSRLKVHYQIHMKE--KPYECGDCGKAFKRK-------SSLTVHQKIHIRQTHHECSECGKTFNQKSELSTH--------------------QRLHLGKNSHR--CSDCGKSFTYASQLKMHR--------RVHTGEKPYKCRDCGKSFTYSFTLNVHRRIHKVEKPHKCSICGKALASKYQLEEHERIHTGEK---PYVCTE--------------CGKGFHGRSGFLRHQITHTRDKPFVCHKCGKAFFQRSQLTSHQQTHTG--EKPYTCHYCGKSFSHTSQLTVH 654          
BLAST of SMED30002896 vs. Ensembl Mouse
Match: Zfp658 (zinc finger protein 658 [Source:MGI Symbol;Acc:MGI:2652821])

HSP 1 Score: 66.6254 bits (161), Expect = 2.285e-10
Identity = 99/453 (21.85%), Postives = 157/453 (34.66%), Query Frame = 2
Query: 1346 FVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQKENCSP------NFIKSLNNTESNGKPLLPIAPAQKADKWKLNPNPSDIEKPLLTPIKSETVVIKNVISQNDTDATFQKNMKFAEKFLNNPAITLNKGSQCVCNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENES------CINSIVEADGIATNDKPAAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYH 2668
            FVC  C   FL +  F  H   H   + ++C +C   F R   L+ H + +         +  KS NNT                 + K++      E+P + P+  +    K+++S ++T  T +K  K                    C +C   F    S    L +H++I ++E         C    K K       + L+      I    H C  C   F  K  L  H                     +  L  N+ +  CSDCG SF     L +HR              +  KC  C K F    TL+ HRR+H+ E       C  ++     +  +++   GE    P + TE                   +    + + ++    D  F C +C K F  RS L++H ++H     KP++C  C + F  T  L  H
Sbjct:  301 FVCHKCGEAFLQKTEFASHQETH-PEKPYECPDCGKSFSRTSNLQVHHRIHTGEKPYECRDCGKSFNNT----------------SQLKVHYRIHTGERPYVCPVCGKAFKQKSILSTHETIHTGEKPYK--------------------CTVCGKLF----SCTSRLKVHYQIHMKE--KPYECGDCGKAFKRK-------SSLTVHQKIHIRQTHHECSECGKTFNQKSELSTH--------------------QRLHLGKNSHR--CSDCGKSFTYASQLKMHR--------RVHTGEKPYKCRDCGKSFTYSFTLNVHRRIHKVEKPHKCSICGKALASKYQLEEHERIHTGEK---PYVCTE--------------CGKGFHGRSGFLRHQITHTRDKPFVCHKCGKAFFQRSQLTSHQQTHTG--EKPYTCHYCGKSFSHTSQLTVH 654          
BLAST of SMED30002896 vs. Ensembl Mouse
Match: Zfp748 (zinc finger protein 748 [Source:MGI Symbol;Acc:MGI:1916455])

HSP 1 Score: 63.5438 bits (153), Expect = 1.785e-9
Identity = 100/481 (20.79%), Postives = 164/481 (34.10%), Query Frame = 2
Query: 1334 RKRAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQK----------ENCS-----PNFIKSLNNTESNGKPLLPIAPAQKADKWKLNPNPSDI---EKPLLTPIKSETVVIKNVISQNDTDATFQKNMKFAE---KF-----LNNPAITLNKGSQCVCNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENES------CINSIVEADGIA------TNDKP----AAGESTTFP-RIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMS 2647
            +++ + C  C  +F       +HL +H   + +KC  C   F  L  L QH+           E C      P+ +K      S  KP       +             I   EKP       +     + +S +    T  K  K  E   KF     L       ++ +   C +C   FY+++   +H +         G+T     KCE   K     +     L+  + K      + CE C   F ++ G  RH                      + +        C +CG  F  +  L  H+              +  KC+ C K+F  P  L EH+R+H  E+      C N      G++      T +KP      G+   +P R+K  + I S+           + Y+     + K+    +  ++C+EC KTF   S L  H+  H     KP+ C  C + F +
Sbjct:  356 QEKPYKCEVCGKVFRTCWQLSKHLRIHSGEKPYKCEECGKAFYTLSYLTQHKLGHTGEKPYKCEECGKTFYYPSVLKEHLAIHSGEKPYRCDECGKDFCTRSGRSRHQRIHTGEKPYKCEQCGKAFSTHSYLSHHKIVHTGHKPYKCEECGKKFYYPSRLKEHQRIHSQENPYKCEICGKAFYTHSYFTQHKL---------GHTGEKPYKCEECGKTFYYPSILKEHLAIHSGKKP----YRCEECGKDFCTRSGRSRH----------------------QRIHTGEKPHKCEECGKVFSTHSYLTQHK--------VVHSGEKPYKCEECGKKFYYPSRLKEHQRIHSQENPYKCEICGNVFCTPKGLSKHQRFHTGEKPYKCEECGKMFYYPSRLKEHQRIHSQENPYKCEICGKAFYTHSYLTQHKLGHTGEKPYKCEECGKTFYYPSILKEHLAIHSG--KKPYRCEECGKDFCT 791          

HSP 2 Score: 52.7582 bits (125), Expect = 3.582e-6
Identity = 74/325 (22.77%), Postives = 115/325 (35.38%), Query Frame = 2
Query: 1733 LNNPAITLNKGSQCVCNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAK-LKPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKS-------LDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENESCINSIVEADGIATND---KPAAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADGL-FECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHR 2671
            L    IT ++     C +C   F +   + KHL +H         +     KCE   K    L   T + L     KP     + CE C   F     L+ HL ++H  +      + G D   +S       +      + C  CG +F  +  L  H+              +  KC+ C K+F  P  L EH+R+H  E+     +      T+    +   G +   P  K EE                 T+  P+  K  +  ++    + C+EC K F  RS  S H + H     KP  C  C + F +   L  H+
Sbjct:  347 LKQHQITHSQEKPYKCEVCGKVFRTCWQLSKHLRIH---------SGEKPYKCEECGKAFYTLSYLTQHKLGHTGEKP-----YKCEECGKTFYYPSVLKEHL-AIHSGEKPYRCDECGKDFCTRSGRSRHQRIHTGEKPYKCEQCGKAFSTHSYLSHHK--------IVHTGHKPYKCEECGKKFYYPSRLKEHQRIHSQENPYKCEICGKAFYTHSYFTQHKLGHTGEKP-YKCEE--------------CGKTFYYPSILKEHLAIHSGKKPYRCEECGKDFCTRSGRSRHQRIHTG--EKPHKCEECGKVFSTHSYLTQHK 631          
BLAST of SMED30002896 vs. Ensembl Mouse
Match: Zfp729a (zinc finger protein 729a [Source:MGI Symbol;Acc:MGI:3036250])

HSP 1 Score: 62.7734 bits (151), Expect = 3.676e-9
Identity = 102/471 (21.66%), Postives = 168/471 (35.67%), Query Frame = 2
Query: 1346 FVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQKENCSPNFIKSLNNTESNGKPLLPIAPAQKADKWKLNPNPSDIEKPLLTPIKSETVVIKNVISQNDTDATFQKNMK---------FAEKFLNNPAI-TLNKGSQCVCNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAK-LKPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENESCINSIVEADG------------IATNDKP----AAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPT-YKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQ 2674
            + C  C   F        H  MH   + +KC  C   F  L  L +H++ +   N+     N E  GK    I P++ +   ++       EKP    +  +   + +++S++ T  T +K  K         +  +  N+  I T  K  QC   +C   F   +S+ KH  +H         T     KC+   K  + L + + +       KP     + CE C   F     L +H                      K +      + C  CG +FH    L  H+              +  KC++C K F  PL L +H+R+H  E+  NS V +              + T +KP      G++  FP +      +               +  P+   K K     +  ++C+ C K F   SSLS H   H     KP+ C  C + F  + +L  H++
Sbjct:  343 YKCEVCGKAFDYPSRLSTHAKMHTGEKPYKCEVCQKAFRSLSSLSKHKRIHTEDNYY----NNELCGKAF--IYPSRLSKHKRICAG----EKPYKCEVCGKAFHVSSLLSKHRTIHTGEKLYKCEVCGKAFYYPSRLSNHKKIHTGEKPFQC--EVCGKAFCFPSSLSKHKRIH---------TGEKPYKCKECGKAFRSLSSLSKHKRIHTGEKP-----YKCEECGKAFHYPSLLSKH----------------------KIIHTEEKPYKCDVCGQAFHVPSKLSHHK--------IIHTGEKPYKCEVCGKAFCIPLLLSKHKRVHTGENPYNSQVCSKAFVYPSKLSKHKKVRTKEKPYKCEVCGKAFRFPSLLLIHKGMHTGEKPYKCEDCGKAFHYPSLLSKHKRIHTGEKPYQCEVCGKDFHVSSSLSKHRIIHTG--EKPYKCEICGKTFRFSSSLSKHKR 755          

HSP 2 Score: 60.077 bits (144), Expect = 2.334e-8
Identity = 81/338 (23.96%), Postives = 129/338 (38.17%), Query Frame = 2
Query: 1745 AITLNKGSQC-VCNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKL--KPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQ--------GIDVKYDSGVDLSKKSLDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENE------SC-----INSIVEADGIA-TNDKP----AAGESTTFP-RIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQ 2674
            A ++ +G +C  C  C   F        H +L         Y  ++ +KCE  A+    P L+   N + T   KP     + CE C   F     L +H   VH  +        G   ++ S +   KK +      + C  CG +FH    L++H+              +  KC+IC K F  P  L +H+R+H  E       C     I+S +    I    +KP      G++  +P R+   + I S            +   +    K K+    +  ++C+ C K F   S LS H K H     KP+ C  C + F S  +L  H++
Sbjct:   81 ATSMLRGEKCYTCKECGKVFEWTKVFQNHEML---------YIGMNPNKCEECARSFHSPSLSSEENRIHTGE-KP-----YKCEVCGKAFCIPLLLSKHK-RVHTGENLYKCEVCGKAFQHPSRLSRHKK-IHSEEKPYKCEVCGKAFHFPSLLLVHKR--------VHTGEKPYKCEICDKAFHYPSILSKHKRIHTGEKPYKCEECGKAFHISSFLSKHKIIHRGEKPYKCEVCGKAFHYPSRLSNHKKIHSGEKPFKCEVCGKAFRILSLLSKHKIIHTEENPYKCEVCGKAFDYPSRLSTHAKMHTG--EKPYKCEVCQKAFRSLSSLSKHKR 391          
BLAST of SMED30002896 vs. Ensembl Mouse
Match: Zkscan8 (zinc finger with KRAB and SCAN domains 8 [Source:MGI Symbol;Acc:MGI:1913815])

HSP 1 Score: 60.4622 bits (145), Expect = 1.212e-8
Identity = 58/262 (22.14%), Postives = 88/262 (33.59%), Query Frame = 2
Query: 1931 VNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQ--------GIDVKYDSGVDLSKKSLDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENE------SCINSIVEADGIATNDKPAAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQ 2674
            +  L      P     H C+ C   FA   GL RH   +H  +        G    Y S + LS + + +   ++ C +CG +F  N  LILH+              +  +C+ C K F     L  H+R+H  E       C  +   +  +  + +   GE                                               +ECDEC KTF   S L  H +SH     KP+ C+ C + F     L  H++
Sbjct:  244 LGKLERHQGNPTQERRHKCDECGKSFAQNSGLVRHW-RIHTGEKPYQCTVCGKAFSYRSAL-LSHQDIHNKVKRYHCKECGKAFSQNTGLILHQ--------RIHTGEKPYQCNQCGKAFSQSAGLILHQRIHSGERPYECNECGKAFSHSSHLIGHQRIHTGEKP---------------------------------------------YECDECGKTFRRSSHLIGHQRSHTG--EKPYKCNECGRAFSQKSGLIEHQR 448          
BLAST of SMED30002896 vs. UniProt/SwissProt
Match: sp|Q05481|ZNF91_HUMAN (Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 2.934e-10
Identity = 102/487 (20.94%), Postives = 170/487 (34.91%), Query Frame = 2
Query: 1340 RAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQK----------ENCSPNFIKSLNNTES----NGKPLLPIAPAQKADKWKLNPNPSDI----EKPLLTPIKSETVVIKNVISQNDTDATFQKNMKFAE---KFLNNPAITLNKGSQC-----VCNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATAKPILHFIHN---CEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSK-------KSLDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENE------SCINSIVEADGIATNDKPAAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQ 2674
            + + C  C   F N      H + H + + +KC  CD  F RL  L +H+           E C   F +S N T       G+         KA  W  +          EKP       +  +  + ++++    T +K  K  E    F  +  +T +K          C  C   F  ++++ KH ++H             + KCE   K         N  S  T   I+H        E C   F     L  H   +H  +      + G   S+       K +      + C +CG +F  + +L  H+              +  KC+ C K FR   TL EH+ +H  E       C  +  ++  +  + +   GE       K EE                 +  + T+K   +    +  ++C+EC K F   S+L+ H + H   + KP+ C  C + F  + TL  H++
Sbjct:  656 KPYKCKECGKAFSNSSTLANHKITHTEEKPYKCKECDKTFKRLSTLTKHKIIHAGEKLYKCEECGKAFNRSSNLTIHKFIHTGEKPYKCEECGKAFNWSSSLTKHKRIHTREKPFKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEECGKAFSRSSTLTKHKTIHTGEKPYKCKECGKAFKHSSALAKHKIIH---------AGEKLYKCEECGK-------AFNQSSNLTTHKIIHTKEKPSKSEECDKAFIWSSTLTEHK-RIHTREKTYKCEECGKAFSQPSHLTTHKRMHTGEKPYKCEECGKAFSQSSTLTTHK--------IIHTGEKPYKCEECGKAFRKSSTLTEHKIIHTGEKPYKCEECGKAFSQSSTLTRHTRMHTGEKP----YKCEE----------CGKAFNRSSKLTTHK---IIHTGEKPYKCEECGKAFISSSTLNGHKRIH--TREKPYKCEECGKAFSQSSTLTRHKR 1098          

HSP 2 Score: 56.225 bits (134), Expect = 2.117e-6
Identity = 102/488 (20.90%), Postives = 168/488 (34.43%), Query Frame = 2
Query: 1340 RAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQK----------ENCSPNFIKSLNNTES----NGKPLLPIAPAQKADKWKLNPNPSDI----EKPLLTPIKSETVVIKNVISQNDTDATFQKNMKFAE---KFLNNPAITLNK----GSQCV-CNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATAKPILHF---IHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENE------SCINSIVEADGIA------TNDKPAAGES--TTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQ 2674
            + + C  C   F N      H + H + + +KC  CD  F RL  L +H+           E C   F +S N T       G+         KA  W  +          EKP       +  +  + ++++    T +K  K  E    F  +  +T +K    G +      C   F  + ++ KH ++H R   ++ Y      KC+   K            ST T   I+H    ++ CE C   F     L  H                      K +      + C +CG +F  + +L  H+              +  KC+ C K F +   L +H+R+H  E       C  +   +  +A      T +KP   +    TF R+                          T  K K+    + L++C+EC K F   S+L+ H   H     KP+ C  C + F  + +L  H++
Sbjct:  348 KPYKCKECGKAFSNSSTLANHKITHTEEKPYKCKECDKAFKRLSTLTKHKIIHAGEKLYKCEECGKAFNRSSNLTIHKFIHTGEKPYKCEECGKAFNWSSSLTKHKRFHTREKPFKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEECGKAFRQSSTLTKHKIIHTGEKPYKFEECGKAFRQSLTLNKHKIIHSR---EKPY------KCKECGK-------AFKQFSTLTTHKIIHAGKKLYKCEECGKAFNHSSSLSTH----------------------KIIHTGEKSYKCEECGKAFLWSSTLRRHKR--------IHTGEKPYKCEECGKAFSHSSALAKHKRIHTGEKPYKCKECGKAFSNSSTLANHKITHTEEKPYKCKECDKTFKRL-------------------------STLTKHKIIHAGEKLYKCEECGKAFNRSSNLTIHKFIHTG--EKPYKCEECGKAFNWSSSLTKHKR 762          
BLAST of SMED30002896 vs. UniProt/SwissProt
Match: sp|Q8TF45|ZN418_HUMAN (Zinc finger protein 418 OS=Homo sapiens OX=9606 GN=ZNF418 PE=1 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 4.127e-10
Identity = 83/349 (23.78%), Postives = 124/349 (35.53%), Query Frame = 2
Query: 1778 CNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAK-LKPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLK-------FVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENE------SCINSIVEADGIATNDKPAAGE--------STTFP---------RIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVP-------------------PNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQ 2674
            C  C   F  N +++KH  +H         T     +CE   K      N   +     + +P     + CE C   F+ K  L  H H VH  +      + G   S+K    N  +       + C +CG SF    +LI H+              R  +C  CRK FR    L EH+R+H  E       C  S  ++ G   + +   GE          +FP         R+ T E          + ++ +S         A+ P                      +  +EC EC KTFT RS+   H + H   + KP+ CS C + F  T +L  HR+
Sbjct:  316 CGECGKSFSQNGTLIKHQRVH---------TGERPYECEECGKCFTQKGNLIQHQRGHTSERP-----YECEECGKCFSQKGTLTEH-HRVHTRERPYECGECGKSFSRKGHLRNHQRGHTGERPYECGECGKSFSRKGNLIQHQRS--------HTGERPYECRECRKLFRGKSHLIEHQRVHTGERPYECNECGKSFQDSSGFRVHQRVHTGEKPFECSECGKSFPQSCSLLRHRRVHTGERPYECGECGKSFHQSSSLLRHQKTHTAERPYECRECGKFFSSLLEHRRVHTGERPYECRECGKTFTRRSAHFKHQRLH--TRGKPYECSECGKSFAETFSLTEHRR 639          
BLAST of SMED30002896 vs. UniProt/SwissProt
Match: sp|A6NN14|ZN729_HUMAN (Zinc finger protein 729 OS=Homo sapiens OX=9606 GN=ZNF729 PE=2 SV=4)

HSP 1 Score: 65.0846 bits (157), Expect = 4.540e-9
Identity = 100/495 (20.20%), Postives = 173/495 (34.95%), Query Frame = 2
Query: 1337 KRAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQK----------ENCSPNFI--------------KSLNNTESNGKPLLPIAPAQKADKWKLNPNPSDIEKPLLTPIKSETVVIKNVISQNDTDATFQKNMKFAEKF--LNNPAITLNKGSQCVCNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAK-LKPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRH--LHS----VHVDQGIDVKYDSGVDLSKKSLDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHR------RLHENESCI------NSIVEADGIATNDKP----AAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYS-IPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHR 2671
            K+ + C  C   F +    +RH ++H   + +KC  C   F     L  H+           E C  +F               + L   E   K     +   K         P   E+       S  + +  VI   +     ++  K  + F  L    +         C  C   F  ++S+ KH ++H         +     KCE   K  K L   TV+ +     KP       CE C   F     L++H  +H+       ++      DS   +  K +      + C++CG +F  +  L  H+        +     +  KC+ C K F N  TL +H+      +L++ E C+      +++++   I T +KP      G++  +    TE  ++          +    +      +K KV       ++CDEC K F   S+L+ H   H     KP+ C  C + F  +  L  H+
Sbjct:  681 KKPYKCEECGKAFSHFSALRRHKIIHTGEKPYKCEECGKAFKWSSKLTVHKVIHTAEKPCKCEECGKSFKHFSALRKHKVIHTREKLYKCEECVKAFNSFSALMKHKVIHTGEKPYKCEECGKAFKWSSKLTVHKVIHTGEKPCKCEECGKAFKHFSALRKHKVIHTGKKPYKCEECGKAFSQSSSLRKHEIIH---------SGEKPYKCEECGKAFKWLSKLTVHKVIHTAEKPC-----KCEECGKAFKHFSALRKHKIIHTGKKPYKCEECGKAFNDSSTLMKHKIIHTGKKPYKCAECGKAFKQSSHLTRHK--------AIHTGEKPYKCEECGKDFNNSSTLKKHKLIHTREKLYKCEECVKAFNNFSALMKHKIIHTGEKPYKCEECGKAFKWSSKLTEHKVIHTGEKPCKCEECDKAFKHFSALRKHKVIHTGKKPYQCDECGKAFNNSSTLTKHKIIHTG--EKPYKCEECGKAFSQSSILTKHK 1151          
BLAST of SMED30002896 vs. UniProt/SwissProt
Match: sp|O43345|ZN208_HUMAN (Zinc finger protein 208 OS=Homo sapiens OX=9606 GN=ZNF208 PE=2 SV=2)

HSP 1 Score: 62.7734 bits (151), Expect = 2.316e-8
Identity = 99/476 (20.80%), Postives = 169/476 (35.50%), Query Frame = 2
Query: 1340 RAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQKENCSPNFIKSLNNTESNGKPLLPIAPAQKADKWKLNPNPSDIEKPLLTPIKSETVVIKNVISQNDTDATFQKNMKFAEKFLNNPAITLNKGSQC-----VCNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATA-KPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQ--------GIDVKYDSGVDLSKKSLDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENE------------SCINSIVEADGIATNDKP----AAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSI-PTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQ 2674
            + + C  C   F       +H ++H   + +KC  C   +     L  H+K     + ++     E  GK     A   K  +      P   E+   T  K  T+     I   +      K  +  + F+    +T +K          C  C   F   + + KH V+H         T     KCE   K     +  +      T  KP     + CE C   F++   L +H   +H  +        G   K+ S +   KK +      + C +CG +F+ +  LI H+              +  KC+ C K F    TL  H+ +H  E            S  + + +   I T +KP      G++  +P   +    +          +    +S+     K +V    +  ++C+EC K F+  S  S H K+H     K + C AC + + S+ TL YH++
Sbjct:  523 KPYKCEECGKSFSTFSILTKHKVIHTGEKPYKCEECGKAYKWSSTLSYHKK----IHTVEKPYKCEECGKAFNQSAILIKHKRIHTGEKPYKCEECGKTFSKVSTLTTHKAIHAGEKP---YKCKECGKTFIKVSTLTTHKAIHAGEKPYKCKECGKAFSKFSILTKHKVIH---------TGEKPYKCEECGKAFNWSSNLMEHKRIHTGEKP-----YKCEECGKSFSTFSVLTKHK-VIHTGEKPYKCEECGKAYKWSSTLSYHKK-IHTVEKPYKCEECGKAFNRSAILIKHKR--------IHTDEKPYKCEECGKTFSKVSTLTTHKAIHAGEKPYKCKECGKAFSKFSILTKHKVIHTGEKPYKCEECGKAYKWPSTLSYHKKIHTGEKPYKCEECGKGFSMFSILTKHEVIHTGEKPYKCEECGKAFSWLSVFSKHKKTHAG--EKFYKCEACGKAYKSSSTLSYHKK 965          
BLAST of SMED30002896 vs. UniProt/SwissProt
Match: sp|Q8NB50|ZFP62_HUMAN (Zinc finger protein 62 homolog OS=Homo sapiens OX=9606 GN=ZFP62 PE=1 SV=3)

HSP 1 Score: 62.3882 bits (150), Expect = 2.766e-8
Identity = 106/488 (21.72%), Postives = 169/488 (34.63%), Query Frame = 2
Query: 1337 KRAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQ-----KENC-------SPNFIKSLNNTESNGKPLLPIAPAQKADKWKLNPNPSDIEKPLLTPIKSETVVIKNVISQNDTDATFQKNMKFAEKFLNNPAITLNKGSQCVCNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRH--LHSVHVDQGIDV-----KYDSGVDLSKKSLDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENESCI------------NSIVEADGIATNDKP-----------AAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQ 2674
            ++ + C  C   F +    + H  +H   + +KC  C   ++    L  H+     ++NC       S N+   L+  +       P    +    ++ N +   + K + T  K     I      N +     K +   EK                C+ C   F +  ++L H  +H       G       +CE       LL +  + +     KP     + C+ C   F +  GL  H  +H+       DV      Y SG+ + K S+        C +CG SF  N  L+ HR        +     R   CD+C K FRN   L  HRRLH  E               +S+    GI   +KP            +       RI T E          A    +    +  +K+       +  ++C+EC K +   SSL NH   H     KPF C  C + F++  TL  H++
Sbjct:  166 EKRYECDDCGGTFRSSSSLRVHKRIHTGEKPYKCEECGKAYMSYSSLINHKSTHSGEKNCKCDECGKSFNYSSVLDQHKRIHTGEKPYECGECGKAFR-NSSGLRVHKRIHTGEKPYECDICGKTFSNSSGLRVHKRIHTGEKPYE-------------CDECGKAFITCRTLLNHKSIHF------GDKPYKCDECEKSFNYSSLLIQ--HKVIHTGEKP-----YECDECGKAFRNSSGLIVHKRIHTGEKPYKCDVCGKAFSYSSGLAVHK-SIHPGKKAHECKECGKSFSYNSLLLQHR--------TIHTGERPYVCDVCGKTFRNNAGLKVHRRLHTGEKPYKCDVCGKAYISRSSLKNHKGIHLGEKPYKCSYCEKSFNYSSALEQHKRIHTREKPFGCDECGKAFRNNS---GLKVHKRIHT---GERPYKCEECGKAYISLSSLINHKSVHPG--EKPFKCDECEKAFITYRTLTNHKK 609          
BLAST of SMED30002896 vs. TrEMBL
Match: A0A3N0XSA9 (Zinc finger protein 208 OS=Anabarilius grahami OX=495550 GN=DPX16_1045 PE=4 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.993e-10
Identity = 146/674 (21.66%), Postives = 248/674 (36.80%), Query Frame = 2
Query:  815 KRSSNPNGVEGIIVSPNGSDNWGCDICGRQF---PTLKQAK-VHKFKSHIEPVQ-KKKLMLHRNIIRKSNSSQRNLVKKYIAENKFRE--ILPNS---KKSKIDKSRIEQGQSVNNEEESGCQGDQNNPDSYSASDTGRPATNLWRAAQSNSRGNKIVLSRVYSITNQNELNINGSSNRYGRFRKRAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQK----------ENCSPNF-IKSLNNTESNGKPLLPIAPAQKADKWKLNPNPSDIEKPLLTPIKSETVVIKNVISQNDTDATFQKNMKFAEKFLNNPAITLNKGSQCVCNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLK-------FVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENE------SCINSIVEADGIATNDKPAAGES-TTFPRIKTEEYILXXXXXXX---------------------XXXXXXXTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYH 2668
            KR ++   ++  +    G   + CD CG+ F    TL   K +H  +     VQ  K+     N+    NS     +       KF +  ++ NS   K+ ++D   +++G     E E          D Y   D     T++ ++ Q+ +  ++++ +      NQ + N+N     +    ++ F C +C   F  +   K+H ++H   + F C  C + F     LKQH K          + C  +F  K   N  +  K   P+A  +   + K      + ++  L  ++     I+   + N T +   K+ K  ++ LNN      + +   C  C   F  N ++ +H+V+H R          +  +C    KLK  L+  +  +     KP       C+ C   F  K  L++H+  +H  +        G     KS  D+ +        F C  CGMSF    +   H+              +   CD C K FR   T D H+R+H  E       C  S  +   +  +     GE   +F R  T  +   +  +                         + +  T S+   +K K   N    F C  C K+F  + +L  H+K H    NKPFSC  C   F+    L  H
Sbjct:  122 KRFTDKGNLKQHMKIHTGEKPFTCDQCGKSFRLKSTLDSHKRIHTEEKSFGCVQCGKRFTDKGNLKHHMNSHPGEKLFTCDQFGKFLQCKVILNSQFPKRKRLDLMALKEGNQELKETE--------KKDQYKRFD----FTDVEKSIQTETTSSQVLKTEFGKGFNQKQ-NLNNHVKIHTG--EKPFKCQHCGKSFTEKGNLKQHKMIHTGEKPFTCQQCGMSFTEKGNLKQHMKIHTGEKPFTCDQCGKSFRRKETLNYHTKKKHSDPMALKEVDQELKETEEKDEYKRCDLIDVEKS---IQTESNSNFTCSHCGKSFK-QKQNLNNHMKIHAEQNPFTCQQCGMGFTRNGNLKRHMVVHTR------EKPFTCDQCGKSFKLKSTLDSHM--MIHTGEKPF-----TCDQCGKSFVDKGNLKQHM-MIHTGEKPFTCDQCGKSFRVKSTCDSHMMIHTGEKPFTCDQCGMSFRLKSTCDSHK--------KIHTGEKPFTCDQCGKSFRVKSTCDSHKRIHTGEKPFTCQQCGRSFADKGNLKQHMNRHNGEKRKSFRRKVTLNFHTKRKHSEENQELEEIEEKEQNNRHDFNDVEKSVQTETSSLTKAQKTKSKSN----FTCSHCGKSFNQKQNLYCHMKVH----NKPFSCEQCGMRFVHKGNLNVH 746          
BLAST of SMED30002896 vs. TrEMBL
Match: A0A087XCR8 (Uncharacterized protein OS=Poecilia formosa OX=48698 PE=4 SV=2)

HSP 1 Score: 72.0182 bits (175), Expect = 1.136e-8
Identity = 107/495 (21.62%), Postives = 184/495 (37.17%), Query Frame = 2
Query: 1337 KRAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQK----------ENCSPNFIKSLNNTE----SNGKPLLPIAPAQKADKWKLNPNPSDI----EKPLLTPIKSETVVIKNVISQNDTDATFQKN---MKFAEKFLNNPAITLNKGSQC-----VCNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQ------GIDVKYDSGVDLSKK-SLDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENE---SCIN-----SIVEADGI----ATNDKP----AAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADG--LFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYH 2668
            ++ F+C  C + F  ++   +H+++H   + F CV C+  F R ++L QH +            C  +F +    T+      G+ L      +K+   K N     +    EKP       ++  +K  ++ +    T +K    +   + F   P +T +  +        C  C   F    ++  H+V+H       G    S  KC     LK  L   +  + T   KP      +C  C   F+ K+ L  H    H  +           ++  V+L++   +  +   F C  CG SFH    L LH               +   C IC K+F      + H R H  E   SC+N     +   A  +     + +KP      G+S    +  TE  ++       +       ++  T   A +  +  G  LF C+ C K+F+ + +L+ H+  H     KPFSC  C + F   + L  H
Sbjct:  364 EKPFLCVNCGNSFRQKQQLIQHMMIHTAEKPFSCVTCEKSFNRKQLLTQHMRFHTGEKPFSCVTCEKSFNRKQLLTQHMRFHTGEKLFECVTCEKSFGEKQNLTRHMMTHTGEKPFSCVTCGKSFSLKRTLTDHMVIHTGEKPFSCVNCGKSFSGKPNLTRHIMTHTGEKPFSCVTCGKSFSLKRTLTDHMVIH------TGEKPCSCVKCGKSFSLKQHLTRHMR-IHTG-EKPF-----SCVTCGKSFSRKRTLTDHHMRTHTGEKPFSCVTCGKSFNQKVNLTRHMRIHTDEKPFSCMTCGKSFHQKLGLSLH--------MRIHTDEKPFMCVICEKQFAFKSAFNFHMRTHTGEKPFSCVNCGKRFAFKSAFNVHVRTHSGEKPFSCVTCGKSFGRKQYLTEHMMIHSGEKPFSCVNCGKRFAFKTAFDAHMRTHTGGRKLFSCETCGKSFSRKRNLTRHMVIHTG--EKPFSCVNCGKSFRHKVNLTEH 835          
BLAST of SMED30002896 vs. TrEMBL
Match: A0A3B5AI15 (Uncharacterized protein OS=Stegastes partitus OX=144197 PE=4 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 1.440e-8
Identity = 156/745 (20.94%), Postives = 255/745 (34.23%), Query Frame = 2
Query:  650 FESKLTKIYDLNTEPVPHRMVDFNNVVQCSKCELSFVHAYASRMHFEKVHLIRKRKRSSNPNGVEG------IIVSPNGSDNWGCDICGRQFPTLKQAKVHKFKSHI--EPV----------QKKKLMLHRNIIRKSNSSQRNLVKKYIAENK--------FREILPNSKKSKIDKSRIE-QGQSVNNEEESGCQGDQNNPDSYSASDTGRPATNLWRAAQSNSRGNKIVLSRVYSITNQNELNINGSSNRYGRFRKRAFVCFYCQSIFLNREGFKRHLLMHRKNES-----------------FKCVNCDLKFIRLKMLKQHQKENCSPNFIKSLNNTESNGKPLLPIAPAQKADKWKLNPNPSDIEKPLLTPIKSETVVIKNVISQNDTDATFQKNMKFA----------EKFLNNPAITLNKGSQCV-----CNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVK----CDICRKRFRNPLTLDEHRRLHENE---SCINSIVEADGIATNDKPAAGESTTFPRIKTEE--YILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQQL 2680
            F    T+++ L      + +   + +  CS C+LSF      + H E  H   K      P    G      +++S +  D   CD CG+ F  +   + HK   H    P           Q   L+ H+ + RK    Q     K + + +        F    P + +   + S  E Q ++V+  E +    D+      S SD G+  TN     +++ + +K+ +                        R R +VC  CQ  F       RHL  H+K                    F C  C L F  ++ L+QH  E+ S +   ++ N E + + L    P Q+  +       S I K L+ P +          S  + +A   K  K            ++   NP     K  +C      C  C++ F  +  + +H  + H  A      + S  +C         L +     +T         +  C  C   F  K  L +H+   H  + +    DS   + +   ++   ++ C  CG S  D K+   H               R+VK    C  C K F N   L +H+R+H  E   SC +       I        G+     R  T E  Y+ +    S   +     +     K   V P     + C EC K+F+   SL  H   H     K F C+ C + F  +  L+ H Q++
Sbjct:  227 FSEAWTQMWFLKLNATENNISATSQIFLCSHCQLSFTTEAFLQRHTEYFHAQPKAAEDHAPGADSGHSAASLVVLSVDSVDAKTCDDCGKSFKQIPHLRRHKLCVHSNRRPYCCPHCRRSFSQASGLIRHQLVHRKQAVIQTPDESKLLDKGESATPRSELFHAADPAASEETEELSINENQQEAVDVTETANASADEAEIGQCSCSDCGKSFTN-----EASLKKHKVTVHE----------------------RLRPYVCTVCQKCFGQYNDLTRHLQRHQKQNKRTGVISEDPEDSANTMPFSCAECSLAFSSVESLQQHINEHHSED--TAVGNQEESIQSL----PTQRPQRLGARSKLSAITK-LIAPKRKAANPAPAERSSAEPEAPAGKTGKLTKYKWFSCNRCKQTYGNPEDL--KAHKCTLKQHKCGQCRATFSKSGFLKRHEQMVHAKA-----KSYSCDRCGKTFTTSGNLKQHQKS-NTCMKYHCTSELFPCSFCQFSFTVKSYLIKHIKRHHPVEFLS-HCDSDSLMDQLEEEEGQKEYTCPQCGKSCADTKAFKSH------------TCFRQVKVLYLCTDCGKGFTNHYGLKQHQRVHTGEKPYSCTHCSKSFSYI--------GQLNVHLRTHTGEKPYLCTHCGESFRQSGDLKRHE---RKHTGVRP-----YSCPECSKSFSRPQSLKAHQMLHLG--QKMFKCTQCGKSFSRSYHLRRHHQKM 898          
BLAST of SMED30002896 vs. TrEMBL
Match: A0A3Q2FR18 (Uncharacterized protein OS=Cyprinodon variegatus OX=28743 PE=4 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.798e-8
Identity = 107/478 (22.38%), Postives = 178/478 (37.24%), Query Frame = 2
Query: 1337 KRAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQKENCSPNFIKSLNNTESNGKPLLPIAPAQKADKWKLNPNPSDIEKPLLTPIKSETVVIKNVISQNDTDATFQKNMKFAEKFLNNPAITLNKGSQCVCNLCQSCF--YSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATA-KPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLK-------FVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENE---SCI---------NSIVEADGIATNDKP----AAGESTTFP-RIKT-------EEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYH 2668
            ++ F C  C   F  +   K+H+ +H   + F C+ C+  FI  + L  H + +      + +    S GK  +  +   +  +          EKP L  I  +   +KN ++++    T +K  K                       C SC   ++ NS+  H+ +H         +     +C S  K     ++    L   T  KP      +C  C+  F  K  L  H+ ++H  +        G   + KS  D  ++       F C+ C  +F    SLI H         +     +  +C  C K F     LD H R+H  E   SC           S++    I T  KP    + G+S T   R+ T       E+       +     + + T+ +  +       + +  F C  CHKTFT +S L++H++ H    +KPFSC+ CN+ F    TL  H
Sbjct:  253 EKPFTCLSCGKGFTLKHALKKHIRIHTGEKPFYCIICNKNFIEKRSLASHMRLHTGEKPFECM----SCGKSFIQKSYLDRHTQLHKG------EKPFLCTICGKRFTVKNSVTEHIKTHTGEKPFK-----------------------CLSCGKSFTQNSLTTHMRIH---------SGEKPFECLSCGKSFTQKSDLDRHLRIHTGEKPF-----SCTICNKNFTEKGSLISHM-TIHTGKKPFECLSCGKSFTWKSSLDGHIRIHTGEKPFSCTICNKNFTKKGSLISH--------MTIHTGNKHSECLSCGKSFTQQSDLDRHIRIHTGEKPFSCTICHNNFTGKGSLISHMAIHTGKKPFECLSCGKSFTRKYRLDTHIRIHSGEKPFFCTICSKNFTERSSLTFHMRIH-------SGEKPFSCTTCHKTFTGKSHLTSHMRIHTG--DKPFSCTICNKNFTEKGTLTSH 665          
BLAST of SMED30002896 vs. TrEMBL
Match: A0A3Q0SPH5 (Uncharacterized protein OS=Amphilophus citrinellus OX=61819 PE=4 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.836e-8
Identity = 106/464 (22.84%), Postives = 166/464 (35.78%), Query Frame = 2
Query: 1337 KRAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQKENCSPNFIKSLNNTESNGKPLLPIAPAQKADKWKLNPNPSDIEKPLLTPIKSETVVIKNVISQNDTDATFQK-------NMKFAEKFLNNPAITLNKGSQC-VCNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHL--HSV-HV-DQGIDVKYDSGV--DLSKKSLDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENE------SCINSIVEADGIATNDKPAAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYH 2668
            K++  C  C   F        HL +H   + + C  C   F  L  LK H +             T +  KP  P     K    K +      EKP    I  +  + K+ + ++    T +K         +F +K      I ++ G +   CN C   F  ++ I+KH+  H       G    S S C    K        ++       KP     H+C  C  +F     L++H+  H+V H   +G   K++S +  D  KKSL        C  CG +FH    LI H               +   C+ C KRF +  T   H RLH  E      +C     +   + T+ +   GE      I  +++                   + T+ +       +  + C  C K F  +S L +HV+ H     KP+SC AC + F+    L+ H
Sbjct:   36 KKSIQCDTCGKTFYKNSHLTTHLRVHTGEKPYSCGTCGKGFTVLSALKTHLR-------------THTGEKP-YPCRNCGKTFTLKTHVRSCTGEKPFCCSICGKRFIQKSHLERHVRIHTGEKPYPCTTCGKRFNQKSELERHIRIHTGEKPHCCNTCGKRFADSSGIIKHMRFH------TGEKPYSCSTCG--KKFSQPSGLKIHVRIHTGEKP-----HSCSTCGKRFNQSTHLKKHMRIHTVIHCPHEGESCKWESQIQTDTRKKSLQ-------CDTCGKTFHYKHHLITH--------LRVHTGEKPHCCNTCGKRFADLSTFTRHMRLHTGEKPYSCSTCGKDFNQRITLKTHMRIHTGERPHCCSICGKKFA-----------------DLSTFVRHTRVHTGEKPYPCSTCGKRFIQKSYLKHHVRIHTG--EKPYSCGACGKRFIQKSDLKQH 438          
BLAST of SMED30002896 vs. Ensembl Cavefish
Match: ENSAMXT00000036835.1 (oocyte zinc finger protein XlCOF6-like [Source:NCBI gene;Acc:103026069])

HSP 1 Score: 66.2402 bits (160), Expect = 1.966e-10
Identity = 111/497 (22.33%), Postives = 184/497 (37.02%), Query Frame = 2
Query: 1340 RAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQH---QKE-------NCSPNFI-KSLNNTESNGKPLL-------PIAPAQKADKWK-------LNPNPSDIEKPLLTPIKSETVVIKNVISQNDTDATFQ----KNMKFAEKFLNNPAITLNKGSQCVCNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENESCINSIVEADGIA------------TNDKP----AAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSIP-TYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQQLCPNI 2692
            + F C  C+ +F NR+  + H   H + + F C  CDLKFI+L  LK+H    KE        C  +F+  SL  + S   PL          +P+ K  K K        N N  +   P      S+ + ++NV S ++   +F     K +  + K+L       N+    +C +C   F S   + KH+++H         T     KC    +    LN +   L + +      F  +C+ C  ++  K  L  H            K  +G+ L           F CSDCG +F   + L  H               ++ +C  C+ +F    +L  H R+H ++          G              T +KP      G+S + P    E   L              ++S   T ++ +     +  ++C EC KTF       NH++ H     KP+ C  C + F    +L  H+++   +I
Sbjct:  308 KTFSCSQCKKMFGNRKNLRAHEKRHNEQKDFLCEVCDLKFIKLSELKKHSLMHKEKGKFRCSGCKKSFLDSSLLRSHSCNLPLSGDKTCDNDRSPSSKGHKQKKCDVTEQQNQNFGESSGP------SDDLQVENV-SLDEKRKSFSCSVCKKLYASLKYLKLHEKRHNEVKDFLCEVCSRSFISLTELKKHMLMH---------TGEGKFKCLVCGR--SFLNLSSFKLHSVSHSDERAF--SCDECGRKYKVKGSLVEH-----------QKSHTGLQL-----------FPCSDCGKTFTHKRYLKKH--------MLRHSKEKQFQCSYCQNKFSQLNSLKTHMRIHSDDKPYKCSHCGKGFRHKVHMQCHERTHTGEKPYLCADCGKSFSDPSHFNEHKRLHTGERPYVCTTCGKSFSKKITLRQHEKIHTGEKPYKCTECEKTFARPCVFKNHLRIHTG--EKPYQCPICKEKFTFLSSLNSHKKKHAADI 752          
BLAST of SMED30002896 vs. Ensembl Cavefish
Match: ENSAMXT00000047138.1 (oocyte zinc finger protein XlCOF6-like [Source:NCBI gene;Acc:103026069])

HSP 1 Score: 66.2402 bits (160), Expect = 1.966e-10
Identity = 111/497 (22.33%), Postives = 184/497 (37.02%), Query Frame = 2
Query: 1340 RAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQH---QKE-------NCSPNFI-KSLNNTESNGKPLL-------PIAPAQKADKWK-------LNPNPSDIEKPLLTPIKSETVVIKNVISQNDTDATFQ----KNMKFAEKFLNNPAITLNKGSQCVCNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENESCINSIVEADGIA------------TNDKP----AAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSIP-TYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQQLCPNI 2692
            + F C  C+ +F NR+  + H   H + + F C  CDLKFI+L  LK+H    KE        C  +F+  SL  + S   PL          +P+ K  K K        N N  +   P      S+ + ++NV S ++   +F     K +  + K+L       N+    +C +C   F S   + KH+++H         T     KC    +    LN +   L + +      F  +C+ C  ++  K  L  H            K  +G+ L           F CSDCG +F   + L  H               ++ +C  C+ +F    +L  H R+H ++          G              T +KP      G+S + P    E   L              ++S   T ++ +     +  ++C EC KTF       NH++ H     KP+ C  C + F    +L  H+++   +I
Sbjct:  308 KTFSCSQCKKMFGNRKNLRAHEKRHNEQKDFLCEVCDLKFIKLSELKKHSLMHKEKGKFRCSGCKKSFLDSSLLRSHSCNLPLSGDKTCDNDRSPSSKGHKQKKCDVTEQQNQNFGESSGP------SDDLQVENV-SLDEKRKSFSCSVCKKLYASLKYLKLHEKRHNEVKDFLCEVCSRSFISLTELKKHMLMH---------TGEGKFKCLVCGR--SFLNLSSFKLHSVSHSDERAF--SCDECGRKYKVKGSLVEH-----------QKSHTGLQL-----------FPCSDCGKTFTHKRYLKKH--------MLRHSKEKQFQCSYCQNKFSQLNSLKTHMRIHSDDKPYKCSHCGKGFRHKVHMQCHERTHTGEKPYLCADCGKSFSDPSHFNEHKRLHTGERPYVCTTCGKSFSKKITLRQHEKIHTGEKPYKCTECEKTFARPCVFKNHLRIHTG--EKPYQCPICKEKFTFLSSLNSHKKKHAADI 752          
BLAST of SMED30002896 vs. Ensembl Cavefish
Match: ENSAMXT00000049921.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000553.1:32346:35546:-1 gene:ENSAMXG00000035437.1 transcript:ENSAMXT00000049921.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 3.379e-9
Identity = 91/476 (19.12%), Postives = 165/476 (34.66%), Query Frame = 2
Query: 1316 NRYGRFRKRAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQKENCSPNFIKSLNNTESNGKPLLPIAPAQKADKWKLNPNPSDIEKPLLTPIKSETVVIKNVISQNDTDATFQKNMKFAEKFLNNPAITLNKGSQCVCNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKS-------LDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENES------CINSIVEADGIATNDKPAAGE-----STTFPRIKTEEYI-----LXXXXXXXXXXXXXXTYSIPT-YKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHR 2671
            ++Y    ++ + C  C   F  +   +RH  +H   + + C  C   FI+   L+QHQ+ +      +   +    GK  +  +  Q+  +      P              +V  K+    +D      K +   EK  +             C+ C   F   + + +H  +H       G T    ++C          N   + L     KP      +C  C   F ++  LQ+H   +H  +        G++  +KS       +      + CS CGM+FH   SL  H+              +   C  C   F   +TL+ H+R+H  E       C         + T+ +   GE     S    R  T+ ++     +         +    +++ P+  ++ K     +  + C +C K+F  +S L  H + H      PF C+ C + F     LQ H+
Sbjct:  189 HKYIHTGEKPYCCSVCGMNFHQKSSLERHQGIHTGEKPYHCSVCGKSFIKQSDLQQHQRIHTG----EKPYHCSVCGKSFIKQSDLQQHQRIHTGEKPHHC-----------SVCGKSFTKPSDLQR--HKYIHTGEKPYH-------------CSDCGKGFIKQSDLQQHQRIH------TGETPFQCTEC--GKNFYKQYNLQQHQLIHTGEKPF-----HCLDCGKSFTTQGNLQQHK-RIHTGEKPYCCSVCGMNFHQKSSLERHQGIHTGEKPYYCSACGMNFHQKSSLERHQG--------IHTGEKPYYCSACGMNFHQKITLERHQRIHTGEKPYHCSVCGKRFTTQSHLKTHQRVHTGEKPYHCSVCGKRFTTQSHLKIHQRIHTGEKPHHCSVCGKSFTKPSDLQRHKYIHTGEKPYHCSDCGKSFIKQSDLQQHQRIHTG--ETPFQCTECGKNFYKQYNLQQHQ 610          

HSP 2 Score: 52.373 bits (124), Expect = 3.683e-6
Identity = 61/267 (22.85%), Postives = 103/267 (38.58%), Query Frame = 2
Query: 1943 STATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKS-------LDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENES---CIN---------SIVEADGIATNDKP----AAGESTTFPR-IKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHR 2671
            ST   KP     H+C  C   F     LQRH + +H  +      D G    K+S       +      F C++CG +F+   +L  H+              +   C  C K F     L +H+R+H  E+   C           ++ +   I T +KP      G+S T P  ++  +YI +       +    + +   + ++ +     +  + C  C K+F  +S L  H + H     KP+ CS C + F+    LQ H+
Sbjct:   24 STGKKKP-----HHCSDCGKSFTKPSDLQRHKY-IHTGEKPYHCSDCGKSFIKQSDLQQHQRIHTGETPFQCTECGKNFYKQYNLQQHQ--------LIHTGEKPFHCLDCGKSFTTQGNLQQHQRIHTGETPFQCTECGKNFYKQYNLQQHQRIHTGEKPYHCSVCGKSFTKPSDLQRHKYIHTGEKPYCCSVCGMNFHQKSSLERHQGIHTGEKPYHCSVCGKSFIKQSDLQQHQRIHTG--EKPYHCSVCGKSFIKQSDLQQHQ 274          
BLAST of SMED30002896 vs. Ensembl Cavefish
Match: ENSAMXT00000053921.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000266.1:123270:124445:-1 gene:ENSAMXG00000043232.1 transcript:ENSAMXT00000053921.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 6.429e-8
Identity = 68/271 (25.09%), Postives = 101/271 (37.27%), Query Frame = 2
Query: 1895 SVAKLKPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLK-------FVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENE------SCINSIVEADGIATNDKPAAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYH 2668
            SVA + P  NE +N        P+    + C  C + F+ K  LQ H  S H  +      + G + S +S     L+       FVCS+CG  F  +  L++H+              +  +C  C K FR    L  H  +H  E      SC  +      +  + +   GE+          + L    +    +     + I T +K          ++C EC K F  RS L  H + H     KPFSCS C + F     LQ H
Sbjct:  116 SVASVLPEANE-LNSEDPKQHTPVEEMPYQCSECENTFSDKSSLQLHQRS-HTGETPYKCTECGKNFSTRSTLKKHLRIHTGEKPFVCSECGKCFRQSGMLLVHKS--------IHTGVKPYQCSECGKCFRVKDHLKSHLTVHTGERPYVCLSCGKNFTTNRCLQLHQRTHTGENMY--------HCLVCGKSFYQKSDLHVHHRIHTGEKP---------YQCSECGKCFFVRSHLHQHQRIHTG--EKPFSCSECGKSFSFHSNLQQH 357          
BLAST of SMED30002896 vs. Ensembl Cavefish
Match: ENSAMXT00000048831.1 (zinc finger protein 883-like [Source:NCBI gene;Acc:103030966])

HSP 1 Score: 57.7658 bits (138), Expect = 8.243e-8
Identity = 108/560 (19.29%), Postives = 197/560 (35.18%), Query Frame = 2
Query: 1067 LPNSKKSKIDKSRIEQGQSVNNEEESGCQGDQNNPDSYSASDTGRPATN--LWRAAQSNSRGNKIVLSRVYSITNQNELNINGSSNRYGRFRKRAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQKENCSPNFIKSLNNTESNGKPLLPIAPAQKADKWKLNPNPSDIEKPLLTPIKSETVVIKNVISQNDTDATFQKNMK---FAEKFLNNPAITLNKGSQC-----VCNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKS-------LDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHEN------ESCINSIVEADGIATNDKPAAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKA-KVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQ 2674
            LP    SK+   +++Q  +  +++ +G   D     +   + T   A N     A Q+N+               Q E++ +          K+ + C  C   F+      +H   H +   + C  C  K+   K L+ HQ   C     K L   ++ GK  + +   +  ++  L        KP L  +      ++ V+  +    T +K  +     ++F  +  + ++KG+        C LC   F    ++ KH V+H                                    +  KP     H C+ C  +F  ++ L+RH+ + H+          G   S+KS       +   +  F+C  CG +F  N +L  H     G    SG      +CD+C K +    TL  H+R+H        + C  +     G+ T+++  +G       +   E ++              T+    Y K   +  N +  ++C  C K F   + L  H+  H     KP  C  C   F +   L+ H++
Sbjct:  143 LPEKAPSKLAAIQVDQSFAAEDDDGAGFLEDDVENQTVEGASTAANAVNDQTQSAEQTNT---------------QEEMSTD----------KQTYECEKCGKTFVKWHNLVQHKRRHAEPAPYSCEKCGKKYTFQKALESHQLTGCEKK--KELRPCQTCGKSFVDL---ESHERIHLQV------KPFLCGVCGRGFTLEYVLKAHQRLHTGEKPYQCELCGKRFTQSSTLLIHKGTHTDEKPWSCELCDKTFKRRANLRKHQVVH------------------------------------SGEKP-----HTCDTCGQKFRHRENLKRHMRN-HLGIRPYKCKTCGKRYSQKSSLKEHMPVHGASKPFMCEKCGKTFVYNYTLRNHMRTHEGSVEESGAEKNPQRCDVCGKCYSTTYTLKMHQRIHSESDPLTCKVCGKTFSSTAGLYTHEQQHSG-------LNASECVI-----------CKKTFVNKAYLKVHMLLHNNEKPYKCSICPKAFNLANGLKMHMLIHTG--EKPHKCDICGMSFRTAGNLRRHKR 604          
BLAST of SMED30002896 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002487.1 (pep scaffold:Pmarinus_7.0:GL476414:876407:883640:1 gene:ENSPMAG00000002270.1 transcript:ENSPMAT00000002487.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.4546 bits (132), Expect = 6.352e-8
Identity = 59/249 (23.69%), Postives = 92/249 (36.95%), Query Frame = 2
Query: 1976 IHNCEHCSSQFASKKGLQRHLHS---VHVDQGIDVKYDSGVDLSKKS-LDDNTLK------FVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENE------SCINSIVEADGIATNDKPAAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQ 2674
            ++ CE C   F+S++ L +HL +    H  +   +  D G   S KS L  ++L       FVC+DCG  F     + +HR         +    R   C  C +RF  P +L  H+  H  E       C    ++A  +  + K   GE           Y+                                    C EC K+F+  S+++ H K+H     KPF C  C +GF     L+ H++
Sbjct:   13 MYMCEQCGKTFSSRRTLGQHLKAHLRTHTGEKPFICQDCGKRFSLKSTLKTHSLTHSLEKPFVCNDCGKGFSKASYMKVHR--------LTHTGERPYACQDCGQRFSQPSSLKTHQFTHTGERPFICTDCGKRFLQASTLKEHHKIHTGE---------RPYV------------------------------------CKECGKSFSYSSAMTVHQKTHTG--EKPFICKDCGRGFAQKPHLKTHQR 206          

HSP 2 Score: 53.1434 bits (126), Expect = 3.276e-7
Identity = 101/473 (21.35%), Postives = 166/473 (35.10%), Query Frame = 2
Query: 1337 KRAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQK----------ENCSPNFIKSL-----NNTESNGKPLL----PIAPAQKADKWKLNPNPSDIEKPLLTPIKSETVVIK-NVISQNDTDATFQKNM------KFAEKFLNNPAITLNKGSQ-CVCNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENESCINSIVEADGIATNDKPAAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQ 2674
            +R + C  C   F      K H   H     F C +C  +F++   LK+H K          + C  +F  S        T +  KP +        AQK    K +      EKP    I  ++  +  N+ +   T    +  M      +F++K      +  + G +  +C  C + F    S  +HL  H RI   E      I  C     LK  L    ++ + +  KP +     C+HC   ++ K  L+ H                      + +      F+C +CG  F    SL  H+         +    +   C  C +RF    +L  H+ LH  E             T   P  G+  +FP                            + K+ +   +++  F C EC K+F+  S+L  H K+H    +KPF+C+ C +GF     L+ H++
Sbjct:   99 ERPYACQDCGQRFSQPSSLKTHQFTHTGERPFICTDCGKRFLQASTLKEHHKIHTGERPYVCKECGKSFSYSSAMTVHQKTHTGEKPFICKDCGRGFAQKPH-LKTHQRIHTGEKPYACNICGKSFSLNYNLKAHQKTHLKERPYMCELCGKRFSDKRTLVVHMRTHTGVKPYICTHCGNKF----SQGQHLKAHKRIHTGERPFICKI--CGKGFALKSTLK--THEFTHSVEKPFI-----CKHCGKGYSLKSTLKNH----------------------EIVHSGEKPFLCKECGKGFSQGSSLKNHK--------LTHDGEQPFICQECGRRFSQTSSLKTHQLLHTGEK------------TFLCPDCGKRFSFP---------------------------SSLKQHQQMHSSERPFICKECGKSFSYYSNLKVHQKTHTG--DKPFTCTLCGRGFSQKPHLKSHQR 486          
BLAST of SMED30002896 vs. Ensembl Sea Lamprey
Match: prdm5 (PR domain containing 5 [Source:ZFIN;Acc:ZDB-GENE-040708-1])

HSP 1 Score: 48.521 bits (114), Expect = 7.098e-6
Identity = 70/319 (21.94%), Postives = 120/319 (37.62%), Query Frame = 2
Query: 1775 VCNLCQSCFYSNNSILKHL-VLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATAKPILHFIH----NCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLKFVC--SDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHE---NESCINSIVEADGIA------TNDKPAAGE--STTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQQ 2677
             C  C+S F S + + +H+  LH R   ++ +      +C S  K  P+       +     K +L         C  CS+ F S+  L++H  +   D                       +FVC    CG  F    +L  H+ +        G + +R  C+IC K+F +   L EHR++HE    + C    + A+ +       +  +P + E    +F R+                        + ++   KV  + D  + C  C K F  R+   NH K+H   + +PF C  C   F +  +LQ H ++
Sbjct:    2 ACPQCESSFPSASVLAEHVQTLHQRGPEEKDF------RCRSCGKRFPVKQALQRHVLQCMEKAVLPGEQPGGFQCGVCSASFVSECSLEQHREACRRD----------------------ARFVCKAERCGKRFKSKDTLKKHKQN-----VHLGSSRKRPACNICNKKFSSSDILMEHRKVHEIFDCQDCDKKFISANQLRRHMITHSEKRPFSCEVCGKSFKRLD----------------------QVASH---KVIHSVDKPYTCKLCGKGFAHRNVYKNHKKTH--SEERPFQCEECKALFRTPFSLQRHHKK 260          
BLAST of SMED30002896 vs. Ensembl Nematostella
Match: EDO36958 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SH48])

HSP 1 Score: 57.7658 bits (138), Expect = 1.815e-8
Identity = 102/457 (22.32%), Postives = 163/457 (35.67%), Query Frame = 2
Query: 1346 FVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQK-ENCSPNFIKSLNNTESNGKPLLPIAPAQKADKWKLNPNPSDIEKPLLTPIKSETVVIKNVISQN-DTDATFQKNMKFAEKFLNNPAITLNKGSQCVCNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVD-------QGIDVKYDSGVDLSKK-SLDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEH------RRLHENESCINSIVEADGIATNDKPAAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYH 2668
            F+C  C   F +  G K+H+  H + +S KC  CD++F     L +H +  +C   FIK                     ++W      + ++  L T  K        +  ++    A  +++MK+  +    P           CN C   FY    + KHL  H         +   + KC+   K    +      LST   K   +F   CE C   F S  GL++H+   H +       Q     Y  G DL+K   +      + C  CG  F    SL  H       +      G + KCD C K F +P  L +H      ++ H    C  S      +  + +   GE         +++  +                           +A  LFEC +C  +F+  SSL  H+KSH     +   CS C++ F++   L+ H
Sbjct:    4 FICELCNKSFGSAIGLKQHMTFHVEKKSHKCNQCDMEFYTRGDLTRHLRIHSCEKPFIK-----------------CDMCERW--FTQSTSLKTHLCTHDKKPDNFKCELCEKSFGYSAGLRQHMKYHTE--KKPH---------KCNQCDMEFYKKGDLTKHLRTH---------SGEKLFKCDICEKRVTRMTTLKAHLSTHYFKKPANF--KCELCKRSFGSASGLRQHI-KYHAEKKPHKCKQCFKEFYTRG-DLTKHLRIHSGEKPYNCDRCGRRFTQISSLKAH-----LATHKDPEDGTQSKCDHCGKSFADPAYLRQHLKYHFGQKTHRCSKCGFSFFTKGDLRKHTRIHNGERPYKCDFGGKQFTQNSSMNEHLYLH-----------------SAQKLFECSQCGNSFSQISSLYTHLKSHSG--KRLAKCSNCSKTFVNLKDLKQH 393          
BLAST of SMED30002896 vs. Ensembl Nematostella
Match: EDO48839 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIQ4])

HSP 1 Score: 51.6026 bits (122), Expect = 1.875e-6
Identity = 74/321 (23.05%), Postives = 116/321 (36.14%), Query Frame = 2
Query: 1775 VCNLCQSCFYSNNSILKHLVLH--HRIAIQEGYTALSISKC----ESVAKLKPLLNETVN-----DLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVD-QGIDVKYDSGVDLSKKSLDDNTLK------FVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENESCINSIVEADGIATNDKPAAGE--STTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPT---YKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYH 2668
            +CN C S F    ++ KH++ H  +           +  KC    + + K+K      V      D S  T +P       C +CS +F +K  +  H    H+  +     Y +    SK  LD +         + C  CG  F ++ SLI+H+              +  KC +C K F +  +L  H R H                + DKP   E     F         +         +     +S  T    K+       +  + C+EC K F+    LS H K HFN   KP SC+ C++ F +T  +  H
Sbjct:    2 LCNRCDSSFKHFTALEKHIISHDGNVTIFNRRRGTRTCLKCNRSFKKIEKMKDHWRRCVPVQAAFDSSGKTERPW-----GCVYCSKKFKTKAKVAEHTRRTHLKVKPFSCTYCNKKCASKSDLDKHERTHTGEKPYSCKYCGRMFGESSSLIMHQ--------RIHTNEKPYKCKLCPKAFTSHSSLVMHNRHH----------------SGDKPYKCEICGRAFSVSSNRARHMRSHKNIKPYSCSQCEWSFTTSSDLKRHLKTHTGEKPYRCEECDKAFSSSCGLSTHKKIHFNI--KPHSCTVCHKRFATTGQVTSH 291          
BLAST of SMED30002896 vs. Ensembl Nematostella
Match: EDO42127 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2E0])

HSP 1 Score: 50.447 bits (119), Expect = 3.645e-6
Identity = 70/279 (25.09%), Postives = 104/279 (37.28%), Query Frame = 2
Query: 1979 HNCEHCSSQFASKKGLQRHLHSVHV--DQGIDVKYDSGVDLSKKSLDDNTLK------FVCSD--CGMSFHDNKSLILHR-------------DDCXXXXXXXXXXXRRV---------KCDICRKRFRNPLTLDEHRRLHENE----------SCINS--IVEADGIATNDKPAAGEST----TFPRIKTEEYILXXXXXXXXXXXXXXTYSIPT-YKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYH 2668
            H CE C   F     L++H+  +H   ++  + +Y      +  SL  + L       FVC    CG SF++  SL +HR             + C     ++    R           KCD C K F     L  H R+H  E          +CI S  +V+     + DKP   +S     T P    +             +     ++I T  K  +     D  F+CDEC KTF     L  H+  H     KPF C  C++ F+S +T + H
Sbjct:   34 HKCEVCGKVFNYASNLRQHM-LIHTGSEKPYECEYCDKAFNNPSSLRSHVLSHSEERPFVCDQEGCGKSFNNPGSLRVHRRVHQEDKPHICEHEGCDKAFKTAAELSRHAFRHTGEKPHKCDQCEKAFIRYDDLKRHYRIHTGEKPFKCDQCDFACIQSFDLVKHKFTHSGDKPYKCDSCPKQFTRPARLRDHMRTHTGEKPYVCDVCGKGFAIQTGLKSHQAIHTGDKPFKCDECEKTFRTALELQAHMGRHTGV--KPFKCDICDKEFISAITFKRH 309          
BLAST of SMED30002896 vs. Ensembl Medaka
Match: ENSORLT00000012557.2 (GDNF-inducible zinc finger protein 1 [Source:NCBI gene;Acc:101173426])

HSP 1 Score: 59.3066 bits (142), Expect = 2.649e-8
Identity = 81/322 (25.16%), Postives = 121/322 (37.58%), Query Frame = 2
Query: 1766 SQCVCNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATAKPILHFIH--------NCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKS---LDDNT----LKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENESCINSIVEADGIATNDKP----AAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQ 2674
            +Q  CN CQ  F+   S LKH+  +H      G  A  + +C+       +  +T  + S       +H  H         C+ CS  F  KK + RH   VH      V  D G  LS K+   L + T      + C+DCG  F  N +L +HR         +    +   CD C  RF     L  H+R H                T +KP    A G+S       ++EY+                 +I T  K          ++C  C + F  R+SL+ H+K H     +P+ C  C++ F     LQ H++
Sbjct:  291 AQFQCNKCQRTFHYERSYLKHISTYH------GVQADIVHRCD-------ICMQTFANRSNLK----IHEKHVHSNERQFACDSCSKTFKRKKDVIRHQRQVHERNLQHVCPDCGKTLSSKAALLLHERTHTGSRPYECADCGARFTQNSALKMHR--------RTHTGEKPYACDECDARFTQKHMLSYHKRSH----------------TGEKPFMCEACGKS-----FASKEYLKHHS-------------NIHTGFKP---------YKCVHCGRGFAQRNSLNQHLKIHTG--ERPYCCKDCDKKFTQLNALQRHQR 542          
BLAST of SMED30002896 vs. Ensembl Medaka
Match: ENSORLT00000039104.1 (pep primary_assembly:ASM223467v1:17:11164388:11168149:-1 gene:ENSORLG00000007097.2 transcript:ENSORLT00000039104.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 2.952e-8
Identity = 75/331 (22.66%), Postives = 116/331 (35.05%), Query Frame = 2
Query: 1778 CNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQ--------GIDVKYDSGVDLSKKSLDDNTLKFVCSDCGMSFHDNKSLILHR-----------DDCXXXXXXXXXXXRRVK---------CDICRKRFRNPLTLDEHRRLHENES------CINSIVEADGIATNDKPAAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYH 2668
            C +CQ CF  N S+  H+ +H         T      C+   K     N     + T T++   HF   CE C   F   + L+ H+   H D+             + S +++  +    +T  F C  CG  F     L  H            D C     S       +K         C IC KRF    +L+ H R+H  E       C  S      +  + +   GE     ++  + +                 YS+  + +       + LF C+ C K FT  S L  H+ +H     +PF+C  C +GFM +  L+ H
Sbjct:   98 CEVCQKCFAQNYSLNVHMRIH---------TGERPYSCDICKKAFIYANSLTYHMRTHTSER--HF--TCEICQKDFMQNRDLKAHM-GTHTDERPYSCKVCEKQFTHKSNLNVHMRIHTGDT-PFTCEVCGKFFSQRSKLKAHIRSHTGEKLFSCDICKKVFVSLRNLTYHMKTHTGERPYSCKICLKRFTQKSSLNVHMRIHTGERPFTCEVCGKSFTTGRDLKAHMRTHTGEKPYSCKVCEKHFT--------------QKYSLKVHMRIH---TGERLFTCEVCRKCFTTGSELKAHIGTH--TAEEPFTCQLCQKGFMQSRDLKIH 394          
BLAST of SMED30002896 vs. Ensembl Medaka
Match: znf646 (zinc finger protein 62 homolog [Source:NCBI gene;Acc:101166995])

HSP 1 Score: 57.3806 bits (137), Expect = 1.196e-7
Identity = 141/688 (20.49%), Postives = 253/688 (36.77%), Query Frame = 2
Query:  854 VSPNGSDNWGCDICGRQFPTLKQAKVHKFKSHIE-----------PVQKKKLMLHRN--------IIRKSNSSQRNLVKKYIAENKFREILPNSKKSKIDKSRIEQG----------QSVNNEEESGCQGDQNNPDSYSASDTGRPATNLWRAAQSNSRGN-KIVLSRVY-------SITNQNELNINGSSNRYGRFRKRAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKF-------IRLKMLKQHQ-KENCSPNFIKSL---NNTESNGKPLLPIAPAQKADKWKLNPNPSDIEKPLLTPIKSETVVIKNVISQNDTDATFQ--KNMKFAEKFLNNPAITLNKGSQCVCNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDL---STATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLK----FVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENE------SCINSIVEADGIATNDK-----------PAAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYH---RQQLCP 2686
            V  + SD + C ICG  + +++  + H  + H +           P+  ++ +   N           +S +++ +L+   I  NK +E + +  +S+  +S+ +Q            S N+ +  GC  ++ +       +  + A N+++  +++ R        R Y       S  +   L  +  S++ G FR     C  CQ  F N    K H   H   + + C  C   F       I L+  K++Q K     N I++L   N + S+GK  L + PA          +P+   +      ++E+ V     S     A  Q  +  + A   +N+     +K  +  C++C + + +  ++  HL  H    + + +T  +  K       K LL    +DL     A  + +   +  C+ C   F S   L  H  + H D G            +   + N +K    F C+ CG S+    SL+ H++                 C  C K F NP+ L  H R+H  +      +C  +   A  +  + +           P+ G S          +            +      +P  +++         F CD C +++    SL NH KSH         C+ C Q F  +LTLQ H   R+  CP
Sbjct:  617 VEEDDSDLYQCSICGNNYSSMRALRCH-LRGHTQSSDTPASSGPSPMSSREDVKEENEGEMMICSTCGESFANRVDLINHQILHNKDQEEVLDQSQSEASESKEDQPIICGTCGISCTSYNHLDNHGCTAERGD----ELVECKQEADNVFKQEETSPRREPDDAEDRQYKCEQCGRSYRHAGSLLNHKKSHKTGLFR-----CQICQKRFYNLLALKNHQRSHFDIKRYTCHECGKAFKIQKQLLIHLRRHKRNQAKMQELGNQIQALMQMNGSRSDGK--LSLLPANANHASASAQHPAQEPEGKRAETEAESSVTSKDASDQRPFACDQCGRTYRHAGSLVNHK--NSHKTGEYYCSICNNTYSNQLAMKNHLRTH---FLYKRHTCQNCGK--GFRGKKQLLAHVCSDLRKDGAAGRRVLKSRLIKCKDCKQTFLSVDQLSSHTCNGHPDSG------------ESQPESNPIKEERPFRCNICGRSYRHAGSLLNHKN---------THKTGHFSCTFCSKPFTNPMALRNHTRIHTQKKKFVCLTCGKAFRLASILHNHQRIHNRVLSHFSCPSCGRS----------FQSRSSLRRHHCRRGQGRSVLPGVQRSD---RGSKCFTCDLCGRSYRHAGSLLNHKKSH---SENLHHCALCLQTFPDSLTLQIHSQMRRHCCP 1248          
BLAST of SMED30002896 vs. Ensembl Medaka
Match: ENSORLT00000045028.1 (pep primary_assembly:ASM223467v1:17:11266576:11351617:-1 gene:ENSORLG00000007097.2 transcript:ENSORLT00000045028.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.9954 bits (136), Expect = 1.359e-7
Identity = 123/622 (19.77%), Postives = 217/622 (34.89%), Query Frame = 2
Query:  863 NGSDNWGCDICGRQFPTLKQAKVHKFKSHIEPVQKKKLMLHRNIIRKSNSSQRNLVKKYIAENKFREILPNSKKSKIDKSRIEQGQSVNNEEESGCQGDQNNPDSYSASDTGRPATNLWRAAQSNSRGNKIVLSRV--YSITNQNELNINGSSNRYGRFRKRAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQKEN----------CSPNFIKSLNNTESNGKPLLPIAP--AQKADKWKLNPNPSDIEKPLLTPIKSETVVIKNVISQNDTDATFQKNMKFAEKFLNNPAITLNKGSQCVCNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENES------CINSIVEADGIATNDKPAAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYH 2668
             G   + C++CG+ F T    KVH  ++H  P   K L+  RN+           ++ +  E  F        KS    S ++    ++  E          P S    + G   +           G +    +V   S T  + LNI+  S+      +R + C  CQ  FL  +  K H+  H     F C  C   F++   LK H + +          C   F+ SL N   + K      P   +   K  + P+  +I   L T  +  +  I      + +  T+   +   E+  +             C +CQ CF  ++ ++ H+ +H       G    S   C+ V      L  T++  +    +P     ++C+ C   F   + L+ H  + H D+                       + C  C   F  N SL +H             + R   C++C K F     L  H R+H  +       C  + +  + + ++ +    +      I  + ++          + +  TY I T+         +  + C  C K FT RS L+ H++ H     +P+SC  C + F+ +  L  H
Sbjct:  223 TGERPFTCEVCGKSFTTGSDLKVH-IRTHTNPFSCKVLISLRNLTYH--------MRIHTGERPF--TCEVCGKSFTKGSDLKMHIRIHTGER---------PFSCDICNKGFINSGALTCHMRTHTGERPYSCKVCQKSFTQSSYLNIHMRSHT----GERPYSCKLCQKGFLQSKDLKVHMRTHTGERPFICEVCGKNFLQSTKLKAHIRTHTATKLFSCDICKKVFV-SLRNLTYHMKTHTGERPYSCKVCQKCFIQPSHLNIHMRLHTGERPYSCDICKKTFIHASRLTYHMRIHTGERPYS-------------CKVCQKCFTQSSCLIVHMRIH------TGERPYSCHICKKVFIHSGGL--TLHMRTHTGERP-----YSCKLCQKGFMHSRALKVHTRT-HTDER---------------------PYSCKVCKKHFTQNSSLNVH--------MRIHTSERPFTCEVCGKSFTTGSDLKVHIRIHTAKKLFPCDICEKTFIHVNSLTSHMRTHTAKKLFSCDICKKVFV----------SSRNLTYHIRTH-------TGERPYSCKVCKKCFTQRSCLNVHMRIHTG--ERPYSCDICRKTFIHSNNLTLH 744          
BLAST of SMED30002896 vs. Ensembl Medaka
Match: ENSORLT00000023037.2 (pep primary_assembly:ASM223467v1:2:6315167:6498304:1 gene:ENSORLG00000027271.1 transcript:ENSORLT00000023037.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.225 bits (134), Expect = 1.439e-7
Identity = 70/309 (22.65%), Postives = 114/309 (36.89%), Query Frame = 2
Query: 1793 SCFYSNNSILKHLVLHHRIAIQEGYTALSISKCE----SVAKLKPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGI-----DVKYDSGVDLSKKSLDDNTLK-FVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENES------CINSIVEADGIATNDKPAAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPN-ADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYH 2668
            SC   N        L   + I  G    S  +C+    S ++LK  +     +      KP      +C  C   F+   GLQ+H+ +   ++       D  +    +L +        + F C +C  SF  N+ + +H  +            +   C +C   F    TL  H R+H  +       C  S  +   +  + K   GE   FP  K E                   +S P++ K  +  +  +  F C EC K+F+C  SL  H+++H     KPFSC+ CN+GF      + H
Sbjct:  120 SCIECNKGFSDLFNLKSHVRIHTGEKPFSCKECDKSFNSTSQLKKHMRTHTRE------KPF-----SCIECKKGFSDSSGLQKHMRTHTGEKPFFCKECDKSFSQSSNLQRHMRTHTGERPFSCKECDKSF--NRHMRIHTGE------------KPFSCKLCDTSFSRLSTLKNHMRIHTGDKPFSCNDCDKSFRQMGHLNIHMKTHTGEKP-FPCNKCER-----------------AFSYPSHLKNHMRTHTGEKPFSCKECDKSFSCLFSLKRHIRTHTG--EKPFSCNKCNKGFSDLSNFKKH 383          
BLAST of SMED30002896 vs. Planmine SMEST
Match: SMESG000065210.1 (SMESG000065210.1)

HSP 1 Score: 1330.85 bits (3443), Expect = 0.000e+0
Identity = 738/761 (96.98%), Postives = 741/761 (97.37%), Query Frame = 2
Query: 1025 LVKKYIAENKFREILPNSKKSKIDKSRIEQGQSVNNEEESGCQGDQNNPDSYSASDTGRPATNLWRAAQSNSRGNKIVLSRVYSITNQNELNINGSSNRYGRFRKRAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQKENCSPNFIKSLNNTESNGKPLLPIAPAQKADKWKLNPNPSDIEKPLLTPIKSETVVIKNVISQNDTDATFQKNMKFAEKFLNNPAITLNKGSQCVCNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENESCINSIVEADGIATNDKPAAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQQLCPNIXXXXXXXXXXXXXXXXXLAPQQNIYSSFDGVSQVPGSNYXXXXXXXXXXXXXXXXXXXXXXXRATSCMHCNAMFPDRSLLEDHASKEHSNHAGEVVCIICPRSFTTYMAFRVHMTKSHGGPNGTSLKSHLNAASIHKANTSFEMIQXXXXXXXXXXXXXXXXXXXGKVFHSRHACPNCDKDFSTSQALGNHKRACMPHLYKKVNL 3307
            LVKKYIAENKFREILPNSKKSKIDKSRIEQGQSVNNEEESGCQGDQNNPDSYSASDTGRPATNLWRAAQSNSRGNKIVLSRVYSITNQNELNINGSSNRYGRFRKRAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQKENCSPNFIKSLNNTESNGKPLLPIAPAQKADKWKLNPNPSDIEKPLLTPIKSETVVIKNVISQNDTDATFQKNMKFAEKFLNNPAITLNKGSQCVCNLCQSCFYSNNSILKHLVLHHRIAIQ+GYTALSISKCESVAKLKP+LNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLK                    DDCSGWSSSSGGTGRRVKCDICRKRFRNPLTLDEHRRLHENESCINSIVEADGIATNDKPAAGESTTFPRIKTEEY+LSKPAASPANNKKASTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQQLCPNINREENSEQEVNNSNSLELAPQQNIYSSFDGVSQVPGSNYSSVSNTGDSGSSLYTSSTNNLTTRATSCMHCNAMFPDRSLLEDHASKEHSNHAGEVVCIICPRSFTTYMAFRVHMTKSHGGPNGTSLKSHLNAASIHKANTSFEMIQELSSSLSKERPSSSSNPSNGKVFHSRHACPNCDKDFSTSQALGNHKRACMPHLYKKVNL
Sbjct:    8 LVKKYIAENKFREILPNSKKSKIDKSRIEQGQSVNNEEESGCQGDQNNPDSYSASDTGRPATNLWRAAQSNSRGNKIVLSRVYSITNQNELNINGSSNRYGRFRKRAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQKENCSPNFIKSLNNTESNGKPLLPIAPAQKADKWKLNPNPSDIEKPLLTPIKSETVVIKNVISQNDTDATFQKNMKFAEKFLNNPAITLNKGSQCVCNLCQSCFYSNNSILKHLVLHHRIAIQDGYTALSISKCESVAKLKPILNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLK--------------------DDCSGWSSSSGGTGRRVKCDICRKRFRNPLTLDEHRRLHENESCINSIVEADGIATNDKPAAGESTTFPRIKTEEYMLSKPAASPANNKKASTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQQLCPNINREENSEQEVNNSNSLELAPQQNIYSSFDGVSQVPGSNYSSVSNTGDSGSSLYTSSTNNLTTRATSCMHCNAMFPDRSLLEDHASKEHSNHAGEVVCIICPRSFTTYMAFRVHMTKSHGGPNGTSLKSHLNAASIHKANTSFEMIQELSSSLSKERPSSSSNPSNGKVFHSRHACPNCDKDFSTSQALGNHKRACMPHLYKKVNL 748          
BLAST of SMED30002896 vs. Planmine SMEST
Match: SMESG000065210.1 (SMESG000065210.1)

HSP 1 Score: 1328.92 bits (3438), Expect = 0.000e+0
Identity = 738/761 (96.98%), Postives = 741/761 (97.37%), Query Frame = 2
Query: 1025 LVKKYIAENKFREILPNSKKSKIDKSRIEQGQSVNNEEESGCQGDQNNPDSYSASDTGRPATNLWRAAQSNSRGNKIVLSRVYSITNQNELNINGSSNRYGRFRKRAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQKENCSPNFIKSLNNTESNGKPLLPIAPAQKADKWKLNPNPSDIEKPLLTPIKSETVVIKNVISQNDTDATFQKNMKFAEKFLNNPAITLNKGSQCVCNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENESCINSIVEADGIATNDKPAAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQQLCPNIXXXXXXXXXXXXXXXXXLAPQQNIYSSFDGVSQVPGSNYXXXXXXXXXXXXXXXXXXXXXXXRATSCMHCNAMFPDRSLLEDHASKEHSNHAGEVVCIICPRSFTTYMAFRVHMTKSHGGPNGTSLKSHLNAASIHKANTSFEMIQXXXXXXXXXXXXXXXXXXXGKVFHSRHACPNCDKDFSTSQALGNHKRACMPHLYKKVNL 3307
            LVKKYIAENKFREILPNSKKSKIDKSRIEQGQSVNNEEESGCQGDQNNPDSYSASDTGRPATNLWRAAQSNSRGNKIVLSRVYSITNQNELNINGSSNRYGRFRKRAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQKENCSPNFIKSLNNTESNGKPLLPIAPAQKADKWKLNPNPSDIEKPLLTPIKSETVVIKNVISQNDTDATFQKNMKFAEKFLNNPAITLNKGSQCVCNLCQSCFYSNNSILKHLVLHHRIAIQ+GYTALSISKCESVAKLKP+LNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLK                    DDCSGWSSSSGGTGRRVKCDICRKRFRNPLTLDEHRRLHENESCINSIVEADGIATNDKPAAGESTTFPRIKTEEY+LSKPAASPANNKKASTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQQLCPNINREENSEQEVNNSNSLELAPQQNIYSSFDGVSQVPGSNYSSVSNTGDSGSSLYTSSTNNLTTRATSCMHCNAMFPDRSLLEDHASKEHSNHAGEVVCIICPRSFTTYMAFRVHMTKSHGGPNGTSLKSHLNAASIHKANTSFEMIQELSSSLSKERPSSSSNPSNGKVFHSRHACPNCDKDFSTSQALGNHKRACMPHLYKKVNL
Sbjct:    5 LVKKYIAENKFREILPNSKKSKIDKSRIEQGQSVNNEEESGCQGDQNNPDSYSASDTGRPATNLWRAAQSNSRGNKIVLSRVYSITNQNELNINGSSNRYGRFRKRAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQKENCSPNFIKSLNNTESNGKPLLPIAPAQKADKWKLNPNPSDIEKPLLTPIKSETVVIKNVISQNDTDATFQKNMKFAEKFLNNPAITLNKGSQCVCNLCQSCFYSNNSILKHLVLHHRIAIQDGYTALSISKCESVAKLKPILNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLK--------------------DDCSGWSSSSGGTGRRVKCDICRKRFRNPLTLDEHRRLHENESCINSIVEADGIATNDKPAAGESTTFPRIKTEEYMLSKPAASPANNKKASTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQQLCPNINREENSEQEVNNSNSLELAPQQNIYSSFDGVSQVPGSNYSSVSNTGDSGSSLYTSSTNNLTTRATSCMHCNAMFPDRSLLEDHASKEHSNHAGEVVCIICPRSFTTYMAFRVHMTKSHGGPNGTSLKSHLNAASIHKANTSFEMIQELSSSLSKERPSSSSNPSNGKVFHSRHACPNCDKDFSTSQALGNHKRACMPHLYKKVNL 745          
BLAST of SMED30002896 vs. Planmine SMEST
Match: SMESG000065210.1 (SMESG000065210.1)

HSP 1 Score: 1321.99 bits (3420), Expect = 0.000e+0
Identity = 738/771 (95.72%), Postives = 741/771 (96.11%), Query Frame = 2
Query: 1025 LVKKYIAENKFREILPNSKKSKIDKSRIEQGQSVNNEEESGCQGDQNNPDSYSASDTGRPATNLWRAAQSNSRGNKIVLSRVYSITNQNELNINGSSNRYGRFRKRAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQKENCSPNFIKSLNNT----------ESNGKPLLPIAPAQKADKWKLNPNPSDIEKPLLTPIKSETVVIKNVISQNDTDATFQKNMKFAEKFLNNPAITLNKGSQCVCNLCQSCFYSNNSILKHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLKFVCSDCGMSFHDNKSLILHRDDCXXXXXXXXXXXRRVKCDICRKRFRNPLTLDEHRRLHENESCINSIVEADGIATNDKPAAGESTTFPRIKTEEYILXXXXXXXXXXXXXXTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQQLCPNIXXXXXXXXXXXXXXXXXLAPQQNIYSSFDGVSQVPGSNYXXXXXXXXXXXXXXXXXXXXXXXRATSCMHCNAMFPDRSLLEDHASKEHSNHAGEVVCIICPRSFTTYMAFRVHMTKSHGGPNGTSLKSHLNAASIHKANTSFEMIQXXXXXXXXXXXXXXXXXXXGKVFHSRHACPNCDKDFSTSQALGNHKRACMPHLYKKVNL 3307
            LVKKYIAENKFREILPNSKKSKIDKSRIEQGQSVNNEEESGCQGDQNNPDSYSASDTGRPATNLWRAAQSNSRGNKIVLSRVYSITNQNELNINGSSNRYGRFRKRAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQKENCSPNFIKSLNNT          ESNGKPLLPIAPAQKADKWKLNPNPSDIEKPLLTPIKSETVVIKNVISQNDTDATFQKNMKFAEKFLNNPAITLNKGSQCVCNLCQSCFYSNNSILKHLVLHHRIAIQ+GYTALSISKCESVAKLKP+LNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLK                    DDCSGWSSSSGGTGRRVKCDICRKRFRNPLTLDEHRRLHENESCINSIVEADGIATNDKPAAGESTTFPRIKTEEY+LSKPAASPANNKKASTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQQLCPNINREENSEQEVNNSNSLELAPQQNIYSSFDGVSQVPGSNYSSVSNTGDSGSSLYTSSTNNLTTRATSCMHCNAMFPDRSLLEDHASKEHSNHAGEVVCIICPRSFTTYMAFRVHMTKSHGGPNGTSLKSHLNAASIHKANTSFEMIQELSSSLSKERPSSSSNPSNGKVFHSRHACPNCDKDFSTSQALGNHKRACMPHLYKKVNL
Sbjct:    8 LVKKYIAENKFREILPNSKKSKIDKSRIEQGQSVNNEEESGCQGDQNNPDSYSASDTGRPATNLWRAAQSNSRGNKIVLSRVYSITNQNELNINGSSNRYGRFRKRAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQKENCSPNFIKSLNNTVLNNNSFIATESNGKPLLPIAPAQKADKWKLNPNPSDIEKPLLTPIKSETVVIKNVISQNDTDATFQKNMKFAEKFLNNPAITLNKGSQCVCNLCQSCFYSNNSILKHLVLHHRIAIQDGYTALSISKCESVAKLKPILNETVNDLSTATAKPILHFIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNTLK--------------------DDCSGWSSSSGGTGRRVKCDICRKRFRNPLTLDEHRRLHENESCINSIVEADGIATNDKPAAGESTTFPRIKTEEYMLSKPAASPANNKKASTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLSNHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQQLCPNINREENSEQEVNNSNSLELAPQQNIYSSFDGVSQVPGSNYSSVSNTGDSGSSLYTSSTNNLTTRATSCMHCNAMFPDRSLLEDHASKEHSNHAGEVVCIICPRSFTTYMAFRVHMTKSHGGPNGTSLKSHLNAASIHKANTSFEMIQELSSSLSKERPSSSSNPSNGKVFHSRHACPNCDKDFSTSQALGNHKRACMPHLYKKVNL 758          
BLAST of SMED30002896 vs. Planmine SMEST
Match: SMESG000065225.1 (SMESG000065225.1)

HSP 1 Score: 747.273 bits (1928), Expect = 0.000e+0
Identity = 359/362 (99.17%), Postives = 360/362 (99.45%), Query Frame = 2
Query:  458 VFRNQMSNDDLSIETDDIFQDEEVNCVFCGKLFPSIEKVQEHITDKHESSEAHTETIDVKQEPNFESKLTKIYDLNTEPVPHRMVDFNNVVQCSKCELSFVHAYASRMHFEKVHLIRKRKRSSNPNGVEGIIVSPNGSDNWGCDICGRQFPTLKQAKVHKFKSHIEPVQKKKLMLHRNIIRKSNSSQRNLVKKYIAENKFREILPNSKKSKIDKSRIEQGQSVNNEEESGCQGDQNNPDSYSASDTGRPATNLWRAAQSNSRGNKIVLSRVYSITNQNELNINGSSNRYGRFRKRAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQKENCSPNFIKSLNNTESN 1543
            +FRNQMSNDDLSIETDDIFQDEEVNCVFCGKLFPSIEKVQEHITDKHESSEAHTETIDVKQEPNFESKLTKIYDLNTEPVPHRMVDFNNVVQCSKCELSFVHAYASRMHFEKVHLIRKRKRSSNPNGVEGIIVSPNGSDNWGCDICGRQFPTLKQAKVHKFKSHIEPVQKKKLMLHRNIIRKSNSSQRNLVKKYIAENKFREILPNSKKSKIDKSRIEQGQSVNNEEESGCQGDQNNPDSYSASDTGRPATNLWRAAQSNSRGNKIVLSRVYSITNQNELNINGSSNRYGRFRKRAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQKENCSPNFIKSLNNT  N
Sbjct:   92 IFRNQMSNDDLSIETDDIFQDEEVNCVFCGKLFPSIEKVQEHITDKHESSEAHTETIDVKQEPNFESKLTKIYDLNTEPVPHRMVDFNNVVQCSKCELSFVHAYASRMHFEKVHLIRKRKRSSNPNGVEGIIVSPNGSDNWGCDICGRQFPTLKQAKVHKFKSHIEPVQKKKLMLHRNIIRKSNSSQRNLVKKYIAENKFREILPNSKKSKIDKSRIEQGQSVNNEEESGCQGDQNNPDSYSASDTGRPATNLWRAAQSNSRGNKIVLSRVYSITNQNELNINGSSNRYGRFRKRAFVCFYCQSIFLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQKENCSPNFIKSLNNTGEN 453          
BLAST of SMED30002896 vs. Planmine SMEST
Match: SMESG000065211.1 (SMESG000065211.1)

HSP 1 Score: 256.144 bits (653), Expect = 4.053e-79
Identity = 122/122 (100.00%), Postives = 122/122 (100.00%), Query Frame = 2
Query:  473 MSNDDLSIETDDIFQDEEVNCVFCGKLFPSIEKVQEHITDKHESSEAHTETIDVKQEPNFESKLTKIYDLNTEPVPHRMVDFNNVVQCSKCELSFVHAYASRMHFEKVHLIRKRKRSSNPNG 838
            MSNDDLSIETDDIFQDEEVNCVFCGKLFPSIEKVQEHITDKHESSEAHTETIDVKQEPNFESKLTKIYDLNTEPVPHRMVDFNNVVQCSKCELSFVHAYASRMHFEKVHLIRKRKRSSNPNG
Sbjct:    1 MSNDDLSIETDDIFQDEEVNCVFCGKLFPSIEKVQEHITDKHESSEAHTETIDVKQEPNFESKLTKIYDLNTEPVPHRMVDFNNVVQCSKCELSFVHAYASRMHFEKVHLIRKRKRSSNPNG 122          
The following BLAST results are available for this feature:
BLAST of SMED30002896 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZNF916.109e-1120.94zinc finger protein 91 [Source:HGNC Symbol;Acc:HGN... [more]
ZNF916.480e-1120.94zinc finger protein 91 [Source:HGNC Symbol;Acc:HGN... [more]
ZNF4186.725e-1123.78zinc finger protein 418 [Source:HGNC Symbol;Acc:HG... [more]
ZNF4187.923e-1123.78zinc finger protein 418 [Source:HGNC Symbol;Acc:HG... [more]
ZNF4188.594e-1123.78zinc finger protein 418 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of SMED30002896 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002896 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002896 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-367f21.51.772e-1221.79si:ch73-367f21.5 [Source:ZFIN;Acc:ZDB-GENE-120214-... [more]
si:ch73-367f21.42.375e-1223.20si:ch73-367f21.4 [Source:ZFIN;Acc:ZDB-GENE-120214-... [more]
si:ch73-367f21.42.728e-1223.20si:ch73-367f21.4 [Source:ZFIN;Acc:ZDB-GENE-120214-... [more]
si:ch73-367f21.66.802e-1121.38si:ch73-367f21.6 [Source:ZFIN;Acc:ZDB-GENE-120214-... [more]
BX000702.24.618e-1020.65pep chromosome:GRCz11:CHR_ALT_CTG3_1_29:62283301:6... [more]
back to top
BLAST of SMED30002896 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000036778.17.189e-1022.32pep primary_assembly:Xenopus_tropicalis_v9.1:9:757... [more]
stk313.677e-922.49serine/threonine kinase 31 [Source:Xenbase;Acc:XB-... [more]
ENSXETT00000031742.13.692e-921.36zinc finger protein Xfin-like [Source:NCBI gene;Ac... [more]
ENSXETT00000051712.16.756e-922.33pep primary_assembly:Xenopus_tropicalis_v9.1:KV460... [more]
astn12.393e-820.04astrotactin 1 [Source:Xenbase;Acc:XB-GENE-979962][more]
back to top
BLAST of SMED30002896 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zfp6582.285e-1021.85zinc finger protein 658 [Source:MGI Symbol;Acc:MGI... [more]
Zfp6582.285e-1021.85zinc finger protein 658 [Source:MGI Symbol;Acc:MGI... [more]
Zfp7481.785e-920.79zinc finger protein 748 [Source:MGI Symbol;Acc:MGI... [more]
Zfp729a3.676e-921.66zinc finger protein 729a [Source:MGI Symbol;Acc:MG... [more]
Zkscan81.212e-822.14zinc finger with KRAB and SCAN domains 8 [Source:M... [more]
back to top
BLAST of SMED30002896 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q05481|ZNF91_HUMAN2.934e-1020.94Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=... [more]
sp|Q8TF45|ZN418_HUMAN4.127e-1023.78Zinc finger protein 418 OS=Homo sapiens OX=9606 GN... [more]
sp|A6NN14|ZN729_HUMAN4.540e-920.20Zinc finger protein 729 OS=Homo sapiens OX=9606 GN... [more]
sp|O43345|ZN208_HUMAN2.316e-820.80Zinc finger protein 208 OS=Homo sapiens OX=9606 GN... [more]
sp|Q8NB50|ZFP62_HUMAN2.766e-821.72Zinc finger protein 62 homolog OS=Homo sapiens OX=... [more]
back to top
BLAST of SMED30002896 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3N0XSA91.993e-1021.66Zinc finger protein 208 OS=Anabarilius grahami OX=... [more]
A0A087XCR81.136e-821.62Uncharacterized protein OS=Poecilia formosa OX=486... [more]
A0A3B5AI151.440e-820.94Uncharacterized protein OS=Stegastes partitus OX=1... [more]
A0A3Q2FR181.798e-822.38Uncharacterized protein OS=Cyprinodon variegatus O... [more]
A0A3Q0SPH51.836e-822.84Uncharacterized protein OS=Amphilophus citrinellus... [more]
back to top
BLAST of SMED30002896 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000036835.11.966e-1022.33oocyte zinc finger protein XlCOF6-like [Source:NCB... [more]
ENSAMXT00000047138.11.966e-1022.33oocyte zinc finger protein XlCOF6-like [Source:NCB... [more]
ENSAMXT00000049921.13.379e-919.12pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000053921.16.429e-825.09pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000048831.18.243e-819.29zinc finger protein 883-like [Source:NCBI gene;Acc... [more]
back to top
BLAST of SMED30002896 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000002487.16.352e-823.69pep scaffold:Pmarinus_7.0:GL476414:876407:883640:1... [more]
prdm57.098e-621.94PR domain containing 5 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of SMED30002896 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002896 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO369581.815e-822.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488391.875e-623.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421273.645e-625.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30002896 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000012557.22.649e-825.16GDNF-inducible zinc finger protein 1 [Source:NCBI ... [more]
ENSORLT00000039104.12.952e-822.66pep primary_assembly:ASM223467v1:17:11164388:11168... [more]
znf6461.196e-720.49zinc finger protein 62 homolog [Source:NCBI gene;A... [more]
ENSORLT00000045028.11.359e-719.77pep primary_assembly:ASM223467v1:17:11266576:11351... [more]
ENSORLT00000023037.21.439e-722.65pep primary_assembly:ASM223467v1:2:6315167:6498304... [more]
back to top
BLAST of SMED30002896 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065210.10.000e+096.98SMESG000065210.1[more]
SMESG000065210.10.000e+096.98SMESG000065210.1[more]
SMESG000065210.10.000e+095.72SMESG000065210.1[more]
SMESG000065225.10.000e+099.17SMESG000065225.1[more]
SMESG000065211.14.053e-79100.00SMESG000065211.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002896 ID=SMED30002896|Name=SMED30002896|organism=Schmidtea mediterranea sexual|type=transcript|length=3983bp
CGAACTTAAGGTTACAAGTAATTACTAGAAGGTTGTTGCCAAATGTTACA
GGAAACCTACTAAGCTAGCTCTTAAATCAACTAAGAAAGGTTGCAACTAA
AATCAATATAATGATTAACTGAATGAGACATGCATCCGATATGTGAAAAG
ACGCCCGACAAGAAGCATGGTTGATTCTCTGCCTAACTGACTGGATTTCT
AGTAGGTCAAAACGGCATGCATGCCTTAAATATACTCCTCTACCCCTGTA
CATTGAATTTTCTTCCTGCTACCCAAGTCTTAGTTAATCAATGATAAGAT
GGTGTAGGCAGAGAGGAAAAGGTTTGCTTATTTCTGGTGAATGAATATAA
TTATTAAAGCTTCGTTACTAAGTTAGTTAAATTTTATCACAACACTAATT
GTTGGATGATATTTTCTTCAGAGGGAATCAGCAGTTTACATTGACAAACA
TATCTAAGTTTTTAGAAATCAAATGAGTAACGACGATTTGAGCATTGAAA
CTGATGATATTTTTCAAGACGAAGAAGTTAACTGTGTATTTTGCGGGAAA
TTGTTTCCATCGATTGAGAAAGTCCAAGAACACATTACTGACAAACACGA
GTCATCGGAAGCTCACACAGAGACTATTGATGTTAAACAAGAACCGAACT
TTGAAAGCAAGCTAACGAAAATTTACGATCTCAACACAGAACCGGTGCCG
CATCGGATGGTGGATTTTAATAATGTTGTTCAATGTTCGAAATGTGAATT
ATCATTCGTCCATGCGTACGCGTCTAGAATGCACTTTGAGAAAGTCCATT
TAATTCGAAAACGAAAACGATCTTCCAATCCAAATGGTGTAGAGGGTATC
ATAGTCAGTCCAAATGGTTCAGATAATTGGGGTTGCGACATTTGTGGCCG
TCAGTTTCCGACACTGAAGCAAGCCAAGGTCCACAAGTTCAAATCACACA
TTGAACCAGTTCAGAAAAAAAAATTGATGCTCCATAGAAATATTATTCGA
AAGTCCAACTCTTCTCAGCGTAATTTAGTGAAAAAATATATCGCGGAAAA
TAAGTTTCGTGAAATTCTACCCAACTCAAAGAAATCGAAAATCGATAAAT
CCCGCATTGAACAAGGCCAGTCTGTGAACAATGAGGAGGAGAGTGGTTGC
CAAGGAGACCAGAATAATCCAGACTCCTATTCTGCCAGCGATACTGGTAG
ACCAGCAACTAATCTGTGGCGTGCAGCTCAATCCAACAGTCGGGGAAATA
AGATCGTTCTATCAAGAGTTTACTCCATCACAAACCAGAATGAGCTCAAT
ATCAATGGCTCGAGCAATAGATACGGCCGCTTCCGTAAACGGGCTTTTGT
ATGTTTCTATTGTCAGTCAATTTTCCTCAACAGGGAAGGCTTCAAGCGCC
ACTTGCTCATGCACAGGAAAAATGAAAGTTTCAAATGTGTTAATTGCGAT
TTGAAATTCATCAGGTTAAAAATGCTCAAGCAGCACCAAAAGGAAAATTG
TAGTCCGAATTTTATCAAATCCCTTAACAATACAGAATCCAATGGAAAAC
CTCTCCTACCAATAGCACCAGCCCAAAAAGCCGACAAATGGAAACTCAAC
CCCAACCCATCTGATATAGAAAAACCCCTCTTAACTCCAATAAAATCTGA
AACTGTAGTTATAAAAAATGTAATCTCTCAAAATGATACTGATGCGACTT
TCCAAAAGAACATGAAATTCGCAGAAAAGTTTCTCAACAACCCTGCAATC
ACTTTAAATAAAGGAAGTCAATGCGTTTGTAATTTGTGTCAAAGTTGTTT
CTACTCTAACAACAGCATCCTTAAGCACTTGGTGCTTCATCACCGGATAG
CAATTCAGGAGGGGTATACTGCTCTCTCAATTTCTAAATGCGAATCCGTT
GCAAAGCTGAAACCTTTATTAAACGAGACTGTAAATGATTTGAGTACCGC
TACAGCAAAACCAATCCTGCATTTTATTCACAACTGTGAGCATTGTAGCA
GTCAATTTGCTTCTAAAAAAGGTTTACAAAGGCACCTTCATTCCGTTCAT
GTTGATCAAGGAATTGATGTAAAATACGATTCGGGAGTGGATTTGTCAAA
AAAGTCATTGGATGATAATACACTAAAGTTCGTTTGTTCTGATTGTGGAA
TGAGTTTTCATGATAATAAATCATTGATACTTCATAGAGATGATTGTTCT
GGTTGGTCGTCTTCATCAGGTGGAACAGGGCGACGTGTTAAATGTGATAT
TTGCAGGAAGCGCTTTAGGAACCCTTTGACACTCGATGAACACAGGCGAT
TGCACGAAAACGAATCTTGTATTAATTCAATCGTAGAAGCGGACGGAATA
GCAACCAATGACAAACCTGCCGCGGGAGAAAGCACAACTTTCCCCCGTAT
CAAGACTGAAGAATATATATTATCTAAACCTGCAGCAAGTCCAGCAAATA
ATAAAAAAGCATCAACTTACTCCATACCAACTTATAAGAAAGCTAAAGTT
CCGCCAAATGCTGATGGGCTTTTTGAGTGTGATGAATGTCATAAAACATT
CACATGCCGAAGTTCGTTAAGCAATCATGTCAAATCGCATTTCAATTTTA
AAAATAAACCATTCTCATGTTCAGCTTGCAATCAAGGTTTCATGTCTACA
CTCACCCTCCAATATCATCGTCAGCAGCTATGCCCGAACATCAATCGTGA
AGAAAACAGCGAGCAAGAAGTGAATAACTCTAATTCTCTAGAATTAGCCC
CTCAACAGAATATTTATTCAAGTTTTGATGGGGTATCTCAAGTTCCTGGT
AGCAATTACTCATCGGTTTCAAATACAGGAGACTCTGGTTCTTCTTTATA
TACATCTAGTACTAATAATCTAACAACCAGAGCGACTAGTTGCATGCATT
GCAATGCAATGTTTCCTGACAGATCTCTTCTCGAGGATCATGCTAGTAAG
GAACACTCAAACCATGCTGGTGAAGTCGTTTGCATTATTTGTCCAAGATC
ATTTACTACCTACATGGCGTTTCGTGTGCATATGACAAAGTCACATGGTG
GTCCAAATGGCACATCCCTCAAAAGTCATTTAAATGCTGCCAGTATACAC
AAAGCAAATACTAGTTTTGAAATGATCCAAGAACTATCTTCTTCCTTAAG
CAAAGAACGGCCTAGTTCTTCATCAAACCCTTCAAACGGCAAAGTGTTTC
ATTCAAGACACGCTTGTCCCAATTGTGATAAGGATTTCAGTACATCCCAA
GCTCTGGGTAATCATAAAAGAGCTTGCATGCCTCATTTGTATAAGAAAGT
CAATCTGTAATATTTTGTGTTATTTATTCTTGTATATTAATTGACCATTT
ATTAACTCTGTACCGATAATTGACTGAGAATTTGTATGAAACTGTTTAGG
TTTCATGTATATCAATTGCTATTAATGATAAAATTGGCGTAGATGTGTTT
CGTATTTCTCAATTCTTTTCCCTTCGACTTCATTTTAGATACCATCAAAG
CATTTTCTTGACTTTTCTTTCTTCCGTTACTCATATTTGTGTTATCAGTT
TTTGTAATATGATTCAGATTCTCTTTTTATTTTTGACTGCCTCCATGACT
AGGAGTTGTTTTAATGGAACTGCTATCTTGTTTTTGTCTCAATTTCCGAA
TTTATTATTTGTTTATTTAGTTTGTTTAAATCATTACGATCAATTTCTGT
TTTCAAAACAATTTGTTGACTGAATTTTATTTTTATTGTTGTAATGGCAT
TTATTAGGTTCCATTTGGCATTTATTCTGGATAGGCAGGCTGAATGGAAT
AGACTTGGTTGGTATGATGTTGGATCAGCAATAGGGTATTGTTTGAGCGG
TTTGGTTTTTGATCTACGCTTTTTAAGCATCAGTTATTAGTGAGATTTCC
TTCTGTAATAAGATCAGCCTAAGTTGTCACTAGTGATGGTGAATTATATA
TGAAATCATTGATATGTTGAATGTTTTAGCAAG
back to top

protein sequence of SMED30002896-orf-1

>SMED30002896-orf-1 ID=SMED30002896-orf-1|Name=SMED30002896-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=946bp
MSNDDLSIETDDIFQDEEVNCVFCGKLFPSIEKVQEHITDKHESSEAHTE
TIDVKQEPNFESKLTKIYDLNTEPVPHRMVDFNNVVQCSKCELSFVHAYA
SRMHFEKVHLIRKRKRSSNPNGVEGIIVSPNGSDNWGCDICGRQFPTLKQ
AKVHKFKSHIEPVQKKKLMLHRNIIRKSNSSQRNLVKKYIAENKFREILP
NSKKSKIDKSRIEQGQSVNNEEESGCQGDQNNPDSYSASDTGRPATNLWR
AAQSNSRGNKIVLSRVYSITNQNELNINGSSNRYGRFRKRAFVCFYCQSI
FLNREGFKRHLLMHRKNESFKCVNCDLKFIRLKMLKQHQKENCSPNFIKS
LNNTESNGKPLLPIAPAQKADKWKLNPNPSDIEKPLLTPIKSETVVIKNV
ISQNDTDATFQKNMKFAEKFLNNPAITLNKGSQCVCNLCQSCFYSNNSIL
KHLVLHHRIAIQEGYTALSISKCESVAKLKPLLNETVNDLSTATAKPILH
FIHNCEHCSSQFASKKGLQRHLHSVHVDQGIDVKYDSGVDLSKKSLDDNT
LKFVCSDCGMSFHDNKSLILHRDDCSGWSSSSGGTGRRVKCDICRKRFRN
PLTLDEHRRLHENESCINSIVEADGIATNDKPAAGESTTFPRIKTEEYIL
SKPAASPANNKKASTYSIPTYKKAKVPPNADGLFECDECHKTFTCRSSLS
NHVKSHFNFKNKPFSCSACNQGFMSTLTLQYHRQQLCPNINREENSEQEV
NNSNSLELAPQQNIYSSFDGVSQVPGSNYSSVSNTGDSGSSLYTSSTNNL
TTRATSCMHCNAMFPDRSLLEDHASKEHSNHAGEVVCIICPRSFTTYMAF
RVHMTKSHGGPNGTSLKSHLNAASIHKANTSFEMIQELSSSLSKERPSSS
SNPSNGKVFHSRHACPNCDKDFSTSQALGNHKRACMPHLYKKVNL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036236Znf_C2H2_sf
IPR015880Znf_C2H2-like
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 19..42
e-value: 0.47
score: 19.5
coord: 913..938
e-value: 38.0
score: 8.2
coord: 136..159
e-value: 2.5
score: 17.1
coord: 714..734
e-value: 68.0
score: 5.9
coord: 589..611
e-value: 0.011
score: 25.0
coord: 805..828
e-value: 1.0
score: 18.4
coord: 684..706
e-value: 0.015
score: 24.5
coord: 434..456
e-value: 9.9
score: 13.3
coord: 320..340
e-value: 72.0
score: 5.7
coord: 835..858
e-value: 0.012
score: 24.7
coord: 503..526
e-value: 0.091
score: 21.9
coord: 86..109
e-value: 8.7
score: 13.8
coord: 292..314
e-value: 0.11
score: 21.5
coord: 553..573
e-value: 33.0
score: 8.7
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 88..109
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 21..42
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 294..314
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 807..828
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 837..858
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 686..706
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 591..611
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 505..526
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 138..159
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 913..943
score: 9.951
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 589..616
score: 10.616
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 684..711
score: 12.591
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 503..531
score: 9.785
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 269..343
e-value: 7.3E-8
score: 34.4
coord: 532..616
e-value: 1.2E-8
score: 36.9
coord: 782..860
e-value: 6.4E-7
score: 31.3
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 679..751
e-value: 9.5E-10
score: 40.5
NoneNo IPR availablePFAMPF13912zf-C2H2_6coord: 912..933
e-value: 8.6E-4
score: 19.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 212..241
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 205..241
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 886..908
NoneNo IPR availablePANTHERPTHR24379:SF67BLOODY FINGERS-RELATEDcoord: 588..859
coord: 289..614
coord: 16..341
NoneNo IPR availablePANTHERPTHR24379FAMILY NOT NAMEDcoord: 588..859
NoneNo IPR availablePANTHERPTHR24379FAMILY NOT NAMEDcoord: 289..614
coord: 16..341
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 553..611
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 290..340
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 681..732