IQ motif and SEC7 domain-containing protein 2

Overview
NameIQ motif and SEC7 domain-containing protein 2
Smed IDSMED30002877
Length (bp)1578
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of IQ motif and SEC7 domain-containing protein 2 (SMED30002877) t-SNE clustered cells

Violin plots show distribution of expression levels for IQ motif and SEC7 domain-containing protein 2 (SMED30002877) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of IQ motif and SEC7 domain-containing protein 2 (SMED30002877) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for IQ motif and SEC7 domain-containing protein 2 (SMED30002877) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002877

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle progenitor cellSMED30002877SMESG000070179.1 SMED30002877smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
X1 cellSMED30002877SMESG000070179.1 SmedASXL_004177SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
muscle cellSMED30002877SMESG000070179.1 dd_Smed_v4_8602_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002877SMESG000070179.1 dd_Smed_v4_8602_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002877SMESG000064830.1 Contig4340GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002877SMESG000070179.1 Contig24470newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002877SMESG000070179.1 Contig24470uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002877SMESG000070179.1 Contig4340GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30002877SMESG000070179.1 SMED30002877smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30002877SMESG000070179.1 SMED30002877smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30002877SMESG000070179.1 SMED30002877smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
zeta neoblastSMED30002877SMESG000070179.1 dd_Smed_v4_8602_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002877SMESG000070179.1 SMED_07038_V2_2GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30002877SMESG000070179.1 SMED_07038_V2_2GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30002877SMESG000070179.1 SMED_07038_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30002877SMESG000070179.1 SMED_07038_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30002877SMESG000070179.1 SmWIOct06_016157GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Human
Match: IQSEC1 (IQ motif and Sec7 domain ArfGEF 1 [Source:HGNC Symbol;Acc:HGNC:29112])

HSP 1 Score: 70.8626 bits (172), Expect = 2.922e-12
Identity = 75/340 (22.06%), Postives = 144/340 (42.35%), Query Frame = 3
Query:  477 QHIKLGIDLFNFNSECGVDYFQSNGIV-NKDKDLAELFMKKNGFNRSRMSDYMTDPE---NLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIFQFLMTFYTSQIHEKSNRLTR----EDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPK--EFH------LIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKLLDIKCAFVK----RNGIQLI-QISDLSNNILGSFYSKINEDFTNFYTSLEQAIG 1433
            +H ++G++LFN   E GV Y    G V +    +A   +++ G +R  + +++ + +   N  +     + +D     + E ++++  +  ++GE Q+V ++++  SQ Y   N    +          I  F +    + ++  + +  R    EDFIK L        I R   + +Y  + +       D   + + KV KLI         H      L   +R ++C+  L +V  P N   K+  H R +FLFND L+ +K      ++  Y F+Q   L  ++    +     NGI+L   +      +L +F +   +D   F   L ++I 
Sbjct:  404 RHYRIGLNLFNKKPEKGVQYLIERGFVPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSTMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCICN-PGVVRQFRNPDTIFILAFAIILLNTDMYSPNVKPERKMKLEDFIKNLRGVDDGEDIPREMLMGIYERIRKRELKTNED-HVSQVQKVEKLIVGKKPIGSLHPGLGCVLSLPHRRLVCYCRLFEVPDP-NKPQKLGLHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSSVPGADIKVLINFNAPNPQDRKKFTDDLRESIA 740          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Human
Match: IQSEC1 (IQ motif and Sec7 domain ArfGEF 1 [Source:HGNC Symbol;Acc:HGNC:29112])

HSP 1 Score: 70.8626 bits (172), Expect = 3.263e-12
Identity = 75/340 (22.06%), Postives = 144/340 (42.35%), Query Frame = 3
Query:  477 QHIKLGIDLFNFNSECGVDYFQSNGIV-NKDKDLAELFMKKNGFNRSRMSDYMTDPE---NLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIFQFLMTFYTSQIHEKSNRLTR----EDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPK--EFH------LIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKLLDIKCAFVKR----NGIQLI-QISDLSNNILGSFYSKINEDFTNFYTSLEQAIG 1433
            +H ++G++LFN   E GV Y    G V +    +A   +++ G +R  + +++ + +   N  +     + +D     + E ++++  +  ++GE Q+V ++++  SQ Y   N    +          I  F +    + ++  + +  R    EDFIK L        I R   + +Y  + +       D   + + KV KLI         H      L   +R ++C+  L +V  P N   K+  H R +FLFND L+ +K      ++  Y F+Q   L  ++    +     NGI+L   +      +L +F +   +D   F   L ++I 
Sbjct:  404 RHYRIGLNLFNKKPEKGVQYLIERGFVPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSTMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCICN-PGVVRQFRNPDTIFILAFAIILLNTDMYSPNVKPERKMKLEDFIKNLRGVDDGEDIPREMLMGIYERIRKRELKTNED-HVSQVQKVEKLIVGKKPIGSLHPGLGCVLSLPHRRLVCYCRLFEVPDP-NKPQKLGLHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSSVPGADIKVLINFNAPNPQDRKKFTDDLRESIA 740          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Human
Match: IQSEC1 (IQ motif and Sec7 domain ArfGEF 1 [Source:HGNC Symbol;Acc:HGNC:29112])

HSP 1 Score: 70.4774 bits (171), Expect = 4.817e-12
Identity = 75/340 (22.06%), Postives = 144/340 (42.35%), Query Frame = 3
Query:  477 QHIKLGIDLFNFNSECGVDYFQSNGIV-NKDKDLAELFMKKNGFNRSRMSDYMTDPE---NLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIFQFLMTFYTSQIHEKSNRLTR----EDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPK--EFH------LIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKLLDIKCAFVK----RNGIQLI-QISDLSNNILGSFYSKINEDFTNFYTSLEQAIG 1433
            +H ++G++LFN   E GV Y    G V +    +A   +++ G +R  + +++ + +   N  +     + +D     + E ++++  +  ++GE Q+V ++++  SQ Y   N    +          I  F +    + ++  + +  R    EDFIK L        I R   + +Y  + +       D   + + KV KLI         H      L   +R ++C+  L +V  P N   K+  H R +FLFND L+ +K      ++  Y F+Q   L  ++    +     NGI+L   +      +L +F +   +D   F   L ++I 
Sbjct:  527 RHYRIGLNLFNKKPEKGVQYLIERGFVPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSTMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCICN-PGVVRQFRNPDTIFILAFAIILLNTDMYSPNVKPERKMKLEDFIKNLRGVDDGEDIPREMLMGIYERIRKRELKTNED-HVSQVQKVEKLIVGKKPIGSLHPGLGCVLSLPHRRLVCYCRLFEVPDP-NKPQKLGLHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSSVPGADIKVLINFNAPNPQDRKKFTDDLRESIA 863          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Human
Match: IQSEC1 (IQ motif and Sec7 domain ArfGEF 1 [Source:HGNC Symbol;Acc:HGNC:29112])

HSP 1 Score: 70.0922 bits (170), Expect = 5.678e-12
Identity = 75/340 (22.06%), Postives = 144/340 (42.35%), Query Frame = 3
Query:  477 QHIKLGIDLFNFNSECGVDYFQSNGIV-NKDKDLAELFMKKNGFNRSRMSDYMTDPE---NLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIFQFLMTFYTSQIHEKSNRLTR----EDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPK--EFH------LIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKLLDIKCAFVK----RNGIQLI-QISDLSNNILGSFYSKINEDFTNFYTSLEQAIG 1433
            +H ++G++LFN   E GV Y    G V +    +A   +++ G +R  + +++ + +   N  +     + +D     + E ++++  +  ++GE Q+V ++++  SQ Y   N    +          I  F +    + ++  + +  R    EDFIK L        I R   + +Y  + +       D   + + KV KLI         H      L   +R ++C+  L +V  P N   K+  H R +FLFND L+ +K      ++  Y F+Q   L  ++    +     NGI+L   +      +L +F +   +D   F   L ++I 
Sbjct:  526 RHYRIGLNLFNKKPEKGVQYLIERGFVPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSTMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCICN-PGVVRQFRNPDTIFILAFAIILLNTDMYSPNVKPERKMKLEDFIKNLRGVDDGEDIPREMLMGIYERIRKRELKTNED-HVSQVQKVEKLIVGKKPIGSLHPGLGCVLSLPHRRLVCYCRLFEVPDP-NKPQKLGLHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSSVPGADIKVLINFNAPNPQDRKKFTDDLRESIA 862          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Human
Match: IQSEC1 (IQ motif and Sec7 domain ArfGEF 1 [Source:HGNC Symbol;Acc:HGNC:29112])

HSP 1 Score: 69.3218 bits (168), Expect = 1.124e-11
Identity = 75/342 (21.93%), Postives = 146/342 (42.69%), Query Frame = 3
Query:  477 QHIKLGIDLFNFNSECGVDYFQSNGIV-NKDKDLAELFMKKNGFNRSRMSDYMTDPE---NLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYF--NQNLEKDILGLNLEQLTIIFQFLMTFYTSQIHEKSNRLTR----EDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPK--EFH------LIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKLLDIKCAFVK----RNGIQLI-QISDLSNNILGSFYSKINEDFTNFYTSLEQAIG 1433
            +H ++G++LFN   E GV Y    G V +    +A   +++ G +R  + +++ + +   N  +     + +D     + E ++++  +  ++GE Q+V ++++  SQ Y   N  + +     +      I  F +    + ++  + +  R    EDFIK L        I R   + +Y  + +       D   + + KV KLI         H      L   +R ++C+  L +V  P N   K+  H R +FLFND L+ +K      ++  Y F+Q   L  ++    +     NGI+L   +      +L +F +   +D   F   L ++I 
Sbjct:  512 RHYRIGLNLFNKKPEKGVQYLIERGFVPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSTMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCICNPGVVRQFRNPDT---IFILAFAIILLNTDMYSPNVKPERKMKLEDFIKNLRGVDDGEDIPREMLMGIYERIRKRELKTNED-HVSQVQKVEKLIVGKKPIGSLHPGLGCVLSLPHRRLVCYCRLFEVPDP-NKPQKLGLHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSSVPGADIKVLINFNAPNPQDRKKFTDDLRESIA 848          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Celegans
Match: bris-1 (BRag/Iqsec/Schizo related Arf GEF family member [Source:UniProtKB/TrEMBL;Acc:U4PLL0])

HSP 1 Score: 58.151 bits (139), Expect = 8.483e-9
Identity = 72/334 (21.56%), Postives = 137/334 (41.02%), Query Frame = 3
Query:  486 KLGIDLFNFNSECGVDYFQSNGIVNKDKD-LAELFMKKNGFNRSRMSDY---MTDPENLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIFQFLMTFYTSQIHEKS--NRLTREDFIKMLNDSLKSNG------ISRSYALSLYYELSE----VSFDNILDTRTTDLDKVSKLITDLPKEFHLIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSK--RKGGMYDTN-QYRFKQVIKLLDIKCAFVKRNGIQLIQISDLSNNILGSFYSKINEDFTNFYTSLEQAI 1430
            ++ ++ FN   E GV    + G V    D LA L   + G ++S + +Y   +  P +  +   F  L+D++   V   +++ +++ ++  E +++ +I+   +  Y   N ++            +  F +    + +H  +   R+T+ DF+K L    K +G      I R     +Y  + +       D++   +  D   V K   D P+   L +  R ++C+  L QV  P       S  +R VFLFND ++ +K  R+G        Y  KQ   LL       +R   +        N     F ++  ED  +F   + ++I
Sbjct:   86 RIALNFFNKKPERGVQLLTAWGFVKNSPDSLASLLFGRRGLSKSMIGEYIGTLHSPYHSLVLKYFTALIDIRGLEVDVALRKAMQFFILPKEAEKIDRIIQAFALHYSKSNPKRTSHYRGGWDTIHLLSFAIIMLNTDLHSPNVKQRMTQADFVKNLRGQDKISGEKNGEDIDRKTLEGIYDRIKKDELKAGDDHVAQVQRVDRAIVGK---DKPR---LTETPRRLVCYCRLQQVSDP-TKRQSSSARERDVFLFNDMIVVAKGVRRGSTSMAGCTYTLKQWTLLLGAHVTEFQRGQYEFGLTITCPNKDKIHFNARNFEDRCHFVADVTESI 412          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Celegans
Match: bris-1 (BRag/Iqsec/Schizo related Arf GEF family member [Source:UniProtKB/TrEMBL;Acc:U4PLL0])

HSP 1 Score: 58.151 bits (139), Expect = 1.000e-8
Identity = 72/334 (21.56%), Postives = 137/334 (41.02%), Query Frame = 3
Query:  486 KLGIDLFNFNSECGVDYFQSNGIVNKDKD-LAELFMKKNGFNRSRMSDY---MTDPENLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIFQFLMTFYTSQIHEKS--NRLTREDFIKMLNDSLKSNG------ISRSYALSLYYELSE----VSFDNILDTRTTDLDKVSKLITDLPKEFHLIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSK--RKGGMYDTN-QYRFKQVIKLLDIKCAFVKRNGIQLIQISDLSNNILGSFYSKINEDFTNFYTSLEQAI 1430
            ++ ++ FN   E GV    + G V    D LA L   + G ++S + +Y   +  P +  +   F  L+D++   V   +++ +++ ++  E +++ +I+   +  Y   N ++            +  F +    + +H  +   R+T+ DF+K L    K +G      I R     +Y  + +       D++   +  D   V K   D P+   L +  R ++C+  L QV  P       S  +R VFLFND ++ +K  R+G        Y  KQ   LL       +R   +        N     F ++  ED  +F   + ++I
Sbjct:   91 RIALNFFNKKPERGVQLLTAWGFVKNSPDSLASLLFGRRGLSKSMIGEYIGTLHSPYHSLVLKYFTALIDIRGLEVDVALRKAMQFFILPKEAEKIDRIIQAFALHYSKSNPKRTSHYRGGWDTIHLLSFAIIMLNTDLHSPNVKQRMTQADFVKNLRGQDKISGEKNGEDIDRKTLEGIYDRIKKDELKAGDDHVAQVQRVDRAIVGK---DKPR---LTETPRRLVCYCRLQQVSDP-TKRQSSSARERDVFLFNDMIVVAKGVRRGSTSMAGCTYTLKQWTLLLGAHVTEFQRGQYEFGLTITCPNKDKIHFNARNFEDRCHFVADVTESI 417          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Celegans
Match: bris-1 (BRag/Iqsec/Schizo related Arf GEF family member [Source:UniProtKB/TrEMBL;Acc:U4PLL0])

HSP 1 Score: 57.7658 bits (138), Expect = 1.265e-8
Identity = 65/287 (22.65%), Postives = 122/287 (42.51%), Query Frame = 3
Query:  486 KLGIDLFNFNSECGVDYFQSNGIVNKDKD-LAELFMKKNGFNRSRMSDY---MTDPENLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIFQFLMTFYTSQIHEKS--NRLTREDFIKMLNDSLKSNG------ISRSYALSLYYELSE----VSFDNILDTRTTDLDKVSKLITDLPKEFHLIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSK--RKGGMYDTN-QYRFKQVIKLL 1289
            ++ ++ FN   E GV    + G V    D LA L   + G ++S + +Y   +  P +  +   F  L+D++   V   +++ +++ ++  E +++ +I+   +  Y   N ++            +  F +    + +H  +   R+T+ DF+K L    K +G      I R     +Y  + +       D++   +  D   V K   D P+   L +  R ++C+  L QV  P       S  +R VFLFND ++ +K  R+G        Y  KQ   LL
Sbjct:  150 RIALNFFNKKPERGVQLLTAWGFVKNSPDSLASLLFGRRGLSKSMIGEYIGTLHSPYHSLVLKYFTALIDIRGLEVDVALRKAMQFFILPKEAEKIDRIIQAFALHYSKSNPKRTSHYRGGWDTIHLLSFAIIMLNTDLHSPNVKQRMTQADFVKNLRGQDKISGEKNGEDIDRKTLEGIYDRIKKDELKAGDDHVAQVQRVDRAIVGK---DKPR---LTETPRRLVCYCRLQQVSDP-TKRQSSSARERDVFLFNDMIVVAKGVRRGSTSMAGCTYTLKQWTLLL 429          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Celegans
Match: bris-1 (BRag/Iqsec/Schizo related Arf GEF family member [Source:UniProtKB/TrEMBL;Acc:U4PLL0])

HSP 1 Score: 57.7658 bits (138), Expect = 1.488e-8
Identity = 72/334 (21.56%), Postives = 137/334 (41.02%), Query Frame = 3
Query:  486 KLGIDLFNFNSECGVDYFQSNGIVNKDKD-LAELFMKKNGFNRSRMSDY---MTDPENLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIFQFLMTFYTSQIHEKS--NRLTREDFIKMLNDSLKSNG------ISRSYALSLYYELSE----VSFDNILDTRTTDLDKVSKLITDLPKEFHLIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSK--RKGGMYDTN-QYRFKQVIKLLDIKCAFVKRNGIQLIQISDLSNNILGSFYSKINEDFTNFYTSLEQAI 1430
            ++ ++ FN   E GV    + G V    D LA L   + G ++S + +Y   +  P +  +   F  L+D++   V   +++ +++ ++  E +++ +I+   +  Y   N ++            +  F +    + +H  +   R+T+ DF+K L    K +G      I R     +Y  + +       D++   +  D   V K   D P+   L +  R ++C+  L QV  P       S  +R VFLFND ++ +K  R+G        Y  KQ   LL       +R   +        N     F ++  ED  +F   + ++I
Sbjct:  229 RIALNFFNKKPERGVQLLTAWGFVKNSPDSLASLLFGRRGLSKSMIGEYIGTLHSPYHSLVLKYFTALIDIRGLEVDVALRKAMQFFILPKEAEKIDRIIQAFALHYSKSNPKRTSHYRGGWDTIHLLSFAIIMLNTDLHSPNVKQRMTQADFVKNLRGQDKISGEKNGEDIDRKTLEGIYDRIKKDELKAGDDHVAQVQRVDRAIVGK---DKPR---LTETPRRLVCYCRLQQVSDP-TKRQSSSARERDVFLFNDMIVVAKGVRRGSTSMAGCTYTLKQWTLLLGAHVTEFQRGQYEFGLTITCPNKDKIHFNARNFEDRCHFVADVTESI 555          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Fly
Match: siz (gene:FBgn0026179 transcript:FBtr0078289)

HSP 1 Score: 80.8777 bits (198), Expect = 1.297e-15
Identity = 87/336 (25.89%), Postives = 152/336 (45.24%), Query Frame = 3
Query:  486 KLGIDLFNFNSECGVDYFQSNGIV-NKDKDLAELFMKKNGFNRSRMSDYMTDPEN---LSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILG-LNLEQLTIIFQFLMTFYTSQIH----EKSNRLTREDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPKEFHLIQYYRYVICHVDLCQVILPH-NGSDKISYHDRTVFLFNDCLIT----SKRKGGMYDTNQYRFK---QVIKLLDIK----CAFVKRNGIQLIQISDLSNNILGSFYSKINEDFTNFYTSLEQAI 1430
            ++G++LFN   E G+ Y    G + N  + +A   + + G +R  + +Y+ + +N   +++   F   LDL  + V   ++++  Y  + GE Q++ ++M+  SQ Y   N   DI+G L       +  F +    + +H    +   R+  EDFIK L      + I +   + +Y  +    F    D   T + KV   I    K+ +L   +R ++C+  L ++  P  N  ++   H R VFLFND L+     SK+K  +  T +  F     V+ LLD+     C       IQL Q  D    IL +F ++   D   F   L+++I
Sbjct:  771 RVGLNLFNKKPEKGITYLIRRGFLENTPQGVARFLITRKGLSRQMIGEYLGNLQNQFNMAVLSCFAMELDLSGRQVDVALRKFQAYFRMPGEAQKIERLMEIFSQRYCECN--ADIVGRLRSSDTIFVLAFAIIMLNTDLHTPNLKPERRMRVEDFIKNLRGIDDCHDIDKDMLMGIYDRVKSDEFKPGSD-HVTQVMKVQATIVG--KKPNLALPHRRLVCYCRLYEI--PDVNKKERPGVHQREVFLFNDLLVITKIFSKKKTSVTYTFRNSFPLCGTVVTLLDMPNYPFC-------IQLSQKVD--GKILITFNARNEHDRCKFAEDLKESI 1090          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Fly
Match: siz (gene:FBgn0026179 transcript:FBtr0111038)

HSP 1 Score: 80.8777 bits (198), Expect = 1.411e-15
Identity = 87/336 (25.89%), Postives = 152/336 (45.24%), Query Frame = 3
Query:  486 KLGIDLFNFNSECGVDYFQSNGIV-NKDKDLAELFMKKNGFNRSRMSDYMTDPEN---LSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILG-LNLEQLTIIFQFLMTFYTSQIH----EKSNRLTREDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPKEFHLIQYYRYVICHVDLCQVILPH-NGSDKISYHDRTVFLFNDCLIT----SKRKGGMYDTNQYRFK---QVIKLLDIK----CAFVKRNGIQLIQISDLSNNILGSFYSKINEDFTNFYTSLEQAI 1430
            ++G++LFN   E G+ Y    G + N  + +A   + + G +R  + +Y+ + +N   +++   F   LDL  + V   ++++  Y  + GE Q++ ++M+  SQ Y   N   DI+G L       +  F +    + +H    +   R+  EDFIK L      + I +   + +Y  +    F    D   T + KV   I    K+ +L   +R ++C+  L ++  P  N  ++   H R VFLFND L+     SK+K  +  T +  F     V+ LLD+     C       IQL Q  D    IL +F ++   D   F   L+++I
Sbjct:  656 RVGLNLFNKKPEKGITYLIRRGFLENTPQGVARFLITRKGLSRQMIGEYLGNLQNQFNMAVLSCFAMELDLSGRQVDVALRKFQAYFRMPGEAQKIERLMEIFSQRYCECN--ADIVGRLRSSDTIFVLAFAIIMLNTDLHTPNLKPERRMRVEDFIKNLRGIDDCHDIDKDMLMGIYDRVKSDEFKPGSD-HVTQVMKVQATIVG--KKPNLALPHRRLVCYCRLYEI--PDVNKKERPGVHQREVFLFNDLLVITKIFSKKKTSVTYTFRNSFPLCGTVVTLLDMPNYPFC-------IQLSQKVD--GKILITFNARNEHDRCKFAEDLKESI 975          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Fly
Match: siz (gene:FBgn0026179 transcript:FBtr0078290)

HSP 1 Score: 80.4925 bits (197), Expect = 1.832e-15
Identity = 87/336 (25.89%), Postives = 152/336 (45.24%), Query Frame = 3
Query:  486 KLGIDLFNFNSECGVDYFQSNGIV-NKDKDLAELFMKKNGFNRSRMSDYMTDPEN---LSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILG-LNLEQLTIIFQFLMTFYTSQIH----EKSNRLTREDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPKEFHLIQYYRYVICHVDLCQVILPH-NGSDKISYHDRTVFLFNDCLIT----SKRKGGMYDTNQYRFK---QVIKLLDIK----CAFVKRNGIQLIQISDLSNNILGSFYSKINEDFTNFYTSLEQAI 1430
            ++G++LFN   E G+ Y    G + N  + +A   + + G +R  + +Y+ + +N   +++   F   LDL  + V   ++++  Y  + GE Q++ ++M+  SQ Y   N   DI+G L       +  F +    + +H    +   R+  EDFIK L      + I +   + +Y  +    F    D   T + KV   I    K+ +L   +R ++C+  L ++  P  N  ++   H R VFLFND L+     SK+K  +  T +  F     V+ LLD+     C       IQL Q  D    IL +F ++   D   F   L+++I
Sbjct:  759 RVGLNLFNKKPEKGITYLIRRGFLENTPQGVARFLITRKGLSRQMIGEYLGNLQNQFNMAVLSCFAMELDLSGRQVDVALRKFQAYFRMPGEAQKIERLMEIFSQRYCECN--ADIVGRLRSSDTIFVLAFAIIMLNTDLHTPNLKPERRMRVEDFIKNLRGIDDCHDIDKDMLMGIYDRVKSDEFKPGSD-HVTQVMKVQATIVG--KKPNLALPHRRLVCYCRLYEI--PDVNKKERPGVHQREVFLFNDLLVITKIFSKKKTSVTYTFRNSFPLCGTVVTLLDMPNYPFC-------IQLSQKVD--GKILITFNARNEHDRCKFAEDLKESI 1078          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Fly
Match: siz (gene:FBgn0026179 transcript:FBtr0301602)

HSP 1 Score: 80.4925 bits (197), Expect = 1.902e-15
Identity = 87/336 (25.89%), Postives = 152/336 (45.24%), Query Frame = 3
Query:  486 KLGIDLFNFNSECGVDYFQSNGIV-NKDKDLAELFMKKNGFNRSRMSDYMTDPEN---LSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILG-LNLEQLTIIFQFLMTFYTSQIH----EKSNRLTREDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPKEFHLIQYYRYVICHVDLCQVILPH-NGSDKISYHDRTVFLFNDCLIT----SKRKGGMYDTNQYRFK---QVIKLLDIK----CAFVKRNGIQLIQISDLSNNILGSFYSKINEDFTNFYTSLEQAI 1430
            ++G++LFN   E G+ Y    G + N  + +A   + + G +R  + +Y+ + +N   +++   F   LDL  + V   ++++  Y  + GE Q++ ++M+  SQ Y   N   DI+G L       +  F +    + +H    +   R+  EDFIK L      + I +   + +Y  +    F    D   T + KV   I    K+ +L   +R ++C+  L ++  P  N  ++   H R VFLFND L+     SK+K  +  T +  F     V+ LLD+     C       IQL Q  D    IL +F ++   D   F   L+++I
Sbjct:  666 RVGLNLFNKKPEKGITYLIRRGFLENTPQGVARFLITRKGLSRQMIGEYLGNLQNQFNMAVLSCFAMELDLSGRQVDVALRKFQAYFRMPGEAQKIERLMEIFSQRYCECN--ADIVGRLRSSDTIFVLAFAIIMLNTDLHTPNLKPERRMRVEDFIKNLRGIDDCHDIDKDMLMGIYDRVKSDEFKPGSD-HVTQVMKVQATIVG--KKPNLALPHRRLVCYCRLYEI--PDVNKKERPGVHQREVFLFNDLLVITKIFSKKKTSVTYTFRNSFPLCGTVVTLLDMPNYPFC-------IQLSQKVD--GKILITFNARNEHDRCKFAEDLKESI 985          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Fly
Match: step (gene:FBgn0086779 transcript:FBtr0085910)

HSP 1 Score: 52.373 bits (124), Expect = 5.946e-7
Identity = 44/186 (23.66%), Postives = 89/186 (47.85%), Query Frame = 3
Query:  477 QHIKLGIDLFNFNSECGVDYFQSNGIVNKD-KDLAELFMKKNGFNRSRMSDYMTDPENLSIHI--AFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIFQFLMTFYTSQIHEKS--NRLTREDFIKMLNDSLKSNG-ISRSYALSLYYELSEVSF 1016
            + + +G   FN + + G++Y   N ++  D +D+A    K  G N++ + DY+ +  + +  +  AF  L D     +V+ ++++L    + GE Q++ ++M+  +Q Y    L  DI   N +   ++  F +    + +H  S  ++ T + FI M N  + + G + R    SLY  +    F
Sbjct:   80 KQMSIGRKKFNMDPKKGIEYLVENRLLRHDPQDVAHFLYKGEGLNKTAIGDYLGEKNDFNEDVLKAFVALHDFTNLILVQALRQFLWSFRLPGEAQKIDRMMETFAQRYC--QLNPDIF-TNTDTCYVL-SFAIIMLNTSLHNPSVKDKPTVDQFISM-NRGINNGGDLPRGLLESLYESIRTEPF 260          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Zebrafish
Match: IQSEC1 (IQ motif and Sec7 domain ArfGEF 1a [Source:NCBI gene;Acc:100334106])

HSP 1 Score: 73.1738 bits (178), Expect = 4.640e-13
Identity = 78/338 (23.08%), Postives = 149/338 (44.08%), Query Frame = 3
Query:  486 KLGIDLFNFNSECGVDYFQSNG-IVNKDKDLAELFMKKNGFNRSRMSDYMTDPE---NLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTI-IFQFLMTFYTSQIHEKSNRLTR----EDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPK--EFH------LIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKLLDIKCAFVK----RNGIQLIQ-ISDLSNNILGSFYSKINEDFTNFYTSLEQAIG 1433
            ++G++LFN   E G+ Y    G I +    +A   +++ G +R  + +++ + +   N  +     + LD     + E ++++     ++GE Q+V ++++  SQ Y   N   D++       TI I  F +    + ++  + ++ R    EDF+K L        I R   + +Y  + +       D   + + KV KLI    +    H      L Q +R ++C+  L +V  P N   K+  H R +FLFND L+ +K      ++  Y F+Q   L  ++    +     NGI+L   I      +L +F +   +D   F + L ++I 
Sbjct:  468 RIGLNLFNKKPEKGIQYLTERGFIPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDELDFSGMELDEALRKFQAQIRVQGEAQKVERLIEAFSQRYCICN--HDVVRQFRNPDTIFILAFAIILLNTDMYSPNVKIERKMKLEDFVKNLRGVDDGEDIPREMLVGIYERIQKKELKTNED-HVSQVQKVEKLIVGKKQMGSLHHGLGCVLSQAHRRLVCYCRLFEVPDP-NRLQKLGQHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVMLFENQFYPNGIRLTSAIPGADFKVLINFNAPNIQDRKRFISDLRESIA 801          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Zebrafish
Match: IQSEC1 (IQ motif and Sec7 domain ArfGEF 1a [Source:NCBI gene;Acc:100334106])

HSP 1 Score: 72.7886 bits (177), Expect = 5.134e-13
Identity = 78/338 (23.08%), Postives = 149/338 (44.08%), Query Frame = 3
Query:  486 KLGIDLFNFNSECGVDYFQSNG-IVNKDKDLAELFMKKNGFNRSRMSDYMTDPE---NLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTI-IFQFLMTFYTSQIHEKSNRLTR----EDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPK--EFH------LIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKLLDIKCAFVK----RNGIQLIQ-ISDLSNNILGSFYSKINEDFTNFYTSLEQAIG 1433
            ++G++LFN   E G+ Y    G I +    +A   +++ G +R  + +++ + +   N  +     + LD     + E ++++     ++GE Q+V ++++  SQ Y   N   D++       TI I  F +    + ++  + ++ R    EDF+K L        I R   + +Y  + +       D   + + KV KLI    +    H      L Q +R ++C+  L +V  P N   K+  H R +FLFND L+ +K      ++  Y F+Q   L  ++    +     NGI+L   I      +L +F +   +D   F + L ++I 
Sbjct:  519 RIGLNLFNKKPEKGIQYLTERGFIPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDELDFSGMELDEALRKFQAQIRVQGEAQKVERLIEAFSQRYCICN--HDVVRQFRNPDTIFILAFAIILLNTDMYSPNVKIERKMKLEDFVKNLRGVDDGEDIPREMLVGIYERIQKKELKTNED-HVSQVQKVEKLIVGKKQMGSLHHGLGCVLSQAHRRLVCYCRLFEVPDP-NRLQKLGQHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVMLFENQFYPNGIRLTSAIPGADFKVLINFNAPNIQDRKRFISDLRESIA 852          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Zebrafish
Match: iqsec2a (IQ motif and Sec7 domain ArfGEF 2a [Source:ZFIN;Acc:ZDB-GENE-170302-3])

HSP 1 Score: 71.633 bits (174), Expect = 1.348e-12
Identity = 70/332 (21.08%), Postives = 144/332 (43.37%), Query Frame = 3
Query:  477 QHIKLGIDLFNFNSECGVDYFQSNGIVNKDK-DLAELFMKKNGFNRSRMSDYMTDPE---NLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIFQFLMTFYTSQIHEKSNRLTR----EDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPKEFHLIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKLLDIKCAFVKRN----GIQLIQ-ISDLSNNILGSFYSKINEDFTNFYTSLEQAIG 1433
            +H ++G++LFN   E G+ Y    G V+     +A   +++ G +R  + +++ + +   N  +     + +D     + + ++++     ++GE Q+V ++++  SQ Y   N    +          I  F +    + ++  + +  R    EDFIK L        I R   + +Y  + +       D   + +  V ++I  + K+  L   +R ++C   L +V  P N   +   H R VFLFND L+ +K       +  Y F+Q   L++++    + +    GI+L   +      +L  F +   +D T F + L ++I 
Sbjct:  725 RHYRIGLNLFNKKPEKGIQYLIERGFVSDTPVGIARFILERKGLSRQMIGEFLGNRQKQFNKDVLDCVLDEMDFSGMDLDDALRKFQAQIKVQGEAQKVERLVEAFSQRYCVCN-PALVRQFQNPDTIFILAFAIILLNTDMYSPNVKAERKMKLEDFIKNLRGVDNGQDIPRDLLVGIYQRIQKWEL-RTNDDHVSQVQAVERVI--VGKKPVLSLPHRRLVCCCQLYEVPDP-NRPQRSGVHQREVFLFNDLLVVTKIFQKKKTSVTYSFRQSFPLVEMQVHMFQNSYYAHGIRLTSAMPGAERKVLIVFNAPSQQDRTRFTSDLRESIA 1051          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Zebrafish
Match: iqsec2a (IQ motif and Sec7 domain ArfGEF 2a [Source:ZFIN;Acc:ZDB-GENE-170302-3])

HSP 1 Score: 68.9366 bits (167), Expect = 8.694e-12
Identity = 72/334 (21.56%), Postives = 145/334 (43.41%), Query Frame = 3
Query:  477 QHIKLGIDLFNFNSECGVDYFQSNGIVNKDK-DLAELFMKKNGFNRSRMSDYMTDPE---NLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIF--QFLMTFYTSQIHEKSNRLTR----EDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPKEFHLIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKLLDIKCAFVKRN----GIQLIQ-ISDLSNNILGSFYSKINEDFTNFYTSLEQAIG 1433
            +H ++G++LFN   E G+ Y    G V+     +A   +++ G +R  + +++ + +   N  +     + +D     + + ++++     ++GE Q+V ++++  SQ Y   N     L    +    IF   F +    + ++  + +  R    EDFIK L        I R   + +Y  + +       D   + +  V ++I    K+  L   +R ++C   L +V  P N   +   H R VFLFND L+ +K       +  Y F+Q   L++++    + +    GI+L   +      +L  F +   +D T F + L ++I 
Sbjct:  725 RHYRIGLNLFNKKPEKGIQYLIERGFVSDTPVGIARFILERKGLSRQMIGEFLGNRQKQFNKDVLDCVLDEMDFSGMDLDDALRKFQAQIKVQGEAQKVERLVEAFSQRYCVCN---PALVRQFQNPDTIFILAFAIILLNTDMYSPNVKAERKMKLEDFIKNLRGVDNGQDIPRDLLVGIYQRIQKWEL-RTNDDHVSQVQAVERVIVG--KKPVLSLPHRRLVCCCQLYEVPDP-NRPQRSGVHQREVFLFNDLLVVTKIFQKKKTSVTYSFRQSFPLVEMQVHMFQNSYYAHGIRLTSAMPGAERKVLIVFNAPSQQDRTRFTSDLRESIA 1051          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Zebrafish
Match: iqsec2a (IQ motif and Sec7 domain ArfGEF 2a [Source:ZFIN;Acc:ZDB-GENE-170302-3])

HSP 1 Score: 68.9366 bits (167), Expect = 8.905e-12
Identity = 72/334 (21.56%), Postives = 145/334 (43.41%), Query Frame = 3
Query:  477 QHIKLGIDLFNFNSECGVDYFQSNGIVNKDK-DLAELFMKKNGFNRSRMSDYMTDPE---NLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIF--QFLMTFYTSQIHEKSNRLTR----EDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPKEFHLIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKLLDIKCAFVK----RNGIQLIQ-ISDLSNNILGSFYSKINEDFTNFYTSLEQAIG 1433
            +H ++G++LFN   E G+ Y    G V+     +A   +++ G +R  + +++ + +   N  +     + +D     + + ++++     ++GE Q+V ++++  SQ Y   N     L    +    IF   F +    + ++  + +  R    EDFIK L        I R   + +Y  + +       D   + +  V ++I    K+  L   +R ++C   L +V  P N   +   H R VFLFND L+ +K       +  Y F+Q   L++++    +     +GI+L   +      +L  F +   +D T F + L ++I 
Sbjct:  587 RHYRIGLNLFNKKPEKGIQYLIERGFVSDTPVGIARFILERKGLSRQMIGEFLGNRQKQFNKDVLDCVLDEMDFSGMDLDDALRKFQAQIKVQGEAQKVERLVEAFSQRYCVCN---PALVRQFQNPDTIFILAFAIILLNTDMYSPNVKAERKMKLEDFIKNLRGVDNGQDIPRDLLVGIYQRIQKWEL-RTNDDHVSQVQAVERVIVG--KKPVLSLPHRRLVCCCQLYEVPDP-NRPQRSGVHQREVFLFNDLLVVTKIFQKKKTSVTYSFRQSFPLVEMQVHMFQNSYYAHGIRLTSAMPGAERKVLIVFNAPSQQDRTRFTSDLRESIA 913          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Xenopus
Match: IQSEC2 (IQ motif and Sec7 domain 2 [Source:NCBI gene;Acc:100485600])

HSP 1 Score: 67.0106 bits (162), Expect = 4.880e-11
Identity = 73/333 (21.92%), Postives = 147/333 (44.14%), Query Frame = 3
Query:  486 KLGIDLFNFNSECGVDYFQSNGIVNKDK-DLAELFMKKNGFNRSRMSDYMTDPE---NLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIF--QFLMTFYTSQIHEKSNRLTR----EDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPKEFHLIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSK--RKGGMYDTNQYRFKQVIKLLDIKCAFVKRN----GIQLIQ-ISDLSNNILGSFYSKINEDFTNFYTSLEQAIG 1433
            ++G++LFN   E G+ Y    G ++     +A   +++ G +R  + +++ + +   N  +     + +D     + E ++++  +  ++GE Q+V ++++  SQ Y   N    +L         IF   F +    + ++  S +  R    +DFIK L        I R   + +Y  +         D   + +  V ++I    K+  L   +R ++C   L +V  P N   ++  H R VFLFND L+ +K  +K  +  T  Y F+Q   L+D++    + +    GI+L+  +      +L  F +   +D   F + L ++I 
Sbjct:  481 RIGLNLFNKKPEKGIQYLIERGFLSDTPVGVAHFILERKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSNMDLDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCVCN---PVLVRQFRNPDTIFILAFAIILLNTDMYSPSVKPERKMKLDDFIKNLRGVDNGEDIPRDLLVGIYQRIQGREL-RTNDDHVSQVQAVERMIVG--KKPVLSLPHRRLVCCCQLYEVPDP-NRPQRMGLHQREVFLFNDLLVVTKIFQKKKILVT--YSFRQSFPLVDMQMQLFQNSYYQYGIKLLSAVPGGERKVLIIFNAPSLQDRLRFTSDLRESIA 804          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Xenopus
Match: IQSEC2 (IQ motif and Sec7 domain 2 [Source:NCBI gene;Acc:100485600])

HSP 1 Score: 67.0106 bits (162), Expect = 5.320e-11
Identity = 73/333 (21.92%), Postives = 147/333 (44.14%), Query Frame = 3
Query:  486 KLGIDLFNFNSECGVDYFQSNGIVNKDK-DLAELFMKKNGFNRSRMSDYMTDPE---NLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIF--QFLMTFYTSQIHEKSNRLTR----EDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPKEFHLIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSK--RKGGMYDTNQYRFKQVIKLLDIKCAFVKRN----GIQLIQ-ISDLSNNILGSFYSKINEDFTNFYTSLEQAIG 1433
            ++G++LFN   E G+ Y    G ++     +A   +++ G +R  + +++ + +   N  +     + +D     + E ++++  +  ++GE Q+V ++++  SQ Y   N    +L         IF   F +    + ++  S +  R    +DFIK L        I R   + +Y  +         D   + +  V ++I    K+  L   +R ++C   L +V  P N   ++  H R VFLFND L+ +K  +K  +  T  Y F+Q   L+D++    + +    GI+L+  +      +L  F +   +D   F + L ++I 
Sbjct:  526 RIGLNLFNKKPEKGIQYLIERGFLSDTPVGVAHFILERKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSNMDLDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCVCN---PVLVRQFRNPDTIFILAFAIILLNTDMYSPSVKPERKMKLDDFIKNLRGVDNGEDIPRDLLVGIYQRIQGREL-RTNDDHVSQVQAVERMIVG--KKPVLSLPHRRLVCCCQLYEVPDP-NRPQRMGLHQREVFLFNDLLVVTKIFQKKKILVT--YSFRQSFPLVDMQMQLFQNSYYQYGIKLLSAVPGGERKVLIIFNAPSLQDRLRFTSDLRESIA 849          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Xenopus
Match: IQSEC2 (IQ motif and Sec7 domain 2 [Source:NCBI gene;Acc:100485600])

HSP 1 Score: 67.0106 bits (162), Expect = 5.689e-11
Identity = 73/333 (21.92%), Postives = 147/333 (44.14%), Query Frame = 3
Query:  486 KLGIDLFNFNSECGVDYFQSNGIVNKDK-DLAELFMKKNGFNRSRMSDYMTDPE---NLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIF--QFLMTFYTSQIHEKSNRLTR----EDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPKEFHLIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSK--RKGGMYDTNQYRFKQVIKLLDIKCAFVKRN----GIQLIQ-ISDLSNNILGSFYSKINEDFTNFYTSLEQAIG 1433
            ++G++LFN   E G+ Y    G ++     +A   +++ G +R  + +++ + +   N  +     + +D     + E ++++  +  ++GE Q+V ++++  SQ Y   N    +L         IF   F +    + ++  S +  R    +DFIK L        I R   + +Y  +         D   + +  V ++I    K+  L   +R ++C   L +V  P N   ++  H R VFLFND L+ +K  +K  +  T  Y F+Q   L+D++    + +    GI+L+  +      +L  F +   +D   F + L ++I 
Sbjct:  518 RIGLNLFNKKPEKGIQYLIERGFLSDTPVGVAHFILERKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSNMDLDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCVCN---PVLVRQFRNPDTIFILAFAIILLNTDMYSPSVKPERKMKLDDFIKNLRGVDNGEDIPRDLLVGIYQRIQGREL-RTNDDHVSQVQAVERMIVG--KKPVLSLPHRRLVCCCQLYEVPDP-NRPQRMGLHQREVFLFNDLLVVTKIFQKKKILVT--YSFRQSFPLVDMQMQLFQNSYYQYGIKLLSAVPGGERKVLIIFNAPSLQDRLRFTSDLRESIA 841          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Xenopus
Match: IQSEC2 (IQ motif and Sec7 domain 2 [Source:NCBI gene;Acc:100485600])

HSP 1 Score: 66.6254 bits (161), Expect = 6.728e-11
Identity = 73/333 (21.92%), Postives = 147/333 (44.14%), Query Frame = 3
Query:  486 KLGIDLFNFNSECGVDYFQSNGIVNKDK-DLAELFMKKNGFNRSRMSDYMTDPE---NLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIF--QFLMTFYTSQIHEKSNRLTR----EDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPKEFHLIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSK--RKGGMYDTNQYRFKQVIKLLDIKCAFVKRN----GIQLIQ-ISDLSNNILGSFYSKINEDFTNFYTSLEQAIG 1433
            ++G++LFN   E G+ Y    G ++     +A   +++ G +R  + +++ + +   N  +     + +D     + E ++++  +  ++GE Q+V ++++  SQ Y   N    +L         IF   F +    + ++  S +  R    +DFIK L        I R   + +Y  +         D   + +  V ++I    K+  L   +R ++C   L +V  P N   ++  H R VFLFND L+ +K  +K  +  T  Y F+Q   L+D++    + +    GI+L+  +      +L  F +   +D   F + L ++I 
Sbjct:  481 RIGLNLFNKKPEKGIQYLIERGFLSDTPVGVAHFILERKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSNMDLDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCVCN---PVLVRQFRNPDTIFILAFAIILLNTDMYSPSVKPERKMKLDDFIKNLRGVDNGEDIPRDLLVGIYQRIQGREL-RTNDDHVSQVQAVERMIVG--KKPVLSLPHRRLVCCCQLYEVPDP-NRPQRMGLHQREVFLFNDLLVVTKIFQKKKILVT--YSFRQSFPLVDMQMQLFQNSYYQYGIKLLSAVPGGERKVLIIFNAPSLQDRLRFTSDLRESIA 804          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Xenopus
Match: IQSEC2 (IQ motif and Sec7 domain 2 [Source:NCBI gene;Acc:100485600])

HSP 1 Score: 66.6254 bits (161), Expect = 7.271e-11
Identity = 73/333 (21.92%), Postives = 147/333 (44.14%), Query Frame = 3
Query:  486 KLGIDLFNFNSECGVDYFQSNGIVNKDK-DLAELFMKKNGFNRSRMSDYMTDPE---NLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIF--QFLMTFYTSQIHEKSNRLTR----EDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPKEFHLIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSK--RKGGMYDTNQYRFKQVIKLLDIKCAFVKRN----GIQLIQ-ISDLSNNILGSFYSKINEDFTNFYTSLEQAIG 1433
            ++G++LFN   E G+ Y    G ++     +A   +++ G +R  + +++ + +   N  +     + +D     + E ++++  +  ++GE Q+V ++++  SQ Y   N    +L         IF   F +    + ++  S +  R    +DFIK L        I R   + +Y  +         D   + +  V ++I    K+  L   +R ++C   L +V  P N   ++  H R VFLFND L+ +K  +K  +  T  Y F+Q   L+D++    + +    GI+L+  +      +L  F +   +D   F + L ++I 
Sbjct:  602 RIGLNLFNKKPEKGIQYLIERGFLSDTPVGVAHFILERKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSNMDLDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCVCN---PVLVRQFRNPDTIFILAFAIILLNTDMYSPSVKPERKMKLDDFIKNLRGVDNGEDIPRDLLVGIYQRIQGREL-RTNDDHVSQVQAVERMIVG--KKPVLSLPHRRLVCCCQLYEVPDP-NRPQRMGLHQREVFLFNDLLVVTKIFQKKKILVT--YSFRQSFPLVDMQMQLFQNSYYQYGIKLLSAVPGGERKVLIIFNAPSLQDRLRFTSDLRESIA 925          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Mouse
Match: Iqsec1 (IQ motif and Sec7 domain 1 [Source:MGI Symbol;Acc:MGI:1196356])

HSP 1 Score: 68.5514 bits (166), Expect = 1.368e-11
Identity = 72/340 (21.18%), Postives = 144/340 (42.35%), Query Frame = 3
Query:  477 QHIKLGIDLFNFNSECGVDYFQSNGIV-NKDKDLAELFMKKNGFNRSRMSDYMTDPE---NLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIFQFLMTFYTSQIHEKSNRLTR----EDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPK--EFH------LIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKLLDIKCAFVK----RNGIQLIQ-ISDLSNNILGSFYSKINEDFTNFYTSLEQAIG 1433
            +H ++G++LFN   E G+ Y    G V +    +A   +++ G +R  + +++ + +   N  +     + +D     + E ++++  +  ++GE Q+V ++++  SQ Y   N    +          I  F +    + ++  + +  R    EDF+K L        I R   + +Y  + +       D   + + KV KLI         H      L   +R ++C+  L +V  P N   K+  H R +FLFND L+ +K      ++  Y F+Q   L  ++    +     NGI+L   +      +L +F +   +D   F   L +++ 
Sbjct:  524 RHYRIGLNLFNKKPEKGIQYLIERGFVPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSAMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCVCN-PGVVRQFRNPDTIFILAFAIILLNTDMYSPNVKPERKMKLEDFVKNLRGVDDGEDIPRETLIGIYERIRKRELKTNED-HVSQVQKVEKLIVGKKPIGSLHHGLGCVLSLPHRRLVCYCRLFEVPDP-NKPQKLGLHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSAVPGADIKVLINFNAPNPQDRKKFTDDLRESVA 860          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Mouse
Match: Iqsec1 (IQ motif and Sec7 domain 1 [Source:MGI Symbol;Acc:MGI:1196356])

HSP 1 Score: 68.5514 bits (166), Expect = 1.384e-11
Identity = 71/341 (20.82%), Postives = 145/341 (42.52%), Query Frame = 3
Query:  477 QHIKLGIDLFNFNSECGVDYFQSNGIV-NKDKDLAELFMKKNGFNRSRMSDYMTDPE---NLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIFQFLMTFYTSQIHEKSNRLTR----EDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPKEFHLIQY---------YRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKLLDIKCAFVK----RNGIQLIQ-ISDLSNNILGSFYSKINEDFTNFYTSLEQAIG 1433
            +H ++G++LFN   E G+ Y    G V +    +A   +++ G +R  + +++ + +   N  +     + +D     + E ++++  +  ++GE Q+V ++++  SQ Y   N    +          I  F +    + ++  + +  R    EDF+K L        I R   + +Y  + +       D   + + KV KLI    K    + +         +R ++C+  L +V  P N   K+  H R +FLFND L+ +K      ++  Y F+Q   L  ++    +     NGI+L   +      +L +F +   +D   F   L +++ 
Sbjct:  510 RHYRIGLNLFNKKPEKGIQYLIERGFVPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSAMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCVCN-PGVVRQFRNPDTIFILAFAIILLNTDMYSPNVKPERKMKLEDFVKNLRGVDDGEDIPRETLIGIYERIRKRELKTNED-HVSQVQKVEKLIVGK-KPIGSLHHGLGCVLSLPHRRLVCYCRLFEVPDP-NKPQKLGLHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSAVPGADIKVLINFNAPNPQDRKKFTDDLRESVA 846          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Mouse
Match: Iqsec1 (IQ motif and Sec7 domain 1 [Source:MGI Symbol;Acc:MGI:1196356])

HSP 1 Score: 68.1662 bits (165), Expect = 1.540e-11
Identity = 72/340 (21.18%), Postives = 144/340 (42.35%), Query Frame = 3
Query:  477 QHIKLGIDLFNFNSECGVDYFQSNGIV-NKDKDLAELFMKKNGFNRSRMSDYMTDPE---NLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIFQFLMTFYTSQIHEKSNRLTR----EDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPK--EFH------LIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKLLDIKCAFVK----RNGIQLIQ-ISDLSNNILGSFYSKINEDFTNFYTSLEQAIG 1433
            +H ++G++LFN   E G+ Y    G V +    +A   +++ G +R  + +++ + +   N  +     + +D     + E ++++  +  ++GE Q+V ++++  SQ Y   N    +          I  F +    + ++  + +  R    EDF+K L        I R   + +Y  + +       D   + + KV KLI         H      L   +R ++C+  L +V  P N   K+  H R +FLFND L+ +K      ++  Y F+Q   L  ++    +     NGI+L   +      +L +F +   +D   F   L +++ 
Sbjct:  614 RHYRIGLNLFNKKPEKGIQYLIERGFVPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSAMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCVCN-PGVVRQFRNPDTIFILAFAIILLNTDMYSPNVKPERKMKLEDFVKNLRGVDDGEDIPRETLIGIYERIRKRELKTNED-HVSQVQKVEKLIVGKKPIGSLHHGLGCVLSLPHRRLVCYCRLFEVPDP-NKPQKLGLHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSAVPGADIKVLINFNAPNPQDRKKFTDDLRESVA 950          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Mouse
Match: Iqsec2 (IQ motif and Sec7 domain 2 [Source:MGI Symbol;Acc:MGI:3528396])

HSP 1 Score: 65.855 bits (159), Expect = 8.102e-11
Identity = 71/336 (21.13%), Postives = 148/336 (44.05%), Query Frame = 3
Query:  477 QHIKLGIDLFNFNSECGVDYFQSNGIVNKDK-DLAELFMKKNGFNRSRMSDYMTDPE---NLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYF--NQNLEKDILGLNLEQLTIIFQFLMTFYTSQIHEKSNRLTR----EDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPKEFHLIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSK--RKGGMYDTNQYRFKQVIKLLDIKCAFVKRN----GIQLIQ-ISDLSNNILGSFYSKINEDFTNFYTSLEQAIG 1433
            +H ++G++LFN   E G+ Y    G ++     +A   +++ G +R  + +++ + +   N  +     + +D     + + ++++  +  ++GE Q+V ++++  SQ Y   N  L +     +      I  F +    + ++  S +  R    +DFIK L        I R   + +Y  +         D   + +  V ++I    K+  L   +R ++C   L +V  P N   ++  H R VFLFND L+ +K  +K  +  T  Y F+Q   L+++     + +    GI+L+  +      +L  F +   +D   F + L ++I 
Sbjct:  550 RHYRIGLNLFNKKPEKGIQYLIERGFLSDTPVGVAHFILERKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSSMDLDDALRKFQSHIRVQGEAQKVERLIEAFSQRYCVCNPALVRQFRNPDT---IFILAFAIILLNTDMYSPSVKAERKMKLDDFIKNLRGVDNGEDIPRDLLVGIYQRIQGREL-RTNDDHVSQVQAVERMIVG--KKPVLSLPHRRLVCCCQLYEVPDP-NRPQRLGLHQREVFLFNDLLVVTKIFQKKKILVT--YSFRQSFPLVEMHMQLFQNSYYQFGIKLLSAVPGGERKVLIIFNAPSLQDRLRFTSDLRESIA 876          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Mouse
Match: Iqsec2 (IQ motif and Sec7 domain 2 [Source:MGI Symbol;Acc:MGI:3528396])

HSP 1 Score: 65.0846 bits (157), Expect = 1.796e-10
Identity = 71/335 (21.19%), Postives = 148/335 (44.18%), Query Frame = 3
Query:  477 QHIKLGIDLFNFNSECGVDYFQSNGIVNKDK-DLAELFMKKNGFNRSRMSDYMTDPE---NLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYF--NQNLEKDILGLNLEQLTIIFQFLMTFYTSQIHEKSNRLTR----EDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPKEFHLIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSK--RKGGMYDTNQYRFKQVIKLLDIKCAFVKRN----GIQLIQ-ISDLSNNILGSFYSKINEDFTNFYTSLEQAI 1430
            +H ++G++LFN   E G+ Y    G ++     +A   +++ G +R  + +++ + +   N  +     + +D     + + ++++  +  ++GE Q+V ++++  SQ Y   N  L +     +      I  F +    + ++  S +  R    +DFIK L        I R   + +Y  +         D   + +  V ++I    K+  L   +R ++C   L +V  P N   ++  H R VFLFND L+ +K  +K  +  T  Y F+Q   L+++     + +    GI+L+  +      +L  F +   +D   F + L ++I
Sbjct:  755 RHYRIGLNLFNKKPEKGIQYLIERGFLSDTPVGVAHFILERKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSSMDLDDALRKFQSHIRVQGEAQKVERLIEAFSQRYCVCNPALVRQFRNPDT---IFILAFAIILLNTDMYSPSVKAERKMKLDDFIKNLRGVDNGEDIPRDLLVGIYQRIQGREL-RTNDDHVSQVQAVERMIVG--KKPVLSLPHRRLVCCCQLYEVPDP-NRPQRLGLHQREVFLFNDLLVVTKIFQKKKILVT--YSFRQSFPLVEMHMQLFQNSYYQFGIKLLSAVPGGERKVLIIFNAPSLQDRLRFTSDLRESI 1080          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q6DN90|IQEC1_HUMAN (IQ motif and SEC7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=IQSEC1 PE=1 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 2.727e-11
Identity = 75/340 (22.06%), Postives = 144/340 (42.35%), Query Frame = 3
Query:  477 QHIKLGIDLFNFNSECGVDYFQSNGIV-NKDKDLAELFMKKNGFNRSRMSDYMTDPE---NLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIFQFLMTFYTSQIHEKSNRLTR----EDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPK--EFH------LIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKLLDIKCAFVK----RNGIQLI-QISDLSNNILGSFYSKINEDFTNFYTSLEQAIG 1433
            +H ++G++LFN   E GV Y    G V +    +A   +++ G +R  + +++ + +   N  +     + +D     + E ++++  +  ++GE Q+V ++++  SQ Y   N    +          I  F +    + ++  + +  R    EDFIK L        I R   + +Y  + +       D   + + KV KLI         H      L   +R ++C+  L +V  P N   K+  H R +FLFND L+ +K      ++  Y F+Q   L  ++    +     NGI+L   +      +L +F +   +D   F   L ++I 
Sbjct:  526 RHYRIGLNLFNKKPEKGVQYLIERGFVPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSTMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCICN-PGVVRQFRNPDTIFILAFAIILLNTDMYSPNVKPERKMKLEDFIKNLRGVDDGEDIPREMLMGIYERIRKRELKTNED-HVSQVQKVEKLIVGKKPIGSLHPGLGCVLSLPHRRLVCYCRLFEVPDP-NKPQKLGLHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSSVPGADIKVLINFNAPNPQDRKKFTDDLRESIA 862          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q8R0S2|IQEC1_MOUSE (IQ motif and SEC7 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Iqsec1 PE=1 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 9.571e-11
Identity = 72/340 (21.18%), Postives = 144/340 (42.35%), Query Frame = 3
Query:  477 QHIKLGIDLFNFNSECGVDYFQSNGIV-NKDKDLAELFMKKNGFNRSRMSDYMTDPE---NLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIFQFLMTFYTSQIHEKSNRLTR----EDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPK--EFH------LIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKLLDIKCAFVK----RNGIQLIQ-ISDLSNNILGSFYSKINEDFTNFYTSLEQAIG 1433
            +H ++G++LFN   E G+ Y    G V +    +A   +++ G +R  + +++ + +   N  +     + +D     + E ++++  +  ++GE Q+V ++++  SQ Y   N    +          I  F +    + ++  + +  R    EDF+K L        I R   + +Y  + +       D   + + KV KLI         H      L   +R ++C+  L +V  P N   K+  H R +FLFND L+ +K      ++  Y F+Q   L  ++    +     NGI+L   +      +L +F +   +D   F   L +++ 
Sbjct:  524 RHYRIGLNLFNKKPEKGIQYLIERGFVPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSAMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCVCN-PGVVRQFRNPDTIFILAFAIILLNTDMYSPNVKPERKMKLEDFVKNLRGVDDGEDIPRETLIGIYERIRKRELKTNED-HVSQVQKVEKLIVGKKPIGSLHHGLGCVLSLPHRRLVCYCRLFEVPDP-NKPQKLGLHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSAVPGADIKVLINFNAPNPQDRKKFTDDLRESVA 860          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q5DU25|IQEC2_MOUSE (IQ motif and SEC7 domain-containing protein 2 OS=Mus musculus OX=10090 GN=Iqsec2 PE=1 SV=3)

HSP 1 Score: 63.929 bits (154), Expect = 2.563e-9
Identity = 71/335 (21.19%), Postives = 148/335 (44.18%), Query Frame = 3
Query:  477 QHIKLGIDLFNFNSECGVDYFQSNGIVNKDK-DLAELFMKKNGFNRSRMSDYMTDPE---NLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYF--NQNLEKDILGLNLEQLTIIFQFLMTFYTSQIHEKSNRLTR----EDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPKEFHLIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSK--RKGGMYDTNQYRFKQVIKLLDIKCAFVKRN----GIQLIQ-ISDLSNNILGSFYSKINEDFTNFYTSLEQAI 1430
            +H ++G++LFN   E G+ Y    G ++     +A   +++ G +R  + +++ + +   N  +     + +D     + + ++++  +  ++GE Q+V ++++  SQ Y   N  L +     +      I  F +    + ++  S +  R    +DFIK L        I R   + +Y  +         D   + +  V ++I    K+  L   +R ++C   L +V  P N   ++  H R VFLFND L+ +K  +K  +  T  Y F+Q   L+++     + +    GI+L+  +      +L  F +   +D   F + L ++I
Sbjct:  745 RHYRIGLNLFNKKPEKGIQYLIERGFLSDTPVGVAHFILERKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSSMDLDDALRKFQSHIRVQGEAQKVERLIEAFSQRYCVCNPALVRQFRNPDT---IFILAFAIILLNTDMYSPSVKAERKMKLDDFIKNLRGVDNGEDIPRDLLVGIYQRIQGREL-RTNDDHVSQVQAVERMIVG--KKPVLSLPHRRLVCCCQLYEVPDP-NRPQRLGLHQREVFLFNDLLVVTKIFQKKKILVT--YSFRQSFPLVEMHMQLFQNSYYQFGIKLLSAVPGGERKVLIIFNAPSLQDRLRFTSDLRESI 1070          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q5JU85|IQEC2_HUMAN (IQ motif and SEC7 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=IQSEC2 PE=1 SV=2)

HSP 1 Score: 63.929 bits (154), Expect = 2.589e-9
Identity = 71/335 (21.19%), Postives = 148/335 (44.18%), Query Frame = 3
Query:  477 QHIKLGIDLFNFNSECGVDYFQSNGIVNKDK-DLAELFMKKNGFNRSRMSDYMTDPE---NLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYF--NQNLEKDILGLNLEQLTIIFQFLMTFYTSQIHEKSNRLTR----EDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPKEFHLIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSK--RKGGMYDTNQYRFKQVIKLLDIKCAFVKRN----GIQLIQ-ISDLSNNILGSFYSKINEDFTNFYTSLEQAI 1430
            +H ++G++LFN   E G+ Y    G ++     +A   +++ G +R  + +++ + +   N  +     + +D     + + ++++  +  ++GE Q+V ++++  SQ Y   N  L +     +      I  F +    + ++  S +  R    +DFIK L        I R   + +Y  +         D   + +  V ++I    K+  L   +R ++C   L +V  P N   ++  H R VFLFND L+ +K  +K  +  T  Y F+Q   L+++     + +    GI+L+  +      +L  F +   +D   F + L ++I
Sbjct:  755 RHYRIGLNLFNKKPEKGIQYLIERGFLSDTPVGVAHFILERKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSSMDLDDALRKFQSHIRVQGEAQKVERLIEAFSQRYCVCNPALVRQFRNPDT---IFILAFAIILLNTDMYSPSVKAERKMKLDDFIKNLRGVDNGEDIPRDLLVGIYQRIQGREL-RTNDDHVSQVQAVERMIVG--KKPVLSLPHRRLVCCCQLYEVPDP-NRPQRLGLHQREVFLFNDLLVVTKIFQKKKILVT--YSFRQSFPLVEMHMQLFQNSYYQFGIKLLSAVPGGERKVLIIFNAPSLQDRLRFTSDLRESI 1080          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q9Y6D5|BIG2_HUMAN (Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Homo sapiens OX=9606 GN=ARFGEF2 PE=1 SV=3)

HSP 1 Score: 62.3882 bits (150), Expect = 8.760e-9
Identity = 40/178 (22.47%), Postives = 88/178 (49.44%), Query Frame = 3
Query:  483 IKLGIDLFNFNSECGVDYFQSNGIVNKD-KDLAELFMKKNGFNRSRMSDYMTDPE--NLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIFQFLMTFYTSQIH--EKSNRLTREDFIKMLNDSLKSNGISRSYALSLYYEL 1001
            I+ GI+LFN   + G+ + Q  G++    +D+A+   ++   + +++ D++ D    N  +  A+ + LD  +K  V  ++ +L+   + GE Q++ ++M+  +  Y   N  + +         + +  +M   T+ +H  +  N++T+E +IKM      S  +   Y  S+Y E+
Sbjct:  647 IEHGIELFNKKPKRGIQFLQEQGMLGTSVEDIAQFLHQEERLDSTQVGDFLGDSARFNKEVMYAYVDQLDFCEKEFVSALRTFLEGFRLPGEAQKIDRLMEKFAARYIECNQGQTLFASADTAYVLAYSIIM--LTTDLHSPQVKNKMTKEQYIKMNRGINDSKDLPEEYLSSIYEEI 822          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. TrEMBL
Match: T1G851 (SEC7 domain-containing protein OS=Helobdella robusta OX=6412 GN=20217248 PE=4 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 4.245e-17
Identity = 79/331 (23.87%), Postives = 152/331 (45.92%), Query Frame = 3
Query:  486 KLGIDLFNFNSECGVDYFQSNGIVN-KDKDLAELFMKKNGFNRSRMSDYMTD---PENLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIF--QFLMTFYTSQIHEKS----NRLTREDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPKEFHLIQYYRYVICHVDLCQVILP--HNGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKLLDIKCAFVK----RNGIQLIQISDLSNNILGSFYSKINEDFTNFYTSLEQAI 1430
            ++G++LFN     G+D+  ++  ++ K + +A   + + G ++  +  Y+ D   P N+ +   F N +DL    + E ++++  Y  + GE Q++ ++M+  S +Y+N N         L+ +  IF   + +    + +H ++     ++  EDF+K L        +   Y   +Y  +S        D   T + KV  +I    K+  L+Q +R ++C+  L +V  P           H R VFLFND L+ +K      +   Y F++   LL +K          NG+QL+   D S  +L +F +K + +   F + L ++I
Sbjct:    5 RIGLNLFNRKPNKGIDFLLTHKFLDSKPQSIARFLLNRKGLSKQMVGVYLGDLQRPMNMEVLSHFVNGIDLHNLPIDEALRKFQAYFRLPGEAQKIERLMEAFSTSYYNSNPSG-----TLKNVDTIFLLSYAVVMLNTDLHNRNIKVEKKMRMEDFVKNLRGIDNGKDVDPGYLSDIYRRISTCPLKPSND-HVTQVSKVDAMIAG--KKPLLVQPHRRLVCYCRLFEVFDPMLMRKDKDGGRHQRDVFLFNDLLVITKLCNRKKNVLTYNFRESFPLLHMKIVLFDLPYCPNGMQLVNGCDGS--VLVTFCAKDDGELKKFVSDLNESI 325          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. TrEMBL
Match: A0A1J1J6T1 (Non-specific serine/threonine protein kinase OS=Clunio marinus OX=568069 GN=CLUMA_CG021015 PE=4 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 2.289e-16
Identity = 82/327 (25.08%), Postives = 150/327 (45.87%), Query Frame = 3
Query:  486 KLGIDLFNFNSECGVDYFQSNGIVNKDK-DLAELFMKKNGFNRSRMSDYM---TDPENLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIFQFLMTFYTSQIHEKS----NRLTREDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPKEFHLIQYYRYVICHVDLCQVILPH-NGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKLLDIKCAFVKRNGIQ-LIQIS-DLSNNILGSFYSKINEDFTNFYTSLEQAIG 1433
            ++G++LFN   E G++Y   NG + K   ++A+    + G +R  + +Y+    +  N+S+   FC  +DL    +   ++++  Y  I GE Q++ ++M   SQ Y   N E      ++E + II  F +    + +H K+     R++ EDF++ L        I R   +S+Y  +    F    D  +  L   + +I   P    L   YR ++C+  L ++  P     ++   H R VFLFND L+ +K       +  Y F++   L  +    +K    Q  +Q+S  + N +L +F ++   D   F   LE++I 
Sbjct: 1512 RIGLNLFNKKPERGIEYLVRNGFLEKTPLNVAKFLTSRKGLSRQMIGEYLGMIQNQFNMSVLECFCEEIDLSGTAIDVALRKFQSYFRIPGEAQKIERLMQIFSQRYAKCNPEVVSKFKSVETVFII-SFAIIMLNTDLHTKTLKPERRMSCEDFVRNLRGVDDCRNIDRQILVSIYDRIRANEFKPAADHVSQVLKVQATIIGKKPS---LALPYRRLVCYCRLYEI--PDIKRKERTGVHQREVFLFNDILVVTKIFNKKKTSVTYTFRECFSLPGLTVTLLKTPNYQHCLQLSHKVDNKVLITFNARNEHDRFKFAQDLEESIA 1832          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. TrEMBL
Match: A0A5N5SX20 (IQ motif and SEC7 domain-containing protein 1 OS=Armadillidium nasatum OX=96803 GN=IQSEC1 PE=4 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 8.210e-15
Identity = 80/326 (24.54%), Postives = 151/326 (46.32%), Query Frame = 3
Query:  486 KLGIDLFNFNSECGVDYFQSNGIV-NKDKDLAELFMKKNGFNRSRMSDYMTD---PENLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTI-IFQFLMTFYTSQIHEKS----NRLTREDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPKEFHLIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKLLDIKCAFVKRNGIQ-LIQISD-LSNNILGSFYSKINEDFTNFYTSLEQAI 1430
            ++G++LFN   E G++Y      + N  + +A+  + + G ++  + +Y+ +   P N+S+   F   +DL    V   ++++  +  + GE Q++ ++M   +Q Y   N  +DI+    +  TI +  F +    + +H  S     R+  EDFIK L        I R     +Y+ +    F    D   T + KV + I    K+  L   +R ++C+  L +V  P N  +++  H R VFLFND L+ +K      ++  Y F+Q  +L  +     +      L++I   + N +L +F ++   D T F   L ++I
Sbjct:  486 RVGLNLFNKKPERGINYLIGRSFLENSPQAVAKFLLTRKGLSKQMIGEYLGNLQNPFNMSVLECFATEIDLSGMQVDVALRKFQTHFRMPGEAQKIERLMQVFAQRYCQCN--RDIVAKLRDPETIFVLAFAIIMLNTDLHTASLKAEKRMKLEDFIKNLRGVDDGCDIEREMLEGMYHRIKAQEFRPGHD-HVTQVMKVQQTIVG--KKPVLALPHRRLVCYCRLYEVPDP-NKKERVGLHQREVFLFNDLLVVTKIFSKKKNSVTYTFRQSFQLAGLSVNTKEATHYSFLLEIKQRVDNKVLATFNARNEHDRTKFCEDLRESI 805          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. TrEMBL
Match: A0A553P6Y6 (SEC7 domain-containing protein OS=Tigriopus californicus OX=6832 GN=TCAL_11335 PE=4 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 3.106e-14
Identity = 81/344 (23.55%), Postives = 162/344 (47.09%), Query Frame = 3
Query:  486 KLGIDLFNFNSECGVDYFQSNGIVN-KDKDLAELFMKKNGFNRSRMSDYMTD---PENLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIFQFLMTFYTSQIHEK----SNRLTREDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTR-------TTDLDKVSKLITDLPK-EFHLIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKLLDIKCA-FVKRNGIQLIQISD-LSNNILGSFYSKINEDFTNFYTSLEQAIGLHRSVVDYQK 1463
            ++G+ LFN N + G++Y      ++      A   + + G ++  + +Y+T+   P NL++   F + +D     +   +++  +   + GE Q++ KI++  S+ Y   N +  + G        +  + +    + +H +    S R+ REDFI+ L       G+     L L  E+ +  +D I +T         T ++KV + IT   + E  L + +R ++C   L +V+  +    K   H R VFLFND L+ +K       T Q++++  I L +I+ A F   +    IQ+ D L+  ++ +F ++ + D   F + L+++I      VD+++
Sbjct:  444 RVGLTLFNQNPDIGIEYLLKKQFLDFSPAATAAFLLGRKGLSKRVIGEYLTNLQRPFNLAVLHCFIHGMDFTGLHLDIALRQLQEEVTLPGEAQKIEKIVEVFSKRYIQCN-QMFVAGFRCPDTIFVLSYAIVLLNTDLHSRAVRSSRRMRREDFIRNLK------GVDSGQDLDL--EMLQGIYDRIRNTEFRVGSDHVTQVNKVEESITGKGRNELALAEPHRRLVCFCRLTEVMDINRQEKKAGVHQRGVFLFNDVLVNTKTIVSKKKT-QHQYRGTILLNEIRVAPFSSAHFTCGIQLQDRLTGKVVLTFNARSHNDQQRFLSDLQESIA---ETVDFER 774          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. TrEMBL
Match: T1IEB3 (SEC7 domain-containing protein (Fragment) OS=Rhodnius prolixus OX=13249 PE=4 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.794e-13
Identity = 84/329 (25.53%), Postives = 150/329 (45.59%), Query Frame = 3
Query:  486 KLGIDLFNFNSECGVDYFQSNGIV-NKDKDLAELFMKKNGFNRSRMSDYM---TDPENLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIF--QFLMTFYTSQIH----EKSNRLTREDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPKEFHLIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKLLDIKCAFVKRN----GIQLIQISDLSNNILGSFYSKINEDFTNFYTSLEQAI 1430
            ++G++LFN   E GV Y    G + N    +A   + + G ++  + +Y+    DP N +    F   +DL    V   ++++  Y  + GE Q+V +I++  SQ Y   N  +D++   L  L  +F   F +    + +H    +   R+T+EDFIK L        I R+  + +Y  +    F    D   T + KV   I  + K+ +L   +R ++C+  L +V   H   ++   H R VFLFND L+ +K       +  Y F+Q   L  +  +  +      GI+L Q  D  + +L +F ++ + D   F   + ++I
Sbjct:  394 RVGLNLFNKKPERGVSYLVKRGFLDNSPASIAHFLITRKGLSKQMIGEYLGNLQDPFNGATLELFAQEMDLSGMQVDVALRKFQTYFRMPGEAQKVERIIEVFSQRYCQCN--RDMVA-RLRNLDTVFVLAFAIIMLNTDLHTPNLKADRRMTQEDFIKNLRGVDDCCDIDRNMLIGIYERVKANEFKTGSD-HVTQVFKVQSTI--VGKKPNLALPHRRLVCYCRLYEVHDMHK-KERPGVHQREVFLFNDLLVITKILSKKKSSVTYTFRQSYSLSGLAVSLFEVPYYPYGIRLSQRVD--SQVLITFNARNDHDRCKFVEDMRESI 713          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Cavefish
Match: IQSEC1 (IQ motif and SEC7 domain-containing protein 1-like [Source:NCBI gene;Acc:103026485])

HSP 1 Score: 69.3218 bits (168), Expect = 6.642e-12
Identity = 74/339 (21.83%), Postives = 144/339 (42.48%), Query Frame = 3
Query:  486 KLGIDLFNFNSECGVDYFQSNGIV-NKDKDLAELFMKKNGFNRSRMSDYMTDPE---NLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYF--NQNLEKDILGLNLEQLTIIFQFLMTFYTSQIHEKSNRLTR----EDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPK--EFH------LIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKLLDIKCAFVK----RNGIQLIQ-ISDLSNNILGSFYSKINEDFTNFYTSLEQAIG 1433
            ++G++LFN   E G+ Y    G V +    +A   +++ G +R  + +++ + +   N  +     + +D     + E ++++  +  ++GE Q+V ++++  SQ Y   N  + +     +      I  F +    + ++  + +  R    EDF+K L        I R   + +Y  + +       D   + + KV KLI         H      L   +R ++C+  L +V  P N   K+  H R +FLFND L+ +K      ++  Y F+Q   L  ++    +     NGI+L   I      +L SF +   +D   F   L ++I 
Sbjct:  527 RIGLNLFNKKPEKGIQYLTERGFVPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSGMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCICNPGVVRQFRNPDT---IFILAFAIILLNTDMYSPNVKPERKMKLEDFVKNLRGVDDGEDIPREMLIGIYERIRQKELKTNED-HVSQVQKVEKLIVGKKPIGSLHHGLGCVLSLPHRRLVCYCRLFEVPDP-NKLQKLGLHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSAIPGADVKVLISFNAPNPQDRKKFTDDLRESIA 860          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Cavefish
Match: IQSEC1 (IQ motif and SEC7 domain-containing protein 1-like [Source:NCBI gene;Acc:103026485])

HSP 1 Score: 68.9366 bits (167), Expect = 7.126e-12
Identity = 73/340 (21.47%), Postives = 145/340 (42.65%), Query Frame = 3
Query:  486 KLGIDLFNFNSECGVDYFQSNGIV-NKDKDLAELFMKKNGFNRSRMSDYMTDPE---NLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYF--NQNLEKDILGLNLEQLTIIFQFLMTFYTSQIHEKSNRLTR----EDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPKEFHLIQY---------YRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKLLDIKCAFVK----RNGIQLIQ-ISDLSNNILGSFYSKINEDFTNFYTSLEQAIG 1433
            ++G++LFN   E G+ Y    G V +    +A   +++ G +R  + +++ + +   N  +     + +D     + E ++++  +  ++GE Q+V ++++  SQ Y   N  + +     +      I  F +    + ++  + +  R    EDF+K L        I R   + +Y  + +       D   + + KV KLI    K    + +         +R ++C+  L +V  P N   K+  H R +FLFND L+ +K      ++  Y F+Q   L  ++    +     NGI+L   I      +L SF +   +D   F   L ++I 
Sbjct:  531 RIGLNLFNKKPEKGIQYLTERGFVPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSGMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCICNPGVVRQFRNPDT---IFILAFAIILLNTDMYSPNVKPERKMKLEDFVKNLRGVDDGEDIPREMLIGIYERIRQKELKTNED-HVSQVQKVEKLIVGK-KPIGSLHHGLGCVLSLPHRRLVCYCRLFEVPDP-NKLQKLGLHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSAIPGADVKVLISFNAPNPQDRKKFTDDLRESIA 864          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Cavefish
Match: IQSEC1 (IQ motif and SEC7 domain-containing protein 1-like [Source:NCBI gene;Acc:103026485])

HSP 1 Score: 68.9366 bits (167), Expect = 8.414e-12
Identity = 73/338 (21.60%), Postives = 143/338 (42.31%), Query Frame = 3
Query:  486 KLGIDLFNFNSECGVDYFQSNGIV-NKDKDLAELFMKKNGFNRSRMSDYMTDPE---NLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIFQFLMTFYTSQIHEKSNRLTR----EDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPKEFHLIQY---------YRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKLLDIKCAFVK----RNGIQLIQ-ISDLSNNILGSFYSKINEDFTNFYTSLEQAIG 1433
            ++G++LFN   E G+ Y    G V +    +A   +++ G +R  + +++ + +   N  +     + +D     + E ++++  +  ++GE Q+V ++++  SQ Y   N    +          I  F +    + ++  + +  R    EDF+K L        I R   + +Y  + +       D   + + KV KLI    K    + +         +R ++C+  L +V  P N   K+  H R +FLFND L+ +K      ++  Y F+Q   L  ++    +     NGI+L   I      +L SF +   +D   F   L ++I 
Sbjct:  538 RIGLNLFNKKPEKGIQYLTERGFVPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSGMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCICN-PGVVRQFRNPDTIFILAFAIILLNTDMYSPNVKPERKMKLEDFVKNLRGVDDGEDIPREMLIGIYERIRQKELKTNED-HVSQVQKVEKLIVGK-KPIGSLHHGLGCVLSLPHRRLVCYCRLFEVPDP-NKLQKLGLHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSAIPGADVKVLISFNAPNPQDRKKFTDDLRESIA 871          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Cavefish
Match: IQSEC1 (IQ motif and SEC7 domain-containing protein 1-like [Source:NCBI gene;Acc:103026485])

HSP 1 Score: 68.9366 bits (167), Expect = 8.942e-12
Identity = 73/340 (21.47%), Postives = 145/340 (42.65%), Query Frame = 3
Query:  486 KLGIDLFNFNSECGVDYFQSNGIV-NKDKDLAELFMKKNGFNRSRMSDYMTDPE---NLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYF--NQNLEKDILGLNLEQLTIIFQFLMTFYTSQIHEKSNRLTR----EDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPKEFHLIQY---------YRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKLLDIKCAFVK----RNGIQLIQ-ISDLSNNILGSFYSKINEDFTNFYTSLEQAIG 1433
            ++G++LFN   E G+ Y    G V +    +A   +++ G +R  + +++ + +   N  +     + +D     + E ++++  +  ++GE Q+V ++++  SQ Y   N  + +     +      I  F +    + ++  + +  R    EDF+K L        I R   + +Y  + +       D   + + KV KLI    K    + +         +R ++C+  L +V  P N   K+  H R +FLFND L+ +K      ++  Y F+Q   L  ++    +     NGI+L   I      +L SF +   +D   F   L ++I 
Sbjct:  507 RIGLNLFNKKPEKGIQYLTERGFVPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSGMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCICNPGVVRQFRNPDT---IFILAFAIILLNTDMYSPNVKPERKMKLEDFVKNLRGVDDGEDIPREMLIGIYERIRQKELKTNED-HVSQVQKVEKLIVGK-KPIGSLHHGLGCVLSLPHRRLVCYCRLFEVPDP-NKLQKLGLHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSAIPGADVKVLISFNAPNPQDRKKFTDDLRESIA 840          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Cavefish
Match: IQSEC1 (IQ motif and SEC7 domain-containing protein 1-like [Source:NCBI gene;Acc:103026485])

HSP 1 Score: 68.5514 bits (166), Expect = 9.378e-12
Identity = 74/339 (21.83%), Postives = 144/339 (42.48%), Query Frame = 3
Query:  486 KLGIDLFNFNSECGVDYFQSNGIV-NKDKDLAELFMKKNGFNRSRMSDYMTDPE---NLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYF--NQNLEKDILGLNLEQLTIIFQFLMTFYTSQIHEKSNRLTR----EDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPK--EFH------LIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKLLDIKCAFVK----RNGIQLIQ-ISDLSNNILGSFYSKINEDFTNFYTSLEQAIG 1433
            ++G++LFN   E G+ Y    G V +    +A   +++ G +R  + +++ + +   N  +     + +D     + E ++++  +  ++GE Q+V ++++  SQ Y   N  + +     +      I  F +    + ++  + +  R    EDF+K L        I R   + +Y  + +       D   + + KV KLI         H      L   +R ++C+  L +V  P N   K+  H R +FLFND L+ +K      ++  Y F+Q   L  ++    +     NGI+L   I      +L SF +   +D   F   L ++I 
Sbjct:  523 RIGLNLFNKKPEKGIQYLTERGFVPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSGMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCICNPGVVRQFRNPDT---IFILAFAIILLNTDMYSPNVKPERKMKLEDFVKNLRGVDDGEDIPREMLIGIYERIRQKELKTNED-HVSQVQKVEKLIVGKKPIGSLHHGLGCVLSLPHRRLVCYCRLFEVPDP-NKLQKLGLHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSAIPGADVKVLISFNAPNPQDRKKFTDDLRESIA 856          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007609.1 (pep scaffold:Pmarinus_7.0:GL477333:80854:108205:-1 gene:ENSPMAG00000006851.1 transcript:ENSPMAT00000007609.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.781 bits (164), Expect = 2.340e-12
Identity = 76/338 (22.49%), Postives = 146/338 (43.20%), Query Frame = 3
Query:  486 KLGIDLFNFNSECGVDYFQSNG-IVNKDKDLAELFMKKNGFNRSRMSDYMTDPE---NLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIF--QFLMTFYTSQIHEKSNRLTR----EDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSK-LITDLP-KEFH----LIQYYRYVICHVDLCQVILPH-NGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKLLDIKCAFVK----RNGIQLIQ-ISDLSNNILGSFYSKINEDFTNFYTSLEQAIG 1433
            ++G++LFN  +E G+ +    G I +    +A+  +++ G +R  + D++ + +   N  +       +D     + E ++++     ++GE Q+V ++++  SQ Y   N    +L         IF   F +    +  +  + +  R    EDFIK L        I R   LS+Y  +S+       D   + + KV K ++   P +  H    L   +R ++C+  L +V  P  N   K+  H R +FLFND L+ +K      ++  Y F+Q   L  ++    +     NGI+++  +      +L  F +    D   F   L ++I 
Sbjct:   41 RIGLNLFNKKAEKGLQFLMERGFIPDTPYGVAQFLLQRKGLSRQMIGDFLGNRQKQFNRDVLDCVVEEMDFAGMDIDEALRKFQGQVRVQGEAQKVERMIEAFSQRYCVCN---SVLLRQFRNPDTIFILAFAIILLNTDRYSPNVKAERKMKLEDFIKNLRGVDDGKDIPREMLLSIYDRISKKELKTNED-HVSQVAKVEKSIVGKKPVRGLHVHCVLALPHRRLVCYCRLFEV--PDTNRPQKLGLHQREIFLFNDFLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIKIVSAVPGADTKVLMVFNAPNPTDRKKFVDDLRESIA 372          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Sea Lamprey
Match: iqsec1b (IQ motif and Sec7 domain ArfGEF 1b [Source:ZFIN;Acc:ZDB-GENE-120813-1])

HSP 1 Score: 66.6254 bits (161), Expect = 7.716e-12
Identity = 75/340 (22.06%), Postives = 143/340 (42.06%), Query Frame = 3
Query:  486 KLGIDLFNFNSECGVDYFQSNGIV-NKDKDLAELFMKKNGFNRSRMSDYMTDPE---NLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYF--NQNLEKDILGLNLEQLTIIF--QFLMTFYTSQIHEKSNRLTR----EDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPKEFHLIQ---------YYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKLLDIKCAFVK----RNGIQLIQISDLS-NNILGSFYSKINEDFTNFYTSLEQA 1427
            ++G++LFN   E GV Y    G V +    +A   +++ G +R  + +++ + +   N  +     + +D     + E ++ +  +  ++GE Q+V ++++  SQ Y   N  + K     N +    IF   F +    + ++  + +  R    +DF+K L        I R   + +Y  +         D   T +  V K I        LI           +R ++C+  L +V  P N   K+  H R +FLFND L+ +K       +  Y F+Q   L  ++    +    ++GI+L+  +  S   IL  F +   ED   F   L+++
Sbjct:  464 RIGLNLFNKKPEKGVAYLMERGFVPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQRAFNRDVLDCVVDEMDFSGMELDEALRMFQAHIRVQGEAQKVERLIEAFSQRYCMCNPGVVK-----NFQNPDTIFILAFAIVLLNTDMYSPNVKPERKMKLDDFVKNLRGVDDGADIPREILVGIYERIQRGEL-KTNDDHVTQVANVEKTIVGKKPVIVLIHKNIQKVLSLPHRRLVCYCRLFEVPDP-NRPQKLGLHQREIFLFNDLLVVTKIFHKRKHSTSYSFRQSFPLYGMQVHLFENQYYQHGIRLVSSTPGSETEILVIFNAPNPEDRKKFVEDLKES 796          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004124.1 (pep scaffold:Pmarinus_7.0:GL477097:5491:41441:-1 gene:ENSPMAG00000003754.1 transcript:ENSPMAT00000004124.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 2.839e-6
Identity = 36/179 (20.11%), Postives = 87/179 (48.60%), Query Frame = 3
Query:  483 IKLGIDLFNFNSECGVDYFQS-NGIVNKDKDLAELFMKKNGFNRSRMSDYMTDPENLSIHI--AFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIFQFLMTFYTSQIH--EKSNRLTREDFIKMLNDSLKSNGISRSYALSLYYELS 1004
            I+ GI+LFN   + G+ + Q  N +    +D+A+    +N  + +++ DY+ + + L+      + + +D   K  V  ++ +L+   + GE Q++ ++M+  +  +   N  + +         + +  +M   T+ +H  +  +++++E +IKM      S  +   Y  S+Y E++
Sbjct:  147 IEQGIELFNKKPKRGIQFLQEQNMLGTTTEDVAQFLHSENRLDSTQVGDYLGENDKLNKETMYTYVDQMDFSGKDFVSALRLFLEGFRLPGEAQKIDRLMEKFAARFCECNQGQTVFASADTAYVLAYSIIM--LTTDLHSLQVKHKMSKEQYIKMNRGINDSKDLPEEYLSSIYDEIA 323          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Sea Lamprey
Match: si:dkey-283b15.4 (cytohesin 2 [Source:HGNC Symbol;Acc:HGNC:9502])

HSP 1 Score: 47.7506 bits (112), Expect = 4.243e-6
Identity = 24/113 (21.24%), Postives = 60/113 (53.10%), Query Frame = 3
Query:  477 QHIKLGIDLFNFNSECGVDYFQSNGIV-NKDKDLAELFMKKNGFNRSRMSDYMTDPENLSIHI--AFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQN 806
            + + +G   FN + + G+ +   N ++ N  +D+A+   K  G N++ + +Y+ + ++ +I +  AF  L +     +V+ ++++L    + GE Q++ ++M+  +  Y   N
Sbjct:   66 KQMSMGRKKFNMDPKKGIRFLTENELLKNTPEDIAQFLYKGEGLNKTAIGEYLGERDDFNIQVLHAFVELHEFANLNLVQALRQFLWSFRLPGEAQKIDRMMEAFATRYCQCN 178          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004144.1 (pep scaffold:Pmarinus_7.0:GL477097:6043:63444:-1 gene:ENSPMAG00000003754.1 transcript:ENSPMAT00000004144.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.1358 bits (113), Expect = 5.536e-6
Identity = 36/179 (20.11%), Postives = 87/179 (48.60%), Query Frame = 3
Query:  483 IKLGIDLFNFNSECGVDYFQS-NGIVNKDKDLAELFMKKNGFNRSRMSDYMTDPENLSIHI--AFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIFQFLMTFYTSQIH--EKSNRLTREDFIKMLNDSLKSNGISRSYALSLYYELS 1004
            I+ GI+LFN   + G+ + Q  N +    +D+A+    +N  + +++ DY+ + + L+      + + +D   K  V  ++ +L+   + GE Q++ ++M+  +  +   N  + +         + +  +M   T+ +H  +  +++++E +IKM      S  +   Y  S+Y E++
Sbjct:  494 IEQGIELFNKKPKRGIQFLQEQNMLGTTTEDVAQFLHSENRLDSTQVGDYLGENDKLNKETMYTYVDQMDFSGKDFVSALRLFLEGFRLPGEAQKIDRLMEKFAARFCECNQGQTVFASADTAYVLAYSIIM--LTTDLHSLQVKHKMSKEQYIKMNRGINDSKDLPEEYLSSIYDEIA 670          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Nematostella
Match: EDO34882 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN35])

HSP 1 Score: 79.7221 bits (195), Expect = 7.320e-16
Identity = 70/313 (22.36%), Postives = 145/313 (46.33%), Query Frame = 3
Query:  480 HIKLGIDLFNFNSECGVDYFQSNGIVNKDKD-LAELFMKKNGFNRSRMSDYMTDPEN---LSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIFQFLMTFYTSQIHEKS--NRLTREDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILD--TRTTDLDKVSKLITDLPKEFHLIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSKRKG--GMYDTNQ-YRFKQVIKLLDIKCAFVKRN----GIQLIQISDLSNNILGSF 1373
             +++GI+ FN   E GV Y  ++ +++ + + +A+  + ++G ++ R+ +Y+ + +N   +++   F    D     +   ++ +L    I GE Q++ ++M+  ++ Y + N   D    + +   +I  F +    + +H  +   R+T+EDFI+ L  +             +Y  + +  F    D  T T  L+K  K++  +P    L   +RY+     L ++  P+    K   H R +F+FND ++ +K +G  G  D    Y +K    L  +K +    +    GIQL   S L + ++ +F
Sbjct:   35 EMRIGINQFNRKPEKGVTYLIAHQVIDDNPEAVAKFLLSEHGVSKQRLGEYLGNLQNDFNMAVLKCFAESFDFTGMEIDVALRTFLAQFRIPGEAQKIERLMEVFAEQYISCNPTDDT---SAQDKVLILAFAIVMLNTDLHSPNVKKRMTQEDFIRNLEGTNNGGNFPSESLAGIYRRVFKKEFTPARDHVTMTAKLEK--KIVGKMPWT-TLAALHRYLRMLTPLFEIRDPNK---KEKTHPRVIFVFNDMIVVTKERGRPGQRDGYHFYSYKHSFLLSGVKISVFTNDYYPWGIQL--YSRLQSQVVATF 336          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Nematostella
Match: EDO38004 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEA8])

HSP 1 Score: 58.5362 bits (140), Expect = 3.055e-9
Identity = 41/175 (23.43%), Postives = 89/175 (50.86%), Query Frame = 3
Query:  486 KLGIDLFNFNSECGVDYFQSNGIVNK-DKDLAELFMKKNGFNRSRMSDYMTDPE--NLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTI-IFQFLMTFYTSQIHEKS--NRLTREDFIKMLNDSLKSNGISRSYALSLY 992
            ++G   F+ + + G+DY   +G++N   +DLA+  +K+ G N++++ +Y+ + +  NL +   F +L   K   +V+ ++++L    + GE Q++ ++M+  +Q Y   N      GL     T  +  F +    + +H  +  ++ T E FI+M         + R + ++LY
Sbjct:   62 QIGKKKFSMDPQKGIDYLVMHGLLNNTPEDLADFLLKEEGLNKTQIGNYLGENKEFNLDVFAKFVDLHKFKDMILVQALRQFLWSFRLPGEAQKIDRMMEAFAQKYCADN-----PGLFTSTDTCYVLSFAIILLNTSLHNPNVKDKPTVEKFIQMNRGINCGEDLDRDFLVALY 231          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Medaka
Match: ENSORLT00000023260.2 (IQ motif and SEC7 domain-containing protein 2 [Source:NCBI gene;Acc:101166035])

HSP 1 Score: 72.4034 bits (176), Expect = 7.742e-13
Identity = 72/333 (21.62%), Postives = 147/333 (44.14%), Query Frame = 3
Query:  477 QHIKLGIDLFNFNSECGVDYFQSNGIVNKDK-DLAELFMKKNGFNRSRMSDYMTDPENLSIHIAFCNL--LDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIF--QFLMTFYTSQIH----EKSNRLTREDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPKEFHLIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKLLDIKCAFVKRN----GIQLIQIS-DLSNNILGSFYSKINEDFTNFYTSLEQAIG 1433
            +  ++G++LFN   E G+ Y    G V+     +A   +++ G +R  + +++   +  +  +  C L  +D     + + ++++     ++GE QRV ++++  SQ Y   N    +L    +    IF   F +    + ++    +   ++  EDFIK L        I R   +++Y  + +       D   + +  V +++  + K+  L   +R ++C   L +V  P N + +   H R VFLFND L+ +K       +  Y F+Q   LLD++    + +    GI+L   +      +L  F +   +D   F + L ++I 
Sbjct:  922 RQYRIGLNLFNKKPEKGIQYLIERGFVSDTPVGVARFILERKGLSRQMIGEFLGSRQQFNKDVLNCVLDEMDFSGMDLDDALRKFQAQIKVQGEAQRVERLVEAFSQRYCICN---PVLIRQFQNPDTIFILAFAIILLNTDMYSPNVKPERKMKLEDFIKNLRGVDNGQDIPRDLLVAIYGRIQKWEL-RTNDDHVSQVQAVERMV--VGKKPVLSLPHRRLVCCCQLFEVPDP-NRAQRSGVHQREVFLFNDLLMVTKIFQKKKTSVTYSFRQSFPLLDMQVHTFQNSYYPHGIKLTSANPGGERKVLIIFTAPSQQDRARFTSDLRESIA 1247          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Medaka
Match: IQSEC1 (IQ motif and SEC7 domain-containing protein 1 [Source:NCBI gene;Acc:101172493])

HSP 1 Score: 70.8626 bits (172), Expect = 2.214e-12
Identity = 75/340 (22.06%), Postives = 145/340 (42.65%), Query Frame = 3
Query:  477 QHIKLGIDLFNFNSECGVDYFQSNG-IVNKDKDLAELFMKKNGFNRSRMSDYMTDPE---NLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIFQFLMTFYTSQIHEKSNRLTR----EDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPK--EFH------LIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKLLDIKCAFVK----RNGIQLIQ-ISDLSNNILGSFYSKINEDFTNFYTSLEQAIG 1433
            +H ++G++LFN   E G+ Y    G I +    +A   +++ G +R  + +++ + +   N  +     + +D +   + E ++++  +  ++GE Q+V ++++  SQ Y   N    +          I  F +    + ++  + +  R    EDFIK L        I R   + +Y  + +       D   + + KV KLI         H      L   +R ++C+  L +V  P N   K+  H R +FLFND L+ +K      ++  Y F+Q   L  ++    +     NGI+L   I      +L +F +   +D   F   L ++I 
Sbjct:  590 RHYRIGLNLFNKKPEKGIQYLTERGFIPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFQSMELDEALRKFQNHIRVQGEAQKVERLIEAFSQRYCICN-PTVVRQFRNPDTIFILAFAIILLNTDMYSPNVKPERKMKLEDFIKNLRGVDDGEDIPRETLVGIYERIRKRELKTNED-HVSQVQKVEKLIVGKKPIGSLHHGLGCVLSLPHRRLVCYCRLFEVPDP-NKLQKLGLHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSAIPGADMKVLINFNAPNPQDRKKFTDDLRESIA 926          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Medaka
Match: IQSEC1 (IQ motif and SEC7 domain-containing protein 1 [Source:NCBI gene;Acc:101172493])

HSP 1 Score: 69.707 bits (169), Expect = 4.427e-12
Identity = 74/341 (21.70%), Postives = 146/341 (42.82%), Query Frame = 3
Query:  477 QHIKLGIDLFNFNSECGVDYFQSNG-IVNKDKDLAELFMKKNGFNRSRMSDYMTDPE---NLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIFQFLMTFYTSQIHEKSNRLTR----EDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPKEFHLIQY---------YRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKLLDIKCAFVK----RNGIQLIQ-ISDLSNNILGSFYSKINEDFTNFYTSLEQAIG 1433
            +H ++G++LFN   E G+ Y    G I +    +A   +++ G +R  + +++ + +   N  +     + +D +   + E ++++  +  ++GE Q+V ++++  SQ Y   N    +          I  F +    + ++  + +  R    EDFIK L        I R   + +Y  + +       D   + + KV KLI    K    + +         +R ++C+  L +V  P N   K+  H R +FLFND L+ +K      ++  Y F+Q   L  ++    +     NGI+L   I      +L +F +   +D   F   L ++I 
Sbjct:  531 RHYRIGLNLFNKKPEKGIQYLTERGFIPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFQSMELDEALRKFQNHIRVQGEAQKVERLIEAFSQRYCICN-PTVVRQFRNPDTIFILAFAIILLNTDMYSPNVKPERKMKLEDFIKNLRGVDDGEDIPRETLVGIYERIRKRELKTNED-HVSQVQKVEKLIVGK-KPIGSLHHGLGCVLSLPHRRLVCYCRLFEVPDP-NKLQKLGLHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSAIPGADMKVLINFNAPNPQDRKKFTDDLRESIA 867          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Medaka
Match: IQSEC1 (IQ motif and SEC7 domain-containing protein 1 [Source:NCBI gene;Acc:101172493])

HSP 1 Score: 69.707 bits (169), Expect = 4.809e-12
Identity = 74/341 (21.70%), Postives = 146/341 (42.82%), Query Frame = 3
Query:  477 QHIKLGIDLFNFNSECGVDYFQSNG-IVNKDKDLAELFMKKNGFNRSRMSDYMTDPE---NLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIFQFLMTFYTSQIHEKSNRLTR----EDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPKEFHLIQY---------YRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKLLDIKCAFVK----RNGIQLIQ-ISDLSNNILGSFYSKINEDFTNFYTSLEQAIG 1433
            +H ++G++LFN   E G+ Y    G I +    +A   +++ G +R  + +++ + +   N  +     + +D +   + E ++++  +  ++GE Q+V ++++  SQ Y   N    +          I  F +    + ++  + +  R    EDFIK L        I R   + +Y  + +       D   + + KV KLI    K    + +         +R ++C+  L +V  P N   K+  H R +FLFND L+ +K      ++  Y F+Q   L  ++    +     NGI+L   I      +L +F +   +D   F   L ++I 
Sbjct:  549 RHYRIGLNLFNKKPEKGIQYLTERGFIPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFQSMELDEALRKFQNHIRVQGEAQKVERLIEAFSQRYCICN-PTVVRQFRNPDTIFILAFAIILLNTDMYSPNVKPERKMKLEDFIKNLRGVDDGEDIPRETLVGIYERIRKRELKTNED-HVSQVQKVEKLIVGK-KPIGSLHHGLGCVLSLPHRRLVCYCRLFEVPDP-NKLQKLGLHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSAIPGADMKVLINFNAPNPQDRKKFTDDLRESIA 885          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Medaka
Match: IQSEC1 (IQ motif and SEC7 domain-containing protein 1 [Source:NCBI gene;Acc:101172493])

HSP 1 Score: 69.707 bits (169), Expect = 5.363e-12
Identity = 74/341 (21.70%), Postives = 146/341 (42.82%), Query Frame = 3
Query:  477 QHIKLGIDLFNFNSECGVDYFQSNG-IVNKDKDLAELFMKKNGFNRSRMSDYMTDPE---NLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIFQFLMTFYTSQIHEKSNRLTR----EDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPKEFHLIQY---------YRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKLLDIKCAFVK----RNGIQLIQ-ISDLSNNILGSFYSKINEDFTNFYTSLEQAIG 1433
            +H ++G++LFN   E G+ Y    G I +    +A   +++ G +R  + +++ + +   N  +     + +D +   + E ++++  +  ++GE Q+V ++++  SQ Y   N    +          I  F +    + ++  + +  R    EDFIK L        I R   + +Y  + +       D   + + KV KLI    K    + +         +R ++C+  L +V  P N   K+  H R +FLFND L+ +K      ++  Y F+Q   L  ++    +     NGI+L   I      +L +F +   +D   F   L ++I 
Sbjct:  642 RHYRIGLNLFNKKPEKGIQYLTERGFIPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFQSMELDEALRKFQNHIRVQGEAQKVERLIEAFSQRYCICN-PTVVRQFRNPDTIFILAFAIILLNTDMYSPNVKPERKMKLEDFIKNLRGVDDGEDIPRETLVGIYERIRKRELKTNED-HVSQVQKVEKLIVGK-KPIGSLHHGLGCVLSLPHRRLVCYCRLFEVPDP-NKLQKLGLHQREIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSAIPGADMKVLINFNAPNPQDRKKFTDDLRESIA 978          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000070179.1 (SMESG000070179.1)

HSP 1 Score: 901.353 bits (2328), Expect = 0.000e+0
Identity = 461/463 (99.57%), Postives = 463/463 (100.00%), Query Frame = 3
Query:   87 MIDIQSAAYLDMDSRDILDFRKRKSDVFSDEVPNKKASKDTFKPESTPKQLLRRFSTRFKLIGSGIKSKNKNFENPIKEDGANESDKLTNNMKTNTSMIYFTASQQKKSAVXXXXXXXXXXXXXXXXXXGQHIKLGIDLFNFNSECGVDYFQSNGIVNKDKDLAELFMKKNGFNRSRMSDYMTDPENLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIFQFLMTFYTSQIHEKSNRLTREDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPKEFHLIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKLLDIKCAFVKRNGIQLIQISDLSNNILGSFYSKINEDFTNFYTSLEQAIGLHRSVVDYQKLYQA 1475
            MIDIQSAAYLDMDSRDILDFRKRKSDVFSDEVPNKKASKDTFKPESTPKQLLRRFSTRFKLIGSGIKSKNKNFENPIKEDGANE+DKLTNNMKTNTSMIYFTASQQKKSAVNNDRLSNSSDNSRQSSTSGQHIKLGIDLFNFNSECGVDYFQSNGIVNKDKDLAELFMKKNGFNRSRMSDYMTDPENLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIFQFLMTFYTSQIHEKSNRLTREDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPKEFHLIQY+RYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKLLDIKCAFVKRNGIQLIQISDLSNNILGSFYSKINEDFTNFYTSLEQAIGLHRSVVDYQKLYQA
Sbjct:    1 MIDIQSAAYLDMDSRDILDFRKRKSDVFSDEVPNKKASKDTFKPESTPKQLLRRFSTRFKLIGSGIKSKNKNFENPIKEDGANETDKLTNNMKTNTSMIYFTASQQKKSAVNNDRLSNSSDNSRQSSTSGQHIKLGIDLFNFNSECGVDYFQSNGIVNKDKDLAELFMKKNGFNRSRMSDYMTDPENLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIFQFLMTFYTSQIHEKSNRLTREDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPKEFHLIQYFRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKLLDIKCAFVKRNGIQLIQISDLSNNILGSFYSKINEDFTNFYTSLEQAIGLHRSVVDYQKLYQA 463          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000042180.1 (SMESG000042180.1)

HSP 1 Score: 96.6709 bits (239), Expect = 9.162e-21
Identity = 66/279 (23.66%), Postives = 136/279 (48.75%), Query Frame = 3
Query:  486 KLGIDLFNFNSECGVDYFQSNGIVNKDKD-LAELFMKKNGFNRSRMSDY---MTDPENLSIHIAFCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIFQFLMTFYTSQIH----EKSNRLTREDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPKEFHLIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKLLDIK 1298
            ++G++LFN N   G++Y   N  +      +A+  + KNG +R+ + DY   + DP  L +   F   +++K K V E ++ ++ Y  + GE Q++  +M+   + Y +QN       L+     ++  + +    +  H    +K+ ++T E F+  L    ++N I R+    +Y  ++      + D  T  + +++ +I    K   L+   R  +C+  L +++   N  +K + H R VFLFND L+ +K +      +QY+ +  + L+D++
Sbjct:  373 RVGLNLFNRNPVVGINYLIKNQFIKPHPSHIAKFLLTKNGISRNAVGDYIGLLNDPLALQVTKYFLRRINMKNKEVDEALRSFIYYVHLPGESQKISHLMEEFKETYVHQNDRSQFKSLDT---IMVLAYAIIMLQTDAHNLSIKKNEKMTLEQFVNNLRGVDENNDIDRNILEPIYMRVTGKELKTMPD-HTDQVRRLNDIICGPNKPADLVNRVRRFMCYCRLSEIV-DDNKKNKPAAHQREVFLFNDLLMITKLQNKSRKEDQYQCRYALPLVDLQ 646          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000057299.1 (SMESG000057299.1)

HSP 1 Score: 72.4034 bits (176), Expect = 3.765e-13
Identity = 76/333 (22.82%), Postives = 153/333 (45.95%), Query Frame = 3
Query:  486 KLGIDLFNFNSECGVDYFQSNGIVNKDKD-LAELFMKKNGFNRSRMSDYMTDP-ENLSIHIA--FCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLE-KDILGLNLEQLTIIFQFLMTFYTSQIHE---KSNRLTREDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPKEFHLIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSK-----RKGGMYDTNQYRFKQVIKLLDIKCAFVKRN----GIQLIQISDLSNNILGSFYSKINEDFTNFYTSLEQAIG 1433
            ++ +++FN NS  GV Y      V    + LA+  M + G +R  + DY+    ++L+      F  ++D++ K +   ++  L +  I GE Q++  IM+   ++Y  QN +    +  N + + I+   ++  +T   +    K +++++E+FI  L +      I+ +   ++Y  +         D  T  + K+ +  +   +  +L Q +R ++C+  L +VI  +   D+I  H R VFLFND L+ +K     +K G+     Y+ +  I L  ++    +      GIQL +     + IL +F ++   D   F   L + + 
Sbjct:  360 RICLNIFNKNSLKGVSYLIRFKFVEPSPNILAKFLMSRKGISRFSIGDYLGHTKDDLATETLKFFVRMVDMRNKEIDIALRHLLSFFQIPGESQKIKSIMEEFQESYMEQNQQFWPQICKNPDTIMILAYAIIMLHTDMYNPNIRKQHKMSKEEFIHNLRNVDDGQDINPNILTAIYDRIKTAEMKTFSD-HTDQVRKIDQHFSGHLRPRNLNQPHRRLVCYCRLFEVIDCYK-KDRIGAHQREVFLFNDLLVITKGVQKRKKDGV----MYQCRNTISLGKVEIYLFETIYYPFGIQLRR----DDEILATFNTRTASDRKRFVEDLIETVS 682          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000057299.1 (SMESG000057299.1)

HSP 1 Score: 72.4034 bits (176), Expect = 4.860e-13
Identity = 76/333 (22.82%), Postives = 153/333 (45.95%), Query Frame = 3
Query:  486 KLGIDLFNFNSECGVDYFQSNGIVNKDKD-LAELFMKKNGFNRSRMSDYMTDP-ENLSIHIA--FCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLE-KDILGLNLEQLTIIFQFLMTFYTSQIHE---KSNRLTREDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPKEFHLIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSK-----RKGGMYDTNQYRFKQVIKLLDIKCAFVKRN----GIQLIQISDLSNNILGSFYSKINEDFTNFYTSLEQAIG 1433
            ++ +++FN NS  GV Y      V    + LA+  M + G +R  + DY+    ++L+      F  ++D++ K +   ++  L +  I GE Q++  IM+   ++Y  QN +    +  N + + I+   ++  +T   +    K +++++E+FI  L +      I+ +   ++Y  +         D  T  + K+ +  +   +  +L Q +R ++C+  L +VI  +   D+I  H R VFLFND L+ +K     +K G+     Y+ +  I L  ++    +      GIQL +     + IL +F ++   D   F   L + + 
Sbjct:  378 RICLNIFNKNSLKGVSYLIRFKFVEPSPNILAKFLMSRKGISRFSIGDYLGHTKDDLATETLKFFVRMVDMRNKEIDIALRHLLSFFQIPGESQKIKSIMEEFQESYMEQNQQFWPQICKNPDTIMILAYAIIMLHTDMYNPNIRKQHKMSKEEFIHNLRNVDDGQDINPNILTAIYDRIKTAEMKTFSD-HTDQVRKIDQHFSGHLRPRNLNQPHRRLVCYCRLFEVIDCYK-KDRIGAHQREVFLFNDLLVITKGVQKRKKDGV----MYQCRNTISLGKVEIYLFETIYYPFGIQLRR----DDEILATFNTRTASDRKRFVEDLIETVS 700          
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000081851.1 (SMESG000081851.1)

HSP 1 Score: 67.781 bits (164), Expect = 7.466e-12
Identity = 73/309 (23.62%), Postives = 129/309 (41.75%), Query Frame = 3
Query:  483 IKLGIDLFNFNSECGVDYFQSNGIVNKDKDLAELFMKKNGFNRSRMSDYMTDPENLSIHIA----FCNLLDLKKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNLEQLTIIFQFLMTFYTSQIH----EKSNRLTREDFIKMLNDSLKSNGISRSYALSLYYELSEVSFDNILDTRTTDLDKVSKLITDLPKEFHLIQYYRYVICHVDLCQVILPHNGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKLLDIKCAFVKR----NGIQLIQISDLSNNILGSF 1373
            + LG ++FN N   G+ +   + I+ +D +     +   G +     +Y++ P N S+  A    +   +  +  ++ + ++       I GE Q ++ I++  S  Y  QN       L  E   +I  + +    + +H     K ++LT+E F+ +     +   I+  +   LY  +       I D      +    L    PK+  LIQ YR  IC V  C  I   N       H R ++LFND L+ +K K        YRFK+VI L  ++          +G++LI+    +N I  +F
Sbjct:  123 LTLGKNIFNRNCNKGISFLIQHNIIEEDPEFIVRLLNSEGISVFVKGEYLSQPNN-SLAKATKNKYLKKISFQDCSIEKGLRRLFSQVRIPGESQNLVSILEGFSDEYLFQNPHISS-KLKNENTIVILAYGILMLHTGVHNKCAAKKDKLTKESFLHLFKCIYEEEIINNDFLGELYENVKRKKMSVISDITDQVRNIFMSLTGRFPKD--LIQKYRKFIC-VYSCNEIYQINKKPDSHSHSRVLYLFNDLLLVTKEKS----KGIYRFKRVISLSGLRVELFSAEYYGHGLRLIETLQGNNTIHFNF 422          
The following BLAST results are available for this feature:
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IQSEC12.922e-1222.06IQ motif and Sec7 domain ArfGEF 1 [Source:HGNC Sym... [more]
IQSEC13.263e-1222.06IQ motif and Sec7 domain ArfGEF 1 [Source:HGNC Sym... [more]
IQSEC14.817e-1222.06IQ motif and Sec7 domain ArfGEF 1 [Source:HGNC Sym... [more]
IQSEC15.678e-1222.06IQ motif and Sec7 domain ArfGEF 1 [Source:HGNC Sym... [more]
IQSEC11.124e-1121.93IQ motif and Sec7 domain ArfGEF 1 [Source:HGNC Sym... [more]
back to top
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
bris-18.483e-921.56BRag/Iqsec/Schizo related Arf GEF family member [... [more]
bris-11.000e-821.56BRag/Iqsec/Schizo related Arf GEF family member [... [more]
bris-11.265e-822.65BRag/Iqsec/Schizo related Arf GEF family member [... [more]
bris-11.488e-821.56BRag/Iqsec/Schizo related Arf GEF family member [... [more]
back to top
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
siz1.297e-1525.89gene:FBgn0026179 transcript:FBtr0078289[more]
siz1.411e-1525.89gene:FBgn0026179 transcript:FBtr0111038[more]
siz1.832e-1525.89gene:FBgn0026179 transcript:FBtr0078290[more]
siz1.902e-1525.89gene:FBgn0026179 transcript:FBtr0301602[more]
step5.946e-723.66gene:FBgn0086779 transcript:FBtr0085910[more]
back to top
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IQSEC14.640e-1323.08IQ motif and Sec7 domain ArfGEF 1a [Source:NCBI ge... [more]
IQSEC15.134e-1323.08IQ motif and Sec7 domain ArfGEF 1a [Source:NCBI ge... [more]
iqsec2a1.348e-1221.08IQ motif and Sec7 domain ArfGEF 2a [Source:ZFIN;Ac... [more]
iqsec2a8.694e-1221.56IQ motif and Sec7 domain ArfGEF 2a [Source:ZFIN;Ac... [more]
iqsec2a8.905e-1221.56IQ motif and Sec7 domain ArfGEF 2a [Source:ZFIN;Ac... [more]
back to top
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IQSEC24.880e-1121.92IQ motif and Sec7 domain 2 [Source:NCBI gene;Acc:1... [more]
IQSEC25.320e-1121.92IQ motif and Sec7 domain 2 [Source:NCBI gene;Acc:1... [more]
IQSEC25.689e-1121.92IQ motif and Sec7 domain 2 [Source:NCBI gene;Acc:1... [more]
IQSEC26.728e-1121.92IQ motif and Sec7 domain 2 [Source:NCBI gene;Acc:1... [more]
IQSEC27.271e-1121.92IQ motif and Sec7 domain 2 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Iqsec11.368e-1121.18IQ motif and Sec7 domain 1 [Source:MGI Symbol;Acc:... [more]
Iqsec11.384e-1120.82IQ motif and Sec7 domain 1 [Source:MGI Symbol;Acc:... [more]
Iqsec11.540e-1121.18IQ motif and Sec7 domain 1 [Source:MGI Symbol;Acc:... [more]
Iqsec28.102e-1121.13IQ motif and Sec7 domain 2 [Source:MGI Symbol;Acc:... [more]
Iqsec21.796e-1021.19IQ motif and Sec7 domain 2 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DN90|IQEC1_HUMAN2.727e-1122.06IQ motif and SEC7 domain-containing protein 1 OS=H... [more]
sp|Q8R0S2|IQEC1_MOUSE9.571e-1121.18IQ motif and SEC7 domain-containing protein 1 OS=M... [more]
sp|Q5DU25|IQEC2_MOUSE2.563e-921.19IQ motif and SEC7 domain-containing protein 2 OS=M... [more]
sp|Q5JU85|IQEC2_HUMAN2.589e-921.19IQ motif and SEC7 domain-containing protein 2 OS=H... [more]
sp|Q9Y6D5|BIG2_HUMAN8.760e-922.47Brefeldin A-inhibited guanine nucleotide-exchange ... [more]
back to top
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1G8514.245e-1723.87SEC7 domain-containing protein OS=Helobdella robus... [more]
A0A1J1J6T12.289e-1625.08Non-specific serine/threonine protein kinase OS=Cl... [more]
A0A5N5SX208.210e-1524.54IQ motif and SEC7 domain-containing protein 1 OS=A... [more]
A0A553P6Y63.106e-1423.55SEC7 domain-containing protein OS=Tigriopus califo... [more]
T1IEB31.794e-1325.53SEC7 domain-containing protein (Fragment) OS=Rhodn... [more]
back to top
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IQSEC16.642e-1221.83IQ motif and SEC7 domain-containing protein 1-like... [more]
IQSEC17.126e-1221.47IQ motif and SEC7 domain-containing protein 1-like... [more]
IQSEC18.414e-1221.60IQ motif and SEC7 domain-containing protein 1-like... [more]
IQSEC18.942e-1221.47IQ motif and SEC7 domain-containing protein 1-like... [more]
IQSEC19.378e-1221.83IQ motif and SEC7 domain-containing protein 1-like... [more]
back to top
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007609.12.340e-1222.49pep scaffold:Pmarinus_7.0:GL477333:80854:108205:-1... [more]
iqsec1b7.716e-1222.06IQ motif and Sec7 domain ArfGEF 1b [Source:ZFIN;Ac... [more]
ENSPMAT00000004124.12.839e-620.11pep scaffold:Pmarinus_7.0:GL477097:5491:41441:-1 g... [more]
si:dkey-283b15.44.243e-621.24cytohesin 2 [Source:HGNC Symbol;Acc:HGNC:9502][more]
ENSPMAT00000004144.15.536e-620.11pep scaffold:Pmarinus_7.0:GL477097:6043:63444:-1 g... [more]
back to top
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO348827.320e-1622.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380043.055e-923.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000023260.27.742e-1321.62IQ motif and SEC7 domain-containing protein 2 [Sou... [more]
IQSEC12.214e-1222.06IQ motif and SEC7 domain-containing protein 1 [Sou... [more]
IQSEC14.427e-1221.70IQ motif and SEC7 domain-containing protein 1 [Sou... [more]
IQSEC14.809e-1221.70IQ motif and SEC7 domain-containing protein 1 [Sou... [more]
IQSEC15.363e-1221.70IQ motif and SEC7 domain-containing protein 1 [Sou... [more]
back to top
BLAST of IQ motif and SEC7 domain-containing protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070179.10.000e+099.57SMESG000070179.1[more]
SMESG000042180.19.162e-2123.66SMESG000042180.1[more]
SMESG000057299.13.765e-1322.82SMESG000057299.1[more]
SMESG000057299.14.860e-1322.82SMESG000057299.1[more]
SMESG000081851.17.466e-1223.62SMESG000081851.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002877 ID=SMED30002877|Name=IQ motif and SEC7 domain-containing protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1578bp
ATTTGATTGGTGGAAAAACTAACAAGTCAGCATTCAGTTGACATATTTAA
GTATCTTTAAATAAAACAAAAATTACCATCGGAAAAATGATAGATATTCA
GTCAGCTGCATATTTGGATATGGATTCAAGAGATATATTAGATTTCAGAA
AAAGAAAAAGTGATGTATTCTCTGATGAAGTTCCCAATAAAAAAGCTTCT
AAAGATACTTTTAAACCAGAATCCACCCCTAAACAACTTTTAAGGAGATT
TTCTACCAGATTTAAGTTAATAGGTTCAGGTATTAAAAGTAAAAATAAAA
ATTTTGAAAATCCTATAAAAGAAGATGGTGCAAACGAGTCAGATAAATTA
ACTAATAATATGAAAACCAATACCTCAATGATTTATTTCACAGCTTCACA
GCAGAAAAAATCTGCTGTTAATAATGATAGATTATCAAACAGTAGCGACA
ATTCTAGGCAGTCTTCAACGTCCGGGCAACACATTAAGTTGGGCATAGAT
CTATTTAACTTTAATTCTGAGTGCGGAGTGGATTATTTTCAAAGTAATGG
AATAGTAAATAAAGATAAAGATCTAGCTGAATTATTTATGAAGAAAAACG
GATTTAATAGATCCCGAATGTCTGACTATATGACGGATCCGGAAAACCTG
TCAATTCACATAGCTTTTTGTAATTTACTAGATTTGAAAAAGAAAACAGT
TGTTGAAACTATTCAGGAATATTTAAAATATTCATTAATAAGAGGTGAGT
ATCAAAGGGTGATCAAAATAATGGATCATCTCAGTCAGGCATATTTCAAT
CAGAATCTTGAAAAGGATATATTAGGATTAAATCTTGAACAACTCACTAT
AATATTCCAGTTTTTGATGACATTTTACACCAGCCAAATCCATGAAAAAT
CCAATCGATTAACCAGAGAAGATTTTATCAAAATGTTGAATGATTCTCTG
AAAAGCAATGGAATCAGTCGCAGTTATGCTCTCTCACTATACTATGAATT
ATCAGAGGTTTCATTCGATAACATCCTTGACACGAGAACAACAGATCTGG
ATAAAGTTTCGAAATTAATTACAGATTTACCGAAAGAGTTTCATTTAATT
CAATATTACCGCTATGTGATATGCCATGTCGATCTCTGTCAAGTGATATT
GCCGCACAATGGCTCGGATAAAATCAGTTACCATGACCGGACTGTGTTCT
TATTCAATGATTGTCTGATCACCAGCAAGCGGAAAGGAGGAATGTACGAC
ACAAATCAGTATCGATTTAAGCAAGTCATCAAATTGCTGGATATTAAATG
CGCATTTGTGAAACGCAACGGAATCCAGCTCATACAAATCAGTGATTTAT
CAAACAATATTTTGGGATCGTTTTATTCGAAAATAAATGAAGATTTTACC
AATTTCTACACATCTCTTGAGCAGGCAATTGGATTGCACAGGTCTGTTGT
CGATTATCAGAAGCTTTACCAAGCAAGGTCATCGTCAAGGTGAAGGTCAT
CACCATCATCGTTCTATTTTACAGCTCCTCGGGTTTCAAATGAGATTATT
TGTAGATAATCAGATTTATGATGAACAG
back to top

protein sequence of SMED30002877-orf-1

>SMED30002877-orf-1 ID=SMED30002877-orf-1|Name=SMED30002877-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=469bp
MIDIQSAAYLDMDSRDILDFRKRKSDVFSDEVPNKKASKDTFKPESTPKQ
LLRRFSTRFKLIGSGIKSKNKNFENPIKEDGANESDKLTNNMKTNTSMIY
FTASQQKKSAVNNDRLSNSSDNSRQSSTSGQHIKLGIDLFNFNSECGVDY
FQSNGIVNKDKDLAELFMKKNGFNRSRMSDYMTDPENLSIHIAFCNLLDL
KKKTVVETIQEYLKYSLIRGEYQRVIKIMDHLSQAYFNQNLEKDILGLNL
EQLTIIFQFLMTFYTSQIHEKSNRLTREDFIKMLNDSLKSNGISRSYALS
LYYELSEVSFDNILDTRTTDLDKVSKLITDLPKEFHLIQYYRYVICHVDL
CQVILPHNGSDKISYHDRTVFLFNDCLITSKRKGGMYDTNQYRFKQVIKL
LDIKCAFVKRNGIQLIQISDLSNNILGSFYSKINEDFTNFYTSLEQAIGL
HRSVVDYQKLYQARSSSR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000016pharynx
PLANA:0000019muscle progenitor cell
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002056medial muscle cell
PLANA:0002109X1 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR033742IQSEC_PH
IPR035999Sec7_dom_sf
IPR000904Sec7_dom
IPR001849PH_domain
IPR023394Sec7_C_sf
IPR011993PH-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0032012regulation of ARF protein signal transduction
GO:0043547positive regulation of GTPase activity
Vocabulary: molecular function
TermDefinition
GO:0005086ARF guanyl-nucleotide exchange factor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000904Sec7 domainSMARTSM00222sec7_5coord: 126..310
e-value: 1.0E-6
score: 24.0
IPR000904Sec7 domainPFAMPF01369Sec7coord: 132..306
e-value: 7.6E-19
score: 68.1
IPR000904Sec7 domainPROSITEPS50190SEC7coord: 122..308
score: 14.046
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 334..460
e-value: 1.0E-12
score: 50.0
IPR023394Sec7, C-terminal domain superfamilyGENE3DG3DSA:1.10.1000.11coord: 200..313
e-value: 4.4E-6
score: 28.5
IPR033742IQ motif and SEC7 domain-containing protein, PH domainPFAMPF16453IQ_SEC7_PHcoord: 337..448
e-value: 8.5E-11
score: 42.0
NoneNo IPR availableGENE3DG3DSA:1.10.220.20coord: 107..199
e-value: 2.6E-7
score: 32.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 110..129
NoneNo IPR availablePANTHERPTHR10663:SF342FI21420P1coord: 45..449
NoneNo IPR availablePANTHERPTHR10663GUANYL-NUCLEOTIDE EXCHANGE FACTORcoord: 45..449
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 364..410
IPR035999Sec7 domain superfamilySUPERFAMILYSSF48425Sec7 domaincoord: 132..306