SMED30002882

Overview
NameSMED30002882
Smed IDSMED30002882
Length (bp)3665
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30002882 (SMED30002882) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30002882 (SMED30002882) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30002882 (SMED30002882) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30002882 (SMED30002882) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002882

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30002882SMESG000069367.1 SmedASXL_011482SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30002882SMESG000069367.1 dd_Smed_v4_11838_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30002882SMESG000069367.1 dd_Smed_v4_11838_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30002882SMESG000069367.1 dd_Smed_v4_11838_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30002882SMESG000069367.1 dd_Smed_v4_11838_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30002882SMESG000069367.1 dd_Smed_v4_9233_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30002882SMESG000069367.1 dd_Smed_v4_9233_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30002882SMESG000069367.1 dd_Smed_v6_9233_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30002882SMESG000069367.1 dd_Smed_v6_11838_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30002882SMESG000069367.1 dd_Smed_v4_11838_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30002882SMESG000069367.1 dd_Smed_v4_11838_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002882SMESG000069367.1 dd_Smed_v4_9233_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30002882SMESG000069367.1 dd_Smed_v4_9233_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30002882SMESG000069367.1 dd_Smed_v4_9233_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30002882 vs. Ensembl Xenopus
Match: PPP1R12A (protein phosphatase 1 regulatory subunit 12A [Source:NCBI gene;Acc:100493563])

HSP 1 Score: 51.9878 bits (123), Expect = 8.644e-6
Identity = 29/73 (39.73%), Postives = 45/73 (61.64%), Query Frame = 1
Query: 1777 EIIKHLESIIVDINYKSLDGLTILHYAVLNNNLPAVKFLIEHCEAGSDILDRNGNSSIQLANMNDFDEIVDYL 1995
            E++K L+    DINY ++DGLT LH A +++N+  VKFL+EH  AG +  D  G   +  A+   + +I +YL
Sbjct:   55 EVLKLLDRG-ADINYANVDGLTALHQACIDDNIDMVKFLVEHG-AGINQPDNEGWIPLHAASSCGYLDIAEYL 125          
BLAST of SMED30002882 vs. Ensembl Xenopus
Match: PPP1R12A (protein phosphatase 1 regulatory subunit 12A [Source:NCBI gene;Acc:100493563])

HSP 1 Score: 51.6026 bits (122), Expect = 8.952e-6
Identity = 29/73 (39.73%), Postives = 45/73 (61.64%), Query Frame = 1
Query: 1777 EIIKHLESIIVDINYKSLDGLTILHYAVLNNNLPAVKFLIEHCEAGSDILDRNGNSSIQLANMNDFDEIVDYL 1995
            E++K L+    DINY ++DGLT LH A +++N+  VKFL+EH  AG +  D  G   +  A+   + +I +YL
Sbjct:   55 EVLKLLDRG-ADINYANVDGLTALHQACIDDNIDMVKFLVEHG-AGINQPDNEGWIPLHAASSCGYLDIAEYL 125          
BLAST of SMED30002882 vs. Ensembl Mouse
Match: Pkd1 (polycystin 1, transient receptor poteintial channel interacting [Source:MGI Symbol;Acc:MGI:97603])

HSP 1 Score: 57.3806 bits (137), Expect = 1.320e-7
Identity = 34/109 (31.19%), Postives = 51/109 (46.79%), Query Frame = 1
Query:  814 NKDSNFSYEIEIKTADKENSEKNIKVLIQLYGETNNMKEPICLNHISTDQTDLNLFRPGNLDKFLLGIQYFIGSIINVKIGLENEGT--LWNLDYLCVRDIQSEKDYFF 1134
             K   F YEI +KT     S     V I LYGE N         H+  D+     F   +LD F +   + +GS+  +++  +N+G    W L ++ VRD+QS +  FF
Sbjct:  769 GKGGRFKYEILVKTGWSRGSGTTAHVGIMLYGEDNRSGH----RHLDGDRA----FHRNSLDIFQIATPHSLGSVWKIRVWHDNKGLSPAWFLQHIIVRDLQSARSTFF 869          
BLAST of SMED30002882 vs. Ensembl Mouse
Match: Pkd1 (polycystin 1, transient receptor poteintial channel interacting [Source:MGI Symbol;Acc:MGI:97603])

HSP 1 Score: 52.373 bits (124), Expect = 4.681e-6
Identity = 34/108 (31.48%), Postives = 51/108 (47.22%), Query Frame = 1
Query:  817 KDSNFSYEIEIKTADKENSEKNIKVLIQLYGETNNMKEPICLNHISTDQTDLNLFRPGNLDKFLLGIQYFIGSIINVKIGLENEG--TLWNLDYLCVRDIQSEKDYFF 1134
            K   F YEI +KT     S     V I LYGE N         H+  D+     F   +LD F +   + +GS+  +++  +N+G    W L ++ VRD+QS +  FF
Sbjct: 3106 KGGRFKYEILVKTGWSRGSGTTAHVGIMLYGEDNRSGH----RHLDGDRA----FHRNSLDIFQIATPHSLGSVWKIRVWHDNKGLSPAWFLQHIIVRDLQSARSTFF 3205          
BLAST of SMED30002882 vs. TrEMBL
Match: gnl|BL_ORD_ID|17513681 (tr|A7SB31|A7SB31_NEMVE Predicted protein (Fragment) OS=Nematostella vectensis OX=45351 GN=v1g13526 PE=4 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 1.411e-7
Identity = 60/209 (28.71%), Postives = 92/209 (44.02%), Query Frame = 1
Query:  706 ESENF------GTLSQLSLEKSVLCSICSPKEQTESHKKENNNKDSNFSYEIEIKTADKENSEKNIKVLIQLYGETNNMKEPICLNHISTDQTDLNLFRPGNLDKFLLGIQYFIGSIINVKIGLENEGT--LWNLDYLCVRDIQSEKDYFFSCRRCLGTDSPDKLTQITLGYTPPYKILKHDSLSKSNTESIENKRSEESILDFEKDNI 1308
            ES N+      GT+  + L   VL      K++ +     +  KD + SYE+ I T    NS     V + + GE N   + I + H   D  +  LF  GN D+F++ +   +G ++ VKI  +NEG    W L  + V    SE  Y F C R L  D  D +   TL  TP Y +            +++   +E+S  DF  D++
Sbjct:   76 ESRNYSVIATVGTVLMVYLFVVVLARRADRKDRKKVRASLSQAKDDHASYEVTIATDIWINSGTTADVALIVCGE-NATSDVIVIRH--ADFPNRILFARGNNDRFIIHVPTPLGKLLRVKIWHDNEGNSPAWLLRSVTVHATNSEDRYVFPCNRWLAVDKDDGMLDCTL--TPHYGL-----------SALKTSFAEKSANDFADDHL 268          
BLAST of SMED30002882 vs. TrEMBL
Match: gnl|BL_ORD_ID|23443748 (tr|A0A2B4STF0|A0A2B4STF0_STYPI Polycystic kidney disease protein 1-like 2 OS=Stylophora pistillata OX=50429 GN=Pkd1l2 PE=4 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 5.711e-6
Identity = 37/119 (31.09%), Postives = 58/119 (48.74%), Query Frame = 1
Query:  829 FSYEIEIKTADKENSEKNIKVLIQLYG-----ETNNMKEPICLNHISTDQTDLNLFRPGNLDKFLLGIQYFIGSIINVKIGLENEGTLWNLDYLCVRDIQSEKDYFFSCRRCLGTDSPD 1170
            + YE+ + T  + N+    KV I LYG     E   + +P           D N F+ G+ D FLL   + +GSI  +++  +N G  W L  + V D+Q+E+ ++F C R L  D  D
Sbjct: 1860 YRYEVTLWTGMRRNAGTKSKVSIILYGDEEDSEARALHDP-----------DRNPFQRGSQDSFLLTTPFDLGSIQYIRVWHDNAGGSWFLSRIMVIDLQTEERFYFICNRWLAVDEED 1967          
BLAST of SMED30002882 vs. TrEMBL
Match: gnl|BL_ORD_ID|23499596 (tr|A0A210Q5A4|A0A210Q5A4_MIZYE Protein phosphatase 1 regulatory subunit 12A OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT06631 PE=4 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 5.719e-6
Identity = 47/130 (36.15%), Postives = 65/130 (50.00%), Query Frame = 1
Query: 1633 AAIRYHDVLTVKRLCNSDNKRIVSDA---------DENGCSPIHLAGIYYEDKEECREIIKHLESIIVDINYKSLDGLTILHYAVLNNNLPAVKFLIEHCEAGSDILDRNGNSSIQLANMNDFDEIVDYL 1995
            A +R HD L  KR   SD  R  SD+          ++GC  + LA     D   C E+++ LE    DIN  ++DGLT LH A +++NL  V+FL+EH  A  D+ D  G + +       F EI  YL
Sbjct:    9 ALLRRHDQL--KRWEESDTNR-ASDSLSSHNRKVKFQDGC--VFLAACSSGD---CEEVLRMLEKN-ADINTANIDGLTALHQACIDDNLDMVEFLVEHS-ADVDVCDNEGWTPLHATASCGFTEIARYL 128          
BLAST of SMED30002882 vs. Ensembl Cavefish
Match: loxhd1b (lipoxygenase homology domains 1b [Source:ZFIN;Acc:ZDB-GENE-081104-370])

HSP 1 Score: 51.2174 bits (121), Expect = 8.028e-6
Identity = 36/122 (29.51%), Postives = 57/122 (46.72%), Query Frame = 1
Query:  832 SYEIEIKTADKENSEKNIKVLIQLYGETNNMKEPICLNHISTDQTDLNLFRPGNLDKFLLGIQYFIGSIINVKIGLENE--GTLWNLDYLCVRDIQSEKDYFFSCRRCLGTDSPDKLTQITL 1191
            + EI ++T D   +  +  V + +YG+  +  E      +S  +T  N F  G +DKF +     +G I  +K+  +N   G  W LD + V DI +E+ Y F C R L     DK  + T 
Sbjct: 1441 ALEISVRTGDMHGAGTDANVFLTMYGDLGDTGE----RKLSKSETGKNKFERGAVDKFSIE-AVDLGQIFKIKVRHDNSMLGADWYLDQVEVVDIDTEEVYMFLCERWLSKKKEDKRIERTF 1557          
BLAST of SMED30002882 vs. Ensembl Nematostella
Match: EDO39107 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB31])

HSP 1 Score: 66.2402 bits (160), Expect = 1.951e-11
Identity = 60/209 (28.71%), Postives = 92/209 (44.02%), Query Frame = 1
Query:  706 ESENF------GTLSQLSLEKSVLCSICSPKEQTESHKKENNNKDSNFSYEIEIKTADKENSEKNIKVLIQLYGETNNMKEPICLNHISTDQTDLNLFRPGNLDKFLLGIQYFIGSIINVKIGLENEGT--LWNLDYLCVRDIQSEKDYFFSCRRCLGTDSPDKLTQITLGYTPPYKILKHDSLSKSNTESIENKRSEESILDFEKDNI 1308
            ES N+      GT+  + L   VL      K++ +     +  KD + SYE+ I T    NS     V + + GE N   + I + H   D  +  LF  GN D+F++ +   +G ++ VKI  +NEG    W L  + V    SE  Y F C R L  D  D +   TL  TP Y +            +++   +E+S  DF  D++
Sbjct:   76 ESRNYSVIATVGTVLMVYLFVVVLARRADRKDRKKVRASLSQAKDDHASYEVTIATDIWINSGTTADVALIVCGE-NATSDVIVIRH--ADFPNRILFARGNNDRFIIHVPTPLGKLLRVKIWHDNEGNSPAWLLRSVTVHATNSEDRYVFPCNRWLAVDKDDGMLDCTL--TPHYGL-----------SALKTSFAEKSANDFADDHL 268          
BLAST of SMED30002882 vs. Ensembl Nematostella
Match: EDO44989 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUB4])

HSP 1 Score: 53.5286 bits (127), Expect = 2.351e-8
Identity = 36/124 (29.03%), Postives = 57/124 (45.97%), Query Frame = 1
Query:  835 YEIEIKTADKENSEKNIKVLIQLYGETNNMKEPICLNHISTDQTDLNLFRPGNLDKFLLGIQYFIGSIINVKIGLENEG--TLWNLDYLCVRDIQSEKDYFFSCRRCLGTDSPDKLTQITLGYT 1200
            Y+++I T D   +  +  VLI +YGE  +  + +  N         N F  G  D F L    ++G I  + IG +N G    WNL  + V D++S + + F C R    +  D LT   L ++
Sbjct:    1 YKVDILTGDVYGAGTDANVLITIYGEDGDSGQQLLDN-------SGNNFERGTKDHFHLVTNKYLGRITKIHIGHDNTGLGAAWNLGKVMVEDVKSREVFVFPCDRWFSVEEDDGLTSRDLFWS 117          
BLAST of SMED30002882 vs. Ensembl Nematostella
Match: EDO38972 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBB7])

HSP 1 Score: 50.8322 bits (120), Expect = 9.136e-7
Identity = 35/132 (26.52%), Postives = 62/132 (46.97%), Query Frame = 1
Query:  817 KDSNFSYEIEIKTADKENSEKNIKVLIQLYGETNN-----MKEPICLNHISTDQTDLNLFRPGNLDKFLLGIQYFIGSIINVKIGLENEGT--LWNLDYLCVRDIQSEKDYFFSCRRCLGTDSPDKLTQITL 1191
            +  +F YEI I T  ++N+     V   L G  +N     +K+P           ++  F+  ++D FL+     +G +  +K+   NEG    W ++ + VRDI+ ++ Y F C R L  +  D   +IT+
Sbjct:   88 RQDHFMYEITIYTGMRKNAGTTSDVFCALVGNQHNSDPRRLKDP-----------NVQRFQRSSVDTFLVSSSLCLGDLCCIKLWHNNEGLNPSWYVNRVTVRDIEKDQTYQFICNRWLAVEYDDGQVEITV 208          
BLAST of SMED30002882 vs. Ensembl Nematostella
Match: EDO38018 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE37])

HSP 1 Score: 50.447 bits (119), Expect = 2.247e-6
Identity = 38/132 (28.79%), Postives = 64/132 (48.48%), Query Frame = 1
Query:  808 NNNKDSNFSYEIEIKTADKENSEKNIKVLIQLYGETNNMKEPICLNHISTDQTDLNL--FRPGNLDKFLLGIQYFIGSIINVKIGLENEGT--LWNLDYLCVRDIQSEKDYFFSCRRCLGTDSPDKLTQITL 1191
            +N+    +SYEI I T   +      +V IQL G  ++       +H +T+  D N   F+ G +D+FL  +   +G +  ++I  +N G    W L  + VRD+Q+++ ++F C   L  D  D     TL
Sbjct:  117 DNDPRDRYSYEISIHTGFHQGCGTTARVYIQLIGSISD-------SH-TTELRDANRPRFQRGAIDQFLFTVPESLGKLEELRIWHDNSGLSPGWFLFKVQVRDVQTDQKWWFVCNNWLAVDENDGSVDRTL 240          
BLAST of SMED30002882 vs. Ensembl Nematostella
Match: EDO43381 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYU3])

HSP 1 Score: 51.2174 bits (121), Expect = 3.138e-6
Identity = 33/112 (29.46%), Postives = 56/112 (50.00%), Query Frame = 1
Query:  829 FSYEIEIKTADKENSEKNIKVLIQLYGETNNMKEPICLNHISTDQTDLNLFRPGNLDKFLLGIQYFIGSIINVKIGLENE---GTLWNLDYLCVRD-IQSEKDYFFSCRRCL 1152
             +YE+ IKT D+  +     V I ++GE  N  E   L      +T  + F+ G +D F +    F+G I++V++G  NE   G  W LD + V++ + + + + F C R  
Sbjct:  459 ITYEVYIKTGDRLGAGTKATVKITIFGEYGNSGERQLLR----SKTHRSKFQRGQVDVFAID-SLFLGKILSVRVG-HNETRLGYGWFLDKVYVKEGVDATRAFEFKCNRWF 564          
BLAST of SMED30002882 vs. Planmine SMEST
Match: SMESG000069367.1 (SMESG000069367.1)

HSP 1 Score: 1588.55 bits (4112), Expect = 0.000e+0
Identity = 882/896 (98.44%), Postives = 887/896 (99.00%), Query Frame = 1
Query:  196 MSRRTNRRQISPVRIKANTEPRRGNYNSEVQRIINHAAKLISEYNKTELDKLMDEDLDNHMKINKLLKESKVNLPKISLLRNSKKQMIKKRKVSTLQSSNLEPENESSKGDCNVNYNSPDEIESNDSGSNGKSASQKFSMQISLPLSNETDGNVQDYSSMKSSENSVTDRESENFGTLSQLSLEKSVLCSICSPKEQTESHKKENNNKDSNFSYEIEIKTADKENSEKNIKVLIQLYGETNNMKEPICLNHISTDQTDLNLFRPGNLDKFLLGIQYFIGSIINVKIGLENEGTLWNLDYLCVRDIQSEKDYFFSCRRCLGTDSPDKLTQITLGYTPPYKILKHDSLSKSNTESIENKRSEESILDFEKDNIPSARSTESHHSQANESSRLSDKILEKLDQDXXXXXXXXXXXXRVVEKSTEKPGSRPIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQEKIKSPSYESTDIFAAIRYHDVLTVKRLCNSDNKRIVSDADENGCSPIHLAGIYYEDKEECREIIKHLESIIVDINYKSLDGLTILHYAVLNNNLPAVKFLIEHCEAGSDILDRNGNSSIQLANMNDFDEIVDYLSDVKEKESSQIQKNLHDFDIGKKSEVDDNILQEAEQLPSFPTDVNIDHNETDQLTPGNVSVEASTLEYSKQEKRASIFNDIDKENVETDEDKSIVSENKQNSRKTSLXXXXXXXXXXXXXXXXXXXVLITKNDESEIGEEMKHSSNNQNVDLITPDNDSLENLENKQFEAENKGIMFHKEIPDPFHNNAIRKSKPPKILEKFNEELXXXXXXXXXXXXXTRIATMSPITPRSNMFDMDEITQPKPSENLNDNQDIIEKRDNKNVNSVPDHESNQENVDKTERENNSTPPEENLIEK 2883
            MSRRTNRRQISPVRIKANTEPRRGN NSEVQRIINHAAKLISEYNKTELDKLMDEDLDNHMKI+KLLKESKVNLPKISLLRNSKKQMIKKRKVSTLQSSNLEPENESSKGDCNVNYNSPDEIESNDSGSNGKSASQKFS  ISLPLSNETDGNVQDYSSMKSSENSVTDRESENFGTLSQLSLEKSVLCSICSPKEQTESHKKENNNKDSNFSYEIEIKTADK+NSEKNIKVLIQLYGETNNMKEPICLNHISTDQTDLNLFRPGNLDKFLLGIQYFIGSIINVKIGLENEGTLWNLDYLCVRDIQSEKDYFFSCRRCLGTDSPDKLTQITLGYTPPYKILKHDSLSKSNTESIENKRSEESILDFEKDNIPSARSTESHHSQANESSRLSDKILEKLDQDNENISN+ECSEERVVEKSTEKPGSRPISQNSDDSSSRSDSKSSSSSPSLSNDLVNNSNGDSLRQEKIKSPSYESTDIFAAIR HDVLTVKRLCNSDNK+IVSDADENGCSPIHLAGIYYEDKEECREIIKHLESIIVDINYKSLDGLTILHYAVLNNNLPAVKFLIEHCEAGSDILDRNGNSSIQLANMNDFDEIV+YLSDVKEKESSQIQKNLHDFDIGK SEVDDNILQEAEQLPSFPTDVNIDHNETDQLTPGNVSVEASTLEYSKQEKRASIFNDIDKENVETDEDKSIVSENKQNSRKTSLSVVSDDSKKSENEPSSKPKVLITKNDESEIGEEMKHSSNNQNVDLIT DNDSLENLENKQFEAENKGIMFHKEIPDPFHNN IRKSKPPKILEKFNEELSEISSRSNTSSVSTRIATMSPITPRSNM DMDEITQPKPSENLNDNQDIIEKRDNKNVNSVPDHESNQENVDKTERENNSTPPEENLI K
Sbjct:    1 MSRRTNRRQISPVRIKANTEPRRGNSNSEVQRIINHAAKLISEYNKTELDKLMDEDLDNHMKISKLLKESKVNLPKISLLRNSKKQMIKKRKVSTLQSSNLEPENESSKGDCNVNYNSPDEIESNDSGSNGKSASQKFSTLISLPLSNETDGNVQDYSSMKSSENSVTDRESENFGTLSQLSLEKSVLCSICSPKEQTESHKKENNNKDSNFSYEIEIKTADKDNSEKNIKVLIQLYGETNNMKEPICLNHISTDQTDLNLFRPGNLDKFLLGIQYFIGSIINVKIGLENEGTLWNLDYLCVRDIQSEKDYFFSCRRCLGTDSPDKLTQITLGYTPPYKILKHDSLSKSNTESIENKRSEESILDFEKDNIPSARSTESHHSQANESSRLSDKILEKLDQDNENISNNECSEERVVEKSTEKPGSRPISQNSDDSSSRSDSKSSSSSPSLSNDLVNNSNGDSLRQEKIKSPSYESTDIFAAIRSHDVLTVKRLCNSDNKKIVSDADENGCSPIHLAGIYYEDKEECREIIKHLESIIVDINYKSLDGLTILHYAVLNNNLPAVKFLIEHCEAGSDILDRNGNSSIQLANMNDFDEIVNYLSDVKEKESSQIQKNLHDFDIGKMSEVDDNILQEAEQLPSFPTDVNIDHNETDQLTPGNVSVEASTLEYSKQEKRASIFNDIDKENVETDEDKSIVSENKQNSRKTSLSVVSDDSKKSENEPSSKPKVLITKNDESEIGEEMKHSSNNQNVDLITLDNDSLENLENKQFEAENKGIMFHKEIPDPFHNNEIRKSKPPKILEKFNEELSEISSRSNTSSVSTRIATMSPITPRSNMSDMDEITQPKPSENLNDNQDIIEKRDNKNVNSVPDHESNQENVDKTERENNSTPPEENLIAK 896          
BLAST of SMED30002882 vs. Planmine SMEST
Match: SMESG000069365.1 (SMESG000069365.1)

HSP 1 Score: 311.612 bits (797), Expect = 5.146e-99
Identity = 155/155 (100.00%), Postives = 155/155 (100.00%), Query Frame = 3
Query: 2973 MSSFQENIENINKISNRFTLKSRMHKSGLSDMILTKSLPKEKCEAVNQYLQSLEALKFSMVSNDSCCFGKSDEVINASESSYSIELDEPNKTQNIVNRVKNRNVERFCECPLEVLICLGSISREHFSDQLDKIDSIEELFYVAENILRNSVLMNR 3437
            MSSFQENIENINKISNRFTLKSRMHKSGLSDMILTKSLPKEKCEAVNQYLQSLEALKFSMVSNDSCCFGKSDEVINASESSYSIELDEPNKTQNIVNRVKNRNVERFCECPLEVLICLGSISREHFSDQLDKIDSIEELFYVAENILRNSVLMNR
Sbjct:    1 MSSFQENIENINKISNRFTLKSRMHKSGLSDMILTKSLPKEKCEAVNQYLQSLEALKFSMVSNDSCCFGKSDEVINASESSYSIELDEPNKTQNIVNRVKNRNVERFCECPLEVLICLGSISREHFSDQLDKIDSIEELFYVAENILRNSVLMNR 155          
The following BLAST results are available for this feature:
BLAST of SMED30002882 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002882 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002882 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002882 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002882 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
PPP1R12A8.644e-639.73protein phosphatase 1 regulatory subunit 12A [Sour... [more]
PPP1R12A8.952e-639.73protein phosphatase 1 regulatory subunit 12A [Sour... [more]
back to top
BLAST of SMED30002882 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Pkd11.320e-731.19polycystin 1, transient receptor poteintial channe... [more]
Pkd14.681e-631.48polycystin 1, transient receptor poteintial channe... [more]
back to top
BLAST of SMED30002882 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002882 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 3
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|175136811.411e-728.71tr|A7SB31|A7SB31_NEMVE Predicted protein (Fragment... [more]
gnl|BL_ORD_ID|234437485.711e-631.09tr|A0A2B4STF0|A0A2B4STF0_STYPI Polycystic kidney d... [more]
gnl|BL_ORD_ID|234995965.719e-636.15tr|A0A210Q5A4|A0A210Q5A4_MIZYE Protein phosphatase... [more]
back to top
BLAST of SMED30002882 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
loxhd1b8.028e-629.51lipoxygenase homology domains 1b [Source:ZFIN;Acc:... [more]
back to top
BLAST of SMED30002882 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002882 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002882 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO391071.951e-1128.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449892.351e-829.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO389729.136e-726.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380182.247e-628.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433813.138e-629.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30002882 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002882 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000069367.10.000e+098.44SMESG000069367.1[more]
SMESG000069365.15.146e-99100.00SMESG000069365.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002882 ID=SMED30002882|Name=SMED30002882|organism=Schmidtea mediterranea sexual|type=transcript|length=3665bp
CGTTCTTTTACTAAATCATTATTTTAATAGTTATAACAACCTTAAAGGTC
ATTCAAATTGAAAATTGAAAAATTGTCTTACAAAATTAATTTCAACCAAT
TAAATGTGAAAGAGAATTTCCATCAATGATTTCATTTTATTTTTAAAACT
TCTCAGCTTTATAAATAATTATTTTATTTCGTCAAACAAGCGAATATGTC
CCGCAGAACAAATCGTCGTCAAATCTCGCCTGTTAGAATCAAAGCAAATA
CTGAACCAAGAAGAGGTAACTATAATTCAGAAGTTCAACGAATTATCAAT
CATGCTGCTAAATTGATATCTGAATATAATAAAACAGAATTAGACAAGCT
AATGGATGAAGACTTAGATAATCACATGAAAATCAATAAATTGCTTAAAG
AATCCAAAGTAAACTTGCCGAAAATTTCATTGTTAAGGAATTCTAAGAAA
CAAATGATAAAAAAGAGAAAAGTGTCGACTCTTCAAAGTTCGAATCTTGA
ACCGGAAAATGAATCTAGCAAAGGTGACTGCAATGTCAACTACAATAGCC
CAGATGAAATCGAATCAAATGATTCTGGCAGCAATGGCAAATCGGCAAGT
CAGAAATTCTCAATGCAAATCTCGTTGCCCCTCTCGAACGAAACTGATGG
AAATGTCCAAGATTATTCGTCAATGAAATCATCGGAAAATTCAGTAACAG
ACAGAGAAAGCGAAAATTTCGGAACTCTTAGTCAGTTATCTCTTGAGAAA
TCAGTTCTCTGCTCCATTTGTTCGCCAAAAGAACAAACAGAGAGTCACAA
AAAAGAAAATAACAATAAAGACTCAAATTTCAGTTATGAAATTGAGATTA
AAACTGCCGATAAAGAAAATTCAGAAAAAAATATAAAAGTTCTCATACAA
TTATATGGAGAAACGAACAACATGAAAGAGCCAATTTGTTTAAATCATAT
CTCTACAGATCAAACAGATTTGAATTTATTTAGACCGGGAAATCTCGATA
AATTTTTACTTGGCATCCAATATTTTATTGGATCTATTATCAATGTAAAA
ATTGGCTTAGAGAATGAAGGTACATTATGGAATCTTGATTATTTATGCGT
CAGAGATATTCAATCTGAGAAAGACTATTTTTTCTCTTGTCGCAGATGTT
TAGGAACCGACAGTCCTGATAAATTAACACAAATAACTCTTGGCTATACC
CCACCATATAAAATACTTAAACACGATAGTTTATCAAAATCAAACACAGA
AAGCATTGAAAATAAAAGGTCTGAAGAATCAATTCTGGATTTTGAAAAAG
ACAATATTCCCTCAGCGAGGAGCACTGAATCCCATCATTCGCAGGCAAAT
GAATCCAGTCGTTTATCAGATAAGATTTTAGAAAAGTTGGATCAAGATAA
CGAAAACATTTCAAACAGCGAATGTTCGGAAGAGAGAGTCGTTGAAAAAT
CAACCGAGAAGCCAGGCAGTCGTCCAATATCACAAAATTCAGATGATTCT
TCCTCTCGTTCTGACTCCAAGTCCAGCAGTTCAAGTCCGTCGTTATCAAA
CGATCTTGTCAACAATTCTAATGGTGATTCACTTAGACAAGAGAAGATCA
AGTCACCATCATACGAGTCTACTGACATCTTCGCAGCGATCAGATATCAT
GATGTCTTAACAGTCAAGCGATTATGTAACTCAGATAATAAAAGAATTGT
TAGTGATGCCGATGAGAATGGTTGTAGCCCAATCCATTTGGCCGGGATTT
ATTACGAAGATAAAGAAGAATGCAGAGAAATTATCAAGCACCTAGAAAGC
ATTATTGTTGATATAAACTATAAATCATTGGACGGGTTGACCATTTTGCA
TTATGCAGTCCTCAATAACAATCTCCCAGCCGTAAAATTTCTAATTGAGC
ATTGTGAAGCTGGGTCTGACATTTTGGATCGGAACGGGAACAGCTCAATT
CAGTTGGCAAATATGAATGATTTTGATGAAATAGTCGATTATTTGTCAGA
CGTAAAAGAGAAAGAATCGAGTCAAATTCAGAAAAATTTACACGATTTTG
ATATTGGTAAAAAGTCAGAGGTCGATGATAACATTCTGCAAGAGGCTGAA
CAATTACCTTCATTTCCAACCGATGTAAATATAGATCATAACGAAACTGA
CCAATTGACACCTGGAAATGTTTCTGTTGAAGCGTCAACCTTAGAATATT
CAAAACAAGAAAAGCGTGCTAGTATCTTTAATGATATTGATAAAGAAAAT
GTTGAAACTGATGAAGACAAAAGTATTGTTTCCGAAAACAAGCAAAATTC
TAGAAAAACAAGCTTATCAGTAGTTAGTGACGATTCAAAAAAATCCGAGA
ATGAACCATCTTCAAAGCCCAAAGTGCTAATTACTAAAAATGATGAATCG
GAAATAGGTGAAGAAATGAAACATTCATCTAACAATCAAAACGTCGACCT
AATAACTCCAGACAATGATAGTTTAGAAAATCTTGAGAACAAGCAATTTG
AAGCGGAAAATAAAGGAATAATGTTTCATAAAGAAATTCCAGATCCTTTT
CATAATAATGCGATTCGAAAATCAAAACCTCCAAAAATATTGGAGAAGTT
CAATGAAGAATTGAGTGAAATTTCATCAAGATCCAATACTTCATCGGTTT
CAACTCGTATAGCTACAATGAGCCCAATCACACCCAGGTCTAATATGTTT
GATATGGATGAAATAACTCAACCAAAACCATCTGAAAACCTAAATGATAA
TCAGGATATAATTGAGAAACGTGACAATAAAAATGTTAATAGCGTCCCTG
ATCATGAGAGCAATCAAGAAAATGTGGACAAAACAGAACGGGAAAATAAC
TCAACACCGCCAGAGGAAAATTTAATTGAGAAAGTAAATTCAGTCCAACC
TCCAATCCGAGTTAGGAAACCCGTTCTTTTAAGCAGACAAGAATCACAGA
AAATAATACTAAAATATTTAATATGTCCTCCTTCCAAGAAAACATTGAAA
ATATCAACAAAATAAGCAATCGTTTCACATTAAAGTCCAGGATGCATAAA
AGCGGCCTGTCCGATATGATTTTAACAAAATCTCTTCCCAAAGAAAAATG
TGAAGCTGTAAACCAATATTTGCAGTCTTTAGAGGCACTAAAATTCTCTA
TGGTCTCCAATGATTCTTGTTGTTTTGGTAAGTCAGATGAAGTAATAAAT
GCATCGGAAAGTTCTTATTCAATTGAATTGGATGAGCCAAACAAGACCCA
AAATATCGTAAACCGAGTAAAGAATCGAAATGTTGAACGATTCTGTGAAT
GCCCTCTCGAGGTTTTAATATGTTTAGGGTCTATTAGTAGAGAGCATTTT
TCGGATCAGTTGGATAAAATAGATTCAATTGAGGAGTTGTTTTATGTTGC
TGAAAACATATTGCGCAATAGTGTTCTTATGAATAGATGATTGCAGATGT
AAAACTTTTGCCTCAATTTCAGGCTTCTGATTTTATACACTGTTTTCTAT
TAAAATAAGGCCAACGTGAAATATAATTAGTAATTTGTCAATTTGATTTT
AATTCATTCATTCCTTTGTTAAGGAATATTTATATATATAAATATCCCGA
TAAATATTACAGCTTTTTAAAGCCTAATAAAATTAAGGAGTGACAGTAAA
GAATCTTAATGAACC
back to top

protein sequence of SMED30002882-orf-1

>SMED30002882-orf-1 ID=SMED30002882-orf-1|Name=SMED30002882-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=156bp
MSSFQENIENINKISNRFTLKSRMHKSGLSDMILTKSLPKEKCEAVNQYL
QSLEALKFSMVSNDSCCFGKSDEVINASESSYSIELDEPNKTQNIVNRVK
NRNVERFCECPLEVLICLGSISREHFSDQLDKIDSIEELFYVAENILRNS
VLMNR*
back to top

protein sequence of SMED30002882-orf-2

>SMED30002882-orf-2 ID=SMED30002882-orf-2|Name=SMED30002882-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=940bp
MSRRTNRRQISPVRIKANTEPRRGNYNSEVQRIINHAAKLISEYNKTELD
KLMDEDLDNHMKINKLLKESKVNLPKISLLRNSKKQMIKKRKVSTLQSSN
LEPENESSKGDCNVNYNSPDEIESNDSGSNGKSASQKFSMQISLPLSNET
DGNVQDYSSMKSSENSVTDRESENFGTLSQLSLEKSVLCSICSPKEQTES
HKKENNNKDSNFSYEIEIKTADKENSEKNIKVLIQLYGETNNMKEPICLN
HISTDQTDLNLFRPGNLDKFLLGIQYFIGSIINVKIGLENEGTLWNLDYL
CVRDIQSEKDYFFSCRRCLGTDSPDKLTQITLGYTPPYKILKHDSLSKSN
TESIENKRSEESILDFEKDNIPSARSTESHHSQANESSRLSDKILEKLDQ
DNENISNSECSEERVVEKSTEKPGSRPISQNSDDSSSRSDSKSSSSSPSL
SNDLVNNSNGDSLRQEKIKSPSYESTDIFAAIRYHDVLTVKRLCNSDNKR
IVSDADENGCSPIHLAGIYYEDKEECREIIKHLESIIVDINYKSLDGLTI
LHYAVLNNNLPAVKFLIEHCEAGSDILDRNGNSSIQLANMNDFDEIVDYL
SDVKEKESSQIQKNLHDFDIGKKSEVDDNILQEAEQLPSFPTDVNIDHNE
TDQLTPGNVSVEASTLEYSKQEKRASIFNDIDKENVETDEDKSIVSENKQ
NSRKTSLSVVSDDSKKSENEPSSKPKVLITKNDESEIGEEMKHSSNNQNV
DLITPDNDSLENLENKQFEAENKGIMFHKEIPDPFHNNAIRKSKPPKILE
KFNEELSEISSRSNTSSVSTRIATMSPITPRSNMFDMDEITQPKPSENLN
DNQDIIEKRDNKNVNSVPDHESNQENVDKTERENNSTPPEENLIEKVNSV
QPPIRVRKPVLLSRQESQKIILKYLICPPSKKTLKISTK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR036392PLAT/LH2_dom_sf
IPR006588Peptide_N_glycanase_PAW_dom
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
IPR001024PLAT/LH2_dom
Vocabulary: biological process
TermDefinition
GO:0006516glycoprotein catabolic process
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0006954inflammatory response
GO:0007165signal transduction
GO:0007249I-kappaB kinase/NF-kappaB signaling
GO:0034097response to cytokine
GO:0038061NIK/NF-kappaB signaling
GO:0045087innate immune response
GO:0045944positive regulation of transcription from RNA polymerase II promoter
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005634nucleus
GO:0005829cytosol
GO:0033256I-kappaB/NF-kappaB complex
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0000977RNA polymerase II regulatory region sequence-specific DNA binding
GO:0000981RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0003677DNA binding
GO:0003682chromatin binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0051059NF-kappaB binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 546..578
e-value: 0.011
score: 24.9
coord: 580..608
e-value: 2500.0
score: 2.0
coord: 508..542
e-value: 290.0
score: 9.0
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 546..569
score: 9.11
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 528..602
e-value: 4.3E-8
score: 33.6
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 508..600
score: 14.265
NoneNo IPR availableGENE3DG3DSA:2.60.60.20coord: 206..324
e-value: 1.1E-16
score: 63.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 423..466
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 399..469
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 851..886
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 709..730
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 346..368
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 85..112
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..28
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 808..891
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 399..421
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 808..850
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 687..730
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 92..112
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 149..172
NoneNo IPR availablePANTHERPTHR24134FAMILY NOT NAMEDcoord: 472..610
IPR001024PLAT/LH2 domainPFAMPF01477PLATcoord: 214..324
e-value: 3.8E-7
score: 30.7
IPR001024PLAT/LH2 domainPROSITEPS50095PLATcoord: 212..333
score: 17.684
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 377..616
e-value: 7.7E-18
score: 66.9
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 471..602
IPR036392PLAT/LH2 domain superfamilySUPERFAMILYSSF49723Lipase/lipooxygenase domain (PLAT/LH2 domain)coord: 212..327