Charged multivesicular body protein 5

Overview
NameCharged multivesicular body protein 5
Smed IDSMED30002863
Length (bp)953
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Charged multivesicular body protein 5 (SMED30002863) t-SNE clustered cells

Violin plots show distribution of expression levels for Charged multivesicular body protein 5 (SMED30002863) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Charged multivesicular body protein 5 (SMED30002863) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Charged multivesicular body protein 5 (SMED30002863) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002863

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30002863SMESG000073364.1 PL04003X1C12ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30002863 Contig3148GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30002863 dd_Smed_v4_1158_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002863 dd_Smed_v4_1158_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002863 SMED_01952_V2_1rGPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30002863 SMED_01952_V2_1rGPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Charged multivesicular body protein 5 vs. Ensembl Human
Match: CHMP5 (charged multivesicular body protein 5 [Source:HGNC Symbol;Acc:HGNC:26942])

HSP 1 Score: 238.039 bits (606), Expect = 9.635e-78
Identity = 141/218 (64.68%), Postives = 173/218 (79.36%), Query Frame = 2
Query:   47 MNRLFGTGKPKQPPPNLNDAVLNIDSRGESVDKKIQKLDVELAKYREQMKKMREGPAKNMIKQKALRVLKQKKVYENQREQMSNQSFNLEQANFAIQTVKDTKTQVDAMKLGVKSFKKEYKNMNXXXXXXXXXXXXXMTEQSNEIQEVLGRSYGMPEVXXXXXXXXXXXXGDDIGLGE-GSYLDDALNVPGVPSTNPGESTVAPNELAVDEFGLPKIP 697
            MNRLFG  KPK PPP+L D +  +DSR ES+DKKI +LD EL KY++Q+KKMREGPAKNM+KQKALRVLKQK++YE QR+ ++ QSFN+EQAN+ IQ++KDTKT VDAMKLGVK  KK YK + IDQIEDLQD+L+DM E +NEIQE L RSYG PE+DE DLEAELDALGD++   E  SYLD+A + P +P   P + T   + + VDEFGLP+IP
Sbjct:    1 MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMVKQKALRVLKQKRMYEQQRDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEMKKAYKQVKIDQIEDLQDQLEDMMEDANEIQEALSRSYGTPELDEDDLEAELDALGDELLADEDSSYLDEAASAPAIPEGVPTD-TKNKDGVLVDEFGLPQIP 217          
BLAST of Charged multivesicular body protein 5 vs. Ensembl Human
Match: CHMP5 (charged multivesicular body protein 5 [Source:HGNC Symbol;Acc:HGNC:26942])

HSP 1 Score: 207.994 bits (528), Expect = 9.960e-67
Identity = 109/158 (68.99%), Postives = 132/158 (83.54%), Query Frame = 2
Query:   47 MNRLFGTGKPKQPPPNLNDAVLNIDSRGESVDKKIQKLDVELAKYREQMKKMREGPAKNMIKQKALRVLKQKKVYENQREQMSNQSFNLEQANFAIQTVKDTKTQVDAMKLGVKSFKKEYKNMNXXXXXXXXXXXXXMTEQSNEIQEVLGRSYGMPEV 520
            MNRLFG  KPK PPP+L D +  +DSR ES+DKKI +LD EL KY++Q+KKMREGPAKNM+KQKALRVLKQK++YE QR+ ++ QSFN+EQAN+ IQ++KDTKT VDAMKLGVK  KK YK + IDQIEDLQD+L+DM E +NEIQE L RSYG PE+
Sbjct:    1 MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMVKQKALRVLKQKRMYEQQRDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEMKKAYKQVKIDQIEDLQDQLEDMMEDANEIQEALSRSYGTPEL 158          
BLAST of Charged multivesicular body protein 5 vs. Ensembl Celegans
Match: vps-60 (Related to yeast Vacuolar Protein Sorting factor [Source:UniProtKB/TrEMBL;Acc:O16458])

HSP 1 Score: 221.861 bits (564), Expect = 8.390e-72
Identity = 134/219 (61.19%), Postives = 173/219 (79.00%), Query Frame = 2
Query:   47 MNRLFGTGKPKQPPPNLNDAVLNIDSRGESVDKKIQKLDVELAKYREQMKKMREGPAKNMIKQKALRVLKQKKVYENQREQMSNQSFNLEQANFAIQTVKDTKTQVDAMKLGVKSFKKEYKNMNXXXXXXXXXXXXXMTEQSNEIQEVLGRSYGMPEVXXXXXXXXXXXXGDDIGLGEG--SYLDDALNVPGVPSTNPGESTVAPNELAVDEFGLPKIP 697
            MNR+FGTGK K PPP+LN+A+ N++SR +S+DKKIQKLD +L K R+QM KMREGP+KN+IKQKALRVLKQK++YENQ+ Q+  Q+FN++Q+NFAIQ +KD +  V AMK G+K+ +KEYK MNIDQIEDLQD+++DM + +NEIQE + R Y  P++DEADLEAEL  LGD++ +GE   +YLD+AL  P VPS  P   T     L VDEFGLPK+P
Sbjct:    1 MNRIFGTGK-KVPPPDLNNAISNVESRSDSIDKKIQKLDQDLMKLRDQMSKMREGPSKNLIKQKALRVLKQKRMYENQKGQLDQQAFNMDQSNFAIQGMKDNQVTVAAMKDGLKTMQKEYKKMNIDQIEDLQDQMEDMLDMNNEIQEAMSRQYDTPDIDEADLEAELAMLGDELDIGESDTNYLDEALAAPTVPSDKP--KTRVAEGLEVDEFGLPKLP 216          
BLAST of Charged multivesicular body protein 5 vs. Ensembl Fly
Match: Vps60 (gene:FBgn0036740 transcript:FBtr0333123)

HSP 1 Score: 237.269 bits (604), Expect = 1.127e-77
Identity = 136/220 (61.82%), Postives = 170/220 (77.27%), Query Frame = 2
Query:   47 MNRLFGTGKPKQPPPNLNDAVLNIDSRGESVDKKIQKLDVELAKYREQMKKMREGPAKNMIKQKALRVLKQKKVYENQREQMSNQSFNLEQANFAIQTVKDTKTQVDAMKLGVKSFKKEYKNMNXXXXXXXXXXXXXMTEQSNEIQEVLGRSYGMPEVXXXXXXXXXXXXGDDIGLGEG-SYLDDALNVPGVPSTNPGESTVAP--NELAVDEFGLPKIP 697
            MNRLFG GKPK+P P+LND +  +D+R  ++++KI  L+ EL KYREQM KMREGPAKN +KQKALRVLKQKK YE Q E + NQSFN+EQAN+A Q++KDT+  V AMK GVK  K EYK +NIDQIED+QD++ DM EQ++E+QE LGR+YGMPEVD+ DL+AELDALGD+I L +  SYLDD +  P  PS  PG  ++ P  + +  DEFGLPKIP
Sbjct:    1 MNRLFGRGKPKEPGPSLNDCIAGVDARATNIEEKISNLEAELRKYREQMSKMREGPAKNSVKQKALRVLKQKKAYEQQAESLRNQSFNMEQANYAAQSLKDTQATVAAMKDGVKQMKTEYKKINIDQIEDIQDDMADMFEQADEVQEALGRTYGMPEVDDDDLQAELDALGDEIALDDDTSYLDDVVKAPEAPSREPGADSIVPGKSTIETDEFGLPKIP 220          
BLAST of Charged multivesicular body protein 5 vs. Ensembl Fly
Match: Vps60 (gene:FBgn0036740 transcript:FBtr0075201)

HSP 1 Score: 237.269 bits (604), Expect = 1.127e-77
Identity = 136/220 (61.82%), Postives = 170/220 (77.27%), Query Frame = 2
Query:   47 MNRLFGTGKPKQPPPNLNDAVLNIDSRGESVDKKIQKLDVELAKYREQMKKMREGPAKNMIKQKALRVLKQKKVYENQREQMSNQSFNLEQANFAIQTVKDTKTQVDAMKLGVKSFKKEYKNMNXXXXXXXXXXXXXMTEQSNEIQEVLGRSYGMPEVXXXXXXXXXXXXGDDIGLGEG-SYLDDALNVPGVPSTNPGESTVAP--NELAVDEFGLPKIP 697
            MNRLFG GKPK+P P+LND +  +D+R  ++++KI  L+ EL KYREQM KMREGPAKN +KQKALRVLKQKK YE Q E + NQSFN+EQAN+A Q++KDT+  V AMK GVK  K EYK +NIDQIED+QD++ DM EQ++E+QE LGR+YGMPEVD+ DL+AELDALGD+I L +  SYLDD +  P  PS  PG  ++ P  + +  DEFGLPKIP
Sbjct:    1 MNRLFGRGKPKEPGPSLNDCIAGVDARATNIEEKISNLEAELRKYREQMSKMREGPAKNSVKQKALRVLKQKKAYEQQAESLRNQSFNMEQANYAAQSLKDTQATVAAMKDGVKQMKTEYKKINIDQIEDIQDDMADMFEQADEVQEALGRTYGMPEVDDDDLQAELDALGDEIALDDDTSYLDDVVKAPEAPSREPGADSIVPGKSTIETDEFGLPKIP 220          
BLAST of Charged multivesicular body protein 5 vs. Ensembl Zebrafish
Match: chmp5b (charged multivesicular body protein 5b [Source:NCBI gene;Acc:393351])

HSP 1 Score: 235.728 bits (600), Expect = 5.699e-77
Identity = 130/218 (59.63%), Postives = 165/218 (75.69%), Query Frame = 2
Query:   47 MNRLFGTGKPKQPPPNLNDAVLNIDSRGESVDKKIQKLDVELAKYREQMKKMREGPAKNMIKQKALRVLKQKKVYENQREQMSNQSFNLEQANFAIQTVKDTKTQVDAMKLGVKSFKKEYKNMNXXXXXXXXXXXXXMTEQSNEIQEVLGRSYGMPEVXXXX-XXXXXXXXGDDIGLGEGSYLDDALNVPGVPSTNPGESTVAPNELAVDEFGLPKIP 697
            MNR+FG GKPK PPPNL D +  +DSR ESVDKKI +LD EL KY++QMKKMR+GP+KNM+KQKA+RVLKQK++YE QR+Q+  QSFN+EQAN+ IQT+KDTKT V+AMK+G K  KK YKN+ IDQIEDLQD+L+DM E +NE+QE L RSYG PE+DE D          + +   + SYLD+A + P +P   PG+ T   + + VDEFGLP+IP
Sbjct:    1 MNRIFGRGKPKGPPPNLTDCISGVDSRAESVDKKIARLDAELMKYKDQMKKMRDGPSKNMVKQKAMRVLKQKRMYEGQRDQLMQQSFNMEQANYTIQTLKDTKTTVEAMKIGAKEMKKAYKNVKIDQIEDLQDQLEDMMEDANEVQEALSRSYGTPEIDEDDLEAELDALGDELLLDDDNSYLDEASSAPAIPEGAPGDRTTNRDGVLVDEFGLPQIP 218          
BLAST of Charged multivesicular body protein 5 vs. Ensembl Zebrafish
Match: chmp5a (charged multivesicular body protein 5a [Source:ZFIN;Acc:ZDB-GENE-060503-60])

HSP 1 Score: 211.46 bits (537), Expect = 4.019e-67
Identity = 116/218 (53.21%), Postives = 162/218 (74.31%), Query Frame = 2
Query:   47 MNRLFGTGKPKQPPPNLNDAVLNIDSRGESVDKKIQKLDVELAKYREQMKKMREGPAKNMIKQKALRVLKQKKVYENQREQMSNQSFNLEQANFAIQTVKDTKTQVDAMKLGVKSFKKEYKNMNXXXXXXXXXXXXXMTEQSNEIQEVLGRSYGMPEVXXXX-XXXXXXXXGDDIGLGEGSYLDDALNVPGVPSTNPGESTVAPNELAVDEFGLPKIP 697
            MNR+FG  K +   PNL+D + N+D+R ES+DKKI ++D EL KY++QMKKMR+GP+KN +KQKA+RVLKQK++YE QR+Q+S QSFN+EQAN+ IQ+++DTKT V+AMK+G K  KK YK + +DQIEDLQD+L+DM E++NE+QE L RSYG PE+DE +          + +   + SYLD+A + P +P   P ++    + + VDEFGLP+IP
Sbjct:   33 MNRIFGRSK-QAASPNLSDCIGNVDTRIESIDKKIARIDAELMKYKDQMKKMRDGPSKNTVKQKAMRVLKQKRMYEGQRDQLSQQSFNMEQANYTIQSLRDTKTTVEAMKIGAKEMKKAYKQVKMDQIEDLQDQLEDMMEEANEVQEALSRSYGTPEIDEDELEAELDALGDELLLDDDSSYLDEASSAPSIPEGMPSDTKTNKDGVLVDEFGLPQIP 249          
BLAST of Charged multivesicular body protein 5 vs. Ensembl Zebrafish
Match: chmp5a (charged multivesicular body protein 5a [Source:ZFIN;Acc:ZDB-GENE-060503-60])

HSP 1 Score: 193.741 bits (491), Expect = 1.765e-60
Identity = 107/200 (53.50%), Postives = 150/200 (75.00%), Query Frame = 2
Query:   47 MNRLFGTGKPKQPPPNLNDAVLNIDSRGESVDKKIQKLDVELAKYREQMKKMREGPAKNMIKQKALRVLKQKKVYENQREQMSNQSFNLEQANFAIQTVKDTKTQVDAMKLGVKSFKKEYKNMNXXXXXXXXXXXXXMTEQSNEIQEVLGRSYGMPEVXXXX-XXXXXXXXGDDIGLGEGSYLDDALNVPGVPSTNPGES 643
            MNR+FG  K +   PNL+D + N+D+R ES+DKKI ++D EL KY++QMKKMR+GP+KN +KQKA+RVLKQK++YE QR+Q+S QSFN+EQAN+ IQ+++DTKT V+AMK+G K  KK YK + +DQIEDLQD+L+DM E++NE+QE L RSYG PE+DE +          + +   + SYLD+A + P +P   P ++
Sbjct:    1 MNRIFGRSK-QAASPNLSDCIGNVDTRIESIDKKIARIDAELMKYKDQMKKMRDGPSKNTVKQKAMRVLKQKRMYEGQRDQLSQQSFNMEQANYTIQSLRDTKTTVEAMKIGAKEMKKAYKQVKMDQIEDLQDQLEDMMEEANEVQEALSRSYGTPEIDEDELEAELDALGDELLLDDDSSYLDEASSAPSIPEGMPSDT 199          
BLAST of Charged multivesicular body protein 5 vs. Ensembl Xenopus
Match: slc25a12 (solute carrier family 25 member 12 [Source:Xenbase;Acc:XB-GENE-1002100])

HSP 1 Score: 224.172 bits (570), Expect = 2.058e-72
Identity = 129/218 (59.17%), Postives = 160/218 (73.39%), Query Frame = 2
Query:   47 MNRLFGTGKPKQPPPNLNDAVLNIDSRGESVDKKIQKLDVELAKYREQMKKMREGPAKNMIKQKALRVLKQKKVYENQREQMSNQSFNLEQANFAIQTVKDTKTQVDAMKLGVKSFKKEYKNMNXXXXXXXXXXXXXMTEQSNEIQEVLGRSYGMPEVXXXX-XXXXXXXXGDDIGLGEGSYLDDALNVPGVPSTNPGESTVAPNELAVDEFGLPKIP 697
            MNRLFG  KPK PP  L D + N+DSR ES+DKKI +LD EL KY++QMKKMREGP+KNM+KQKALRVLKQK++YE QR+ ++ QSFN+EQ N+AIQ++KDTKT VDAMK+G K  KK YK + IDQIEDLQD+L+DM E +NEIQE L RSYG PE+DE D          + +   + SYLD+A + P +P   P +S      L VDEFGLP+IP
Sbjct:    1 MNRLFGKSKPKVPPSTLTDCISNVDSRSESIDKKISRLDAELVKYKDQMKKMREGPSKNMVKQKALRVLKQKRMYEQQRDNLNQQSFNMEQTNYAIQSLKDTKTTVDAMKVGAKEMKKAYKQVKIDQIEDLQDQLEDMMENANEIQEALSRSYGTPEIDEDDLEAELDALGDELLLDDDTSYLDEAASAPAIPEGVPNDSKNKDGVL-VDEFGLPQIP 217          
BLAST of Charged multivesicular body protein 5 vs. Ensembl Xenopus
Match: slc25a12 (solute carrier family 25 member 12 [Source:Xenbase;Acc:XB-GENE-1002100])

HSP 1 Score: 223.016 bits (567), Expect = 1.211e-71
Identity = 129/218 (59.17%), Postives = 160/218 (73.39%), Query Frame = 2
Query:   47 MNRLFGTGKPKQPPPNLNDAVLNIDSRGESVDKKIQKLDVELAKYREQMKKMREGPAKNMIKQKALRVLKQKKVYENQREQMSNQSFNLEQANFAIQTVKDTKTQVDAMKLGVKSFKKEYKNMNXXXXXXXXXXXXXMTEQSNEIQEVLGRSYGMPEVXXXX-XXXXXXXXGDDIGLGEGSYLDDALNVPGVPSTNPGESTVAPNELAVDEFGLPKIP 697
            MNRLFG  KPK PP  L D + N+DSR ES+DKKI +LD EL KY++QMKKMREGP+KNM+KQKALRVLKQK++YE QR+ ++ QSFN+EQ N+AIQ++KDTKT VDAMK+G K  KK YK + IDQIEDLQD+L+DM E +NEIQE L RSYG PE+DE D          + +   + SYLD+A + P +P   P +S      L VDEFGLP+IP
Sbjct:   22 MNRLFGKSKPKVPPSTLTDCISNVDSRSESIDKKISRLDAELVKYKDQMKKMREGPSKNMVKQKALRVLKQKRMYEQQRDNLNQQSFNMEQTNYAIQSLKDTKTTVDAMKVGAKEMKKAYKQVKIDQIEDLQDQLEDMMENANEIQEALSRSYGTPEIDEDDLEAELDALGDELLLDDDTSYLDEAASAPAIPEGVPNDSKNKDGVL-VDEFGLPQIP 238          
BLAST of Charged multivesicular body protein 5 vs. Ensembl Xenopus
Match: slc25a12 (solute carrier family 25 member 12 [Source:Xenbase;Acc:XB-GENE-1002100])

HSP 1 Score: 211.46 bits (537), Expect = 2.085e-67
Identity = 119/200 (59.50%), Postives = 149/200 (74.50%), Query Frame = 2
Query:   47 MNRLFGTGKPKQPPPNLNDAVLNIDSRGESVDKKIQKLDVELAKYREQMKKMREGPAKNMIKQKALRVLKQKKVYENQREQMSNQSFNLEQANFAIQTVKDTKTQVDAMKLGVKSFKKEYKNMNXXXXXXXXXXXXXMTEQSNEIQEVLGRSYGMPEVXXXX-XXXXXXXXGDDIGLGEGSYLDDALNVPGVPSTNPGES 643
            MNRLFG  KPK PP  L D + N+DSR ES+DKKI +LD EL KY++QMKKMREGP+KNM+KQKALRVLKQK++YE QR+ ++ QSFN+EQ N+AIQ++KDTKT VDAMK+G K  KK YK + IDQIEDLQD+L+DM E +NEIQE L RSYG PE+DE D          + +   + SYLD+A + P +P   P +S
Sbjct:    1 MNRLFGKSKPKVPPSTLTDCISNVDSRSESIDKKISRLDAELVKYKDQMKKMREGPSKNMVKQKALRVLKQKRMYEQQRDNLNQQSFNMEQTNYAIQSLKDTKTTVDAMKVGAKEMKKAYKQVKIDQIEDLQDQLEDMMENANEIQEALSRSYGTPEIDEDDLEAELDALGDELLLDDDTSYLDEAASAPAIPEGVPNDS 200          
BLAST of Charged multivesicular body protein 5 vs. Ensembl Mouse
Match: Chmp5 (charged multivesicular body protein 5 [Source:MGI Symbol;Acc:MGI:1924209])

HSP 1 Score: 238.424 bits (607), Expect = 4.773e-78
Identity = 141/218 (64.68%), Postives = 173/218 (79.36%), Query Frame = 2
Query:   47 MNRLFGTGKPKQPPPNLNDAVLNIDSRGESVDKKIQKLDVELAKYREQMKKMREGPAKNMIKQKALRVLKQKKVYENQREQMSNQSFNLEQANFAIQTVKDTKTQVDAMKLGVKSFKKEYKNMNXXXXXXXXXXXXXMTEQSNEIQEVLGRSYGMPEVXXXXXXXXXXXXGDDIGLGE-GSYLDDALNVPGVPSTNPGESTVAPNELAVDEFGLPKIP 697
            MNR FG  KPK PPP+L D +  +DSR ES+DKKI +LD EL KY++Q+KKMREGPAKNM+KQKALRVLKQK++YE QR+ ++ QSFN+EQAN+ IQ++KDTKT VDAMKLGVK  KK YK + IDQIEDLQD+L+DM E +NEIQE LGRSYG PE+DE DLEAELDALGD++   E  SYLD+A + P +P   P + T   + + VDEFGLP+IP
Sbjct:    1 MNRFFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMVKQKALRVLKQKRMYEQQRDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEMKKAYKEVKIDQIEDLQDQLEDMMEDANEIQEALGRSYGTPELDEDDLEAELDALGDELLADEDSSYLDEAASAPAIPEGVPTD-TKNKDGVLVDEFGLPQIP 217          
BLAST of Charged multivesicular body protein 5 vs. UniProt/SwissProt
Match: sp|Q4QQV8|CHMP5_RAT (Charged multivesicular body protein 5 OS=Rattus norvegicus OX=10116 GN=Chmp5 PE=2 SV=1)

HSP 1 Score: 238.424 bits (607), Expect = 3.339e-77
Identity = 141/218 (64.68%), Postives = 173/218 (79.36%), Query Frame = 2
Query:   47 MNRLFGTGKPKQPPPNLNDAVLNIDSRGESVDKKIQKLDVELAKYREQMKKMREGPAKNMIKQKALRVLKQKKVYENQREQMSNQSFNLEQANFAIQTVKDTKTQVDAMKLGVKSFKKEYKNMNXXXXXXXXXXXXXMTEQSNEIQEVLGRSYGMPEVXXXXXXXXXXXXGDDIGLGE-GSYLDDALNVPGVPSTNPGESTVAPNELAVDEFGLPKIP 697
            MNR FG  KPK PPP+L D +  +DSR ES+DKKI +LD EL KY++Q+KKMREGPAKNM+KQKALRVLKQK++YE QR+ ++ QSFN+EQAN+ IQ++KDTKT VDAMKLGVK  KK YK + IDQIEDLQD+L+DM E +NEIQE LGRSYG PE+DE DLEAELDALGD++   E  SYLD+A + P +P   P + T   + + VDEFGLP+IP
Sbjct:    1 MNRFFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMVKQKALRVLKQKRMYEQQRDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEMKKAYKEVKIDQIEDLQDQLEDMMEDANEIQEALGRSYGTPELDEDDLEAELDALGDELLADEDSSYLDEAASAPAIPEGVPTD-TKNKDGVLVDEFGLPQIP 217          
BLAST of Charged multivesicular body protein 5 vs. UniProt/SwissProt
Match: sp|Q9D7S9|CHMP5_MOUSE (Charged multivesicular body protein 5 OS=Mus musculus OX=10090 GN=Chmp5 PE=1 SV=1)

HSP 1 Score: 238.424 bits (607), Expect = 3.339e-77
Identity = 141/218 (64.68%), Postives = 173/218 (79.36%), Query Frame = 2
Query:   47 MNRLFGTGKPKQPPPNLNDAVLNIDSRGESVDKKIQKLDVELAKYREQMKKMREGPAKNMIKQKALRVLKQKKVYENQREQMSNQSFNLEQANFAIQTVKDTKTQVDAMKLGVKSFKKEYKNMNXXXXXXXXXXXXXMTEQSNEIQEVLGRSYGMPEVXXXXXXXXXXXXGDDIGLGE-GSYLDDALNVPGVPSTNPGESTVAPNELAVDEFGLPKIP 697
            MNR FG  KPK PPP+L D +  +DSR ES+DKKI +LD EL KY++Q+KKMREGPAKNM+KQKALRVLKQK++YE QR+ ++ QSFN+EQAN+ IQ++KDTKT VDAMKLGVK  KK YK + IDQIEDLQD+L+DM E +NEIQE LGRSYG PE+DE DLEAELDALGD++   E  SYLD+A + P +P   P + T   + + VDEFGLP+IP
Sbjct:    1 MNRFFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMVKQKALRVLKQKRMYEQQRDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEMKKAYKEVKIDQIEDLQDQLEDMMEDANEIQEALGRSYGTPELDEDDLEAELDALGDELLADEDSSYLDEAASAPAIPEGVPTD-TKNKDGVLVDEFGLPQIP 217          
BLAST of Charged multivesicular body protein 5 vs. UniProt/SwissProt
Match: sp|Q5RBR3|CHMP5_PONAB (Charged multivesicular body protein 5 OS=Pongo abelii OX=9601 GN=CHMP5 PE=2 SV=1)

HSP 1 Score: 238.039 bits (606), Expect = 4.627e-77
Identity = 141/218 (64.68%), Postives = 173/218 (79.36%), Query Frame = 2
Query:   47 MNRLFGTGKPKQPPPNLNDAVLNIDSRGESVDKKIQKLDVELAKYREQMKKMREGPAKNMIKQKALRVLKQKKVYENQREQMSNQSFNLEQANFAIQTVKDTKTQVDAMKLGVKSFKKEYKNMNXXXXXXXXXXXXXMTEQSNEIQEVLGRSYGMPEVXXXXXXXXXXXXGDDIGLGE-GSYLDDALNVPGVPSTNPGESTVAPNELAVDEFGLPKIP 697
            MNRLFG  KPK PPP+L D +  +DSR ES+DKKI +LD EL KY++Q+KKMREGPAKNM+KQKALRVLKQK++YE QR+ ++ QSFN+EQAN+ IQ++KDTKT VDAMKLGVK  KK YK + IDQIEDLQD+L+DM E +NEIQE L RSYG PE+DE DLEAELDALGD++   E  SYLD+A + P +P   P + T   + + VDEFGLP+IP
Sbjct:    1 MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMVKQKALRVLKQKRMYEQQRDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEMKKAYKQVKIDQIEDLQDQLEDMMEDANEIQEALSRSYGTPELDEDDLEAELDALGDELLADEDSSYLDEAASAPAIPEGVPTD-TKNKDGVLVDEFGLPQIP 217          
BLAST of Charged multivesicular body protein 5 vs. UniProt/SwissProt
Match: sp|Q9NZZ3|CHMP5_HUMAN (Charged multivesicular body protein 5 OS=Homo sapiens OX=9606 GN=CHMP5 PE=1 SV=1)

HSP 1 Score: 238.039 bits (606), Expect = 4.627e-77
Identity = 141/218 (64.68%), Postives = 173/218 (79.36%), Query Frame = 2
Query:   47 MNRLFGTGKPKQPPPNLNDAVLNIDSRGESVDKKIQKLDVELAKYREQMKKMREGPAKNMIKQKALRVLKQKKVYENQREQMSNQSFNLEQANFAIQTVKDTKTQVDAMKLGVKSFKKEYKNMNXXXXXXXXXXXXXMTEQSNEIQEVLGRSYGMPEVXXXXXXXXXXXXGDDIGLGE-GSYLDDALNVPGVPSTNPGESTVAPNELAVDEFGLPKIP 697
            MNRLFG  KPK PPP+L D +  +DSR ES+DKKI +LD EL KY++Q+KKMREGPAKNM+KQKALRVLKQK++YE QR+ ++ QSFN+EQAN+ IQ++KDTKT VDAMKLGVK  KK YK + IDQIEDLQD+L+DM E +NEIQE L RSYG PE+DE DLEAELDALGD++   E  SYLD+A + P +P   P + T   + + VDEFGLP+IP
Sbjct:    1 MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMVKQKALRVLKQKRMYEQQRDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEMKKAYKQVKIDQIEDLQDQLEDMMEDANEIQEALSRSYGTPELDEDDLEAELDALGDELLADEDSSYLDEAASAPAIPEGVPTD-TKNKDGVLVDEFGLPQIP 217          
BLAST of Charged multivesicular body protein 5 vs. UniProt/SwissProt
Match: sp|Q9VVI9|CHMP5_DROME (Charged multivesicular body protein 5 OS=Drosophila melanogaster OX=7227 GN=Vps60 PE=1 SV=2)

HSP 1 Score: 237.269 bits (604), Expect = 1.130e-76
Identity = 136/220 (61.82%), Postives = 170/220 (77.27%), Query Frame = 2
Query:   47 MNRLFGTGKPKQPPPNLNDAVLNIDSRGESVDKKIQKLDVELAKYREQMKKMREGPAKNMIKQKALRVLKQKKVYENQREQMSNQSFNLEQANFAIQTVKDTKTQVDAMKLGVKSFKKEYKNMNXXXXXXXXXXXXXMTEQSNEIQEVLGRSYGMPEVXXXXXXXXXXXXGDDIGLGEG-SYLDDALNVPGVPSTNPGESTVAP--NELAVDEFGLPKIP 697
            MNRLFG GKPK+P P+LND +  +D+R  ++++KI  L+ EL KYREQM KMREGPAKN +KQKALRVLKQKK YE Q E + NQSFN+EQAN+A Q++KDT+  V AMK GVK  K EYK +NIDQIED+QD++ DM EQ++E+QE LGR+YGMPEVD+ DL+AELDALGD+I L +  SYLDD +  P  PS  PG  ++ P  + +  DEFGLPKIP
Sbjct:    1 MNRLFGRGKPKEPGPSLNDCIAGVDARATNIEEKISNLEAELRKYREQMSKMREGPAKNSVKQKALRVLKQKKAYEQQAESLRNQSFNMEQANYAAQSLKDTQATVAAMKDGVKQMKTEYKKINIDQIEDIQDDMADMFEQADEVQEALGRTYGMPEVDDDDLQAELDALGDEIALDDDTSYLDDVVKAPEAPSREPGADSIVPGKSTIETDEFGLPKIP 220          
BLAST of Charged multivesicular body protein 5 vs. TrEMBL
Match: A0A267EH21 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017276g1 PE=4 SV=1)

HSP 1 Score: 297.36 bits (760), Expect = 5.781e-98
Identity = 162/217 (74.65%), Postives = 191/217 (88.02%), Query Frame = 2
Query:   47 MNRLFGTGKPKQPPPNLNDAVLNIDSRGESVDKKIQKLDVELAKYREQMKKMREGPAKNMIKQKALRVLKQKKVYENQREQMSNQSFNLEQANFAIQTVKDTKTQVDAMKLGVKSFKKEYKNMNXXXXXXXXXXXXXMTEQSNEIQEVLGRSYGMPEVXXXXXXXXXXXXGDDIGLGEGSYLDDALNVPGVPSTNPGESTVAPNELAVDEFGLPKIP 697
            MNRLFGTGKPKQPPPNLNDAV NIDSRGESVDKKI +LD ELAKYR+QMKKMREGP+KN++KQKALRVLKQK+ YE QR+Q++ QSFNLEQ NFAIQTVKDTKT V+AMK GVK FKK YK +N+D++EDLQD+L+D  +Q+NEI EV+GRSYGMP+VDE++LEAEL+ALGDDIG+G+ SYLD+ALN PGVPS  PG  + A  +  +DEFGLPKIP
Sbjct:    1 MNRLFGTGKPKQPPPNLNDAVSNIDSRGESVDKKIARLDAELAKYRDQMKKMREGPSKNLVKQKALRVLKQKRTYEQQRDQLTQQSFNLEQTNFAIQTVKDTKTTVEAMKGGVKEFKKSYKGINLDKVEDLQDDLEDFMDQANEINEVMGRSYGMPDVDESELEAELEALGDDIGVGDDSYLDEALNAPGVPSKEPGAESAAAGDAQLDEFGLPKIP 217          
BLAST of Charged multivesicular body protein 5 vs. TrEMBL
Match: A0A1I8G7E9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017276g2 PE=4 SV=1)

HSP 1 Score: 296.204 bits (757), Expect = 1.880e-97
Identity = 161/217 (74.19%), Postives = 191/217 (88.02%), Query Frame = 2
Query:   47 MNRLFGTGKPKQPPPNLNDAVLNIDSRGESVDKKIQKLDVELAKYREQMKKMREGPAKNMIKQKALRVLKQKKVYENQREQMSNQSFNLEQANFAIQTVKDTKTQVDAMKLGVKSFKKEYKNMNXXXXXXXXXXXXXMTEQSNEIQEVLGRSYGMPEVXXXXXXXXXXXXGDDIGLGEGSYLDDALNVPGVPSTNPGESTVAPNELAVDEFGLPKIP 697
            MNRLFG+GKPKQPPPNLNDAV NIDSRGESVDKKI +LD ELAKYR+QMKKMREGP+KN++KQKALRVLKQK+ YE QR+Q++ QSFNLEQ NFAIQTVKDTKT V+AMK GVK FKK YK +N+D++EDLQD+L+D  +Q+NEI EV+GRSYGMP+VDE++LEAEL+ALGDDIG+G+ SYLD+ALN PGVPS  PG  + A  +  +DEFGLPKIP
Sbjct:    1 MNRLFGSGKPKQPPPNLNDAVSNIDSRGESVDKKIARLDAELAKYRDQMKKMREGPSKNLVKQKALRVLKQKRTYEQQRDQLTQQSFNLEQTNFAIQTVKDTKTTVEAMKGGVKEFKKSYKGINLDKVEDLQDDLEDFMDQANEINEVMGRSYGMPDVDESELEAELEALGDDIGVGDDSYLDEALNAPGVPSKEPGAESAAAGDAQLDEFGLPKIP 217          
BLAST of Charged multivesicular body protein 5 vs. TrEMBL
Match: A0A1I8GI13 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017276g3 PE=4 SV=1)

HSP 1 Score: 294.278 bits (752), Expect = 1.078e-96
Identity = 160/217 (73.73%), Postives = 191/217 (88.02%), Query Frame = 2
Query:   47 MNRLFGTGKPKQPPPNLNDAVLNIDSRGESVDKKIQKLDVELAKYREQMKKMREGPAKNMIKQKALRVLKQKKVYENQREQMSNQSFNLEQANFAIQTVKDTKTQVDAMKLGVKSFKKEYKNMNXXXXXXXXXXXXXMTEQSNEIQEVLGRSYGMPEVXXXXXXXXXXXXGDDIGLGEGSYLDDALNVPGVPSTNPGESTVAPNELAVDEFGLPKIP 697
            MNRLFGTGKPKQPPP+LNDAV NIDSRGESVDKKI +LD ELAKYR+QMKKMREGP+KN++KQKALRVLKQK+ YE QR+Q++ QSFNLEQ NFAIQTVKDTKT V+AMK G+K FKK YK +N+D++EDLQD+L+D  +Q+NEI EV+GRSYGMP+VDE++LEAEL+ALGDDIG+G+ SYLD+ALN PGVPS  PG  + A  +  +DEFGLPKIP
Sbjct:    1 MNRLFGTGKPKQPPPSLNDAVSNIDSRGESVDKKIARLDAELAKYRDQMKKMREGPSKNLVKQKALRVLKQKRTYEQQRDQLTQQSFNLEQTNFAIQTVKDTKTTVEAMKGGMKEFKKSYKGINLDKVEDLQDDLEDFMDQANEINEVMGRSYGMPDVDESELEAELEALGDDIGVGDDSYLDEALNAPGVPSKEPGAESAAAGDAQLDEFGLPKIP 217          
BLAST of Charged multivesicular body protein 5 vs. TrEMBL
Match: A0A3S0ZIB6 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_016734 PE=4 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 1.019e-88
Identity = 152/219 (69.41%), Postives = 189/219 (86.30%), Query Frame = 2
Query:   47 MNRLFGTGKPKQPPPNLNDAVLNIDSRGESVDKKIQKLDVELAKYREQMKKMREGPAKNMIKQKALRVLKQKKVYENQREQMSNQSFNLEQANFAIQTVKDTKTQVDAMKLGVKSFKKEYKNMNXXXXXXXXXXXXXMTEQSNEIQEVLGRSYGMPEVXXXXXXXXXXXXGDDIGLGEG-SYLDDALNVPGVPSTNPGESTVAPNELAVDEFGLPKIPQ 700
            MNRLFG GK K+P PNLND + NIDSRGES+DKKI +LD+EL KY++QMKKMR+GPAKN +KQKA+RVLKQKK+YE+QR+Q+S QSFNLEQ NFA+Q++KDTKT VDAMK+GVK F+K YKN+NID IE++QDEL+DM E +NEIQEV+GRSYGMPEVD+ +LEAELDALGD++GL E  SYLDDA+  P +P++ PG  + A  ++ VDEFGLP+IPQ
Sbjct:    1 MNRLFGKGKSKEPAPNLNDCISNIDSRGESIDKKINRLDMELKKYKDQMKKMRDGPAKNQVKQKAMRVLKQKKMYESQRDQLSQQSFNLEQQNFAVQSLKDTKTTVDAMKVGVKDFRKAYKNVNIDHIENMQDELEDMMEMNNEIQEVMGRSYGMPEVDDDELEAELDALGDELGLDEDTSYLDDAVTAPSIPTSEPGMES-ATGDVPVDEFGLPQIPQ 218          
BLAST of Charged multivesicular body protein 5 vs. TrEMBL
Match: A0A0B7AUH3 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF141788 PE=4 SV=1)

HSP 1 Score: 272.707 bits (696), Expect = 2.998e-88
Identity = 149/219 (68.04%), Postives = 186/219 (84.93%), Query Frame = 2
Query:   47 MNRLFGTGKPKQPPPNLNDAVLNIDSRGESVDKKIQKLDVELAKYREQMKKMREGPAKNMIKQKALRVLKQKKVYENQREQMSNQSFNLEQANFAIQTVKDTKTQVDAMKLGVKSFKKEYKNMNXXXXXXXXXXXXXMTEQSNEIQEVLGRSYGMPEVXXXXXXXXXXXXGDDIGLGEG-SYLDDALNVPGVPSTNPGESTVAPNELAVDEFGLPKIPQ 700
            MNRLFG GKPK+P PNL D V NIDSRGES+DKKI +LD EL KY++QMKKMREGPAKN +KQKA+RVLKQK++YENQR+Q+S QSFNLEQ NFAIQ++KDTKT VDAMK+GVK FKK +K +NID IE++QD+L+D+ EQ+NEIQEV+GRSYGMPE+D+ +LEAEL ALGD++ L E  SYLDDA+  P  P++ PG  + +  +++VDEFGLP+IPQ
Sbjct:    1 MNRLFGRGKPKEPAPNLTDCVANIDSRGESIDKKISRLDAELVKYKDQMKKMREGPAKNQVKQKAMRVLKQKRMYENQRDQLSQQSFNLEQQNFAIQSLKDTKTTVDAMKIGVKDFKKAHKQVNIDNIENMQDDLEDLMEQTNEIQEVMGRSYGMPELDDDELEAELSALGDELQLDEDTSYLDDAVAAPSAPTSEPGAES-SRGDISVDEFGLPQIPQ 218          
BLAST of Charged multivesicular body protein 5 vs. Ensembl Cavefish
Match: chmp5b (charged multivesicular body protein 5 [Source:NCBI gene;Acc:103034662])

HSP 1 Score: 248.054 bits (632), Expect = 6.079e-82
Identity = 143/218 (65.60%), Postives = 176/218 (80.73%), Query Frame = 2
Query:   47 MNRLFGTGKPKQPPPNLNDAVLNIDSRGESVDKKIQKLDVELAKYREQMKKMREGPAKNMIKQKALRVLKQKKVYENQREQMSNQSFNLEQANFAIQTVKDTKTQVDAMKLGVKSFKKEYKNMNXXXXXXXXXXXXXMTEQSNEIQEVLGRSYGMPEVXXXXXXXXXXXXGDDIGLGEG-SYLDDALNVPGVPSTNPGESTVAPNELAVDEFGLPKIP 697
            MNR+FG GKPK PPPNL+D +  +DSR ESVDKKI +LD EL KY+EQMKKMR+GP+KNM+KQKA+RVLKQK++YE QR+Q+  QSFN+EQAN+ IQT+KDTKT VDAMK+G K  KK YKN+ IDQIEDLQD+L+DM E +NEIQE L RSYG P++DE DLEAELDALGD++ + E  SYLD+A   P +P   PGE +   + + VDEFGLP+IP
Sbjct:    1 MNRIFGRGKPKGPPPNLSDCIGTVDSRAESVDKKISRLDAELMKYKEQMKKMRDGPSKNMVKQKAMRVLKQKRMYEGQRDQLMQQSFNMEQANYTIQTLKDTKTTVDAMKIGAKEMKKAYKNVKIDQIEDLQDQLEDMMEDANEIQEALSRSYGTPDIDEDDLEAELDALGDELLMDEDTSYLDEASTAPSIPEGVPGEKSTNRDGVLVDEFGLPQIP 218          
BLAST of Charged multivesicular body protein 5 vs. Ensembl Cavefish
Match: chmp5a (charged multivesicular body protein 5 [Source:NCBI gene;Acc:103031885])

HSP 1 Score: 215.698 bits (548), Expect = 2.446e-69
Identity = 119/218 (54.59%), Postives = 163/218 (74.77%), Query Frame = 2
Query:   47 MNRLFGTGKPKQPPPNLNDAVLNIDSRGESVDKKIQKLDVELAKYREQMKKMREGPAKNMIKQKALRVLKQKKVYENQREQMSNQSFNLEQANFAIQTVKDTKTQVDAMKLGVKSFKKEYKNMNXXXXXXXXXXXXXMTEQSNEIQEVLGRSYGMPEVXXXX-XXXXXXXXGDDIGLGEGSYLDDALNVPGVPSTNPGESTVAPNELAVDEFGLPKIP 697
            MNR+FG  K  QPPPNL++ + N+D+R ES+DKKI ++D EL KY++QMKKMR+GPAKN +KQKA+RVLKQK++YE QR+Q++ QSFN+EQAN+ IQ++KDTKT V+AMK+G K  KK YK + +DQIEDLQD+L+DM E+++E+QE L RSYG P++DE D          + +   + SYLD+A   P +P   P +S    + + VDEFGLP+IP
Sbjct:    1 MNRIFGRSK-NQPPPNLSECIGNVDARAESIDKKIARIDSELVKYKDQMKKMRDGPAKNAVKQKAMRVLKQKRMYEGQRDQLAQQSFNMEQANYTIQSLKDTKTTVEAMKIGAKEMKKAYKQVKMDQIEDLQDQLEDMMEEASEVQEALSRSYGTPDIDEDDLEAELDALGDELLLDDDSSYLDEASAAPAIPEGMPSDSKTNKDGVLVDEFGLPQIP 217          
BLAST of Charged multivesicular body protein 5 vs. Ensembl Cavefish
Match: ENSAMXT00000025696.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000053.1:404898:405566:1 gene:ENSAMXG00000024969.2 transcript:ENSAMXT00000025696.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 193.356 bits (490), Expect = 1.638e-60
Identity = 110/220 (50.00%), Postives = 159/220 (72.27%), Query Frame = 2
Query:   47 MNRLFGTGK-PKQPPPNLNDAVLNIDSRGESVDKKIQKLDVELAKYREQMKKMREGPAKNMIKQKALRVLKQKKVYENQREQMSNQSFNLEQANFAIQTVKDTKTQVDAMKLGVKSFKKEYKNMNXXXXXXXXXXXXXMTEQSNEIQEVLGRSYGMPEVXXXXXXXXXXXXGDDIGLGEG-SYLDDALNVPGVPSTNPGESTVAPNELAVDEFGLPKIPQ 700
            M R+FG GK PK P P L D +   DSR ES+++KI +LD EL KY++QM+++++GP+KN+++QKA+RVL+QK +YE QREQ+  QSFN+ +A  +IQ +KDTKT V+A+K G+K  ++ +KN+ I QIE LQD+++ M   +N+IQE L R Y MPE+DE DL+A L ALGD++ + +  SYLD+    P VPS  PGES+   +E+  DE  LP +P+
Sbjct:    1 MKRMFGRGKQPKDPEPTLADCITLTDSRAESLERKISRLDAELLKYKKQMERLQDGPSKNLVQQKAMRVLRQKVMYEEQREQLMEQSFNMGRARDSIQALKDTKTTVEAIKAGLKEMREAHKNVKIGQIEALQDQMEKMILDANDIQEALSRRYSMPELDEDDLKAALGALGDELSIDDDTSYLDEFFAAPSVPSGVPGESSTYQDEVLTDELALPDVPE 220          
BLAST of Charged multivesicular body protein 5 vs. Ensembl Cavefish
Match: ENSAMXT00000042675.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000053.1:404199:404537:1 gene:ENSAMXG00000033472.1 transcript:ENSAMXT00000042675.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.079 bits (279), Expect = 1.834e-30
Identity = 55/99 (55.56%), Postives = 73/99 (73.74%), Query Frame = 2
Query:   47 MNRLFGTGKPKQPPPNLNDAVLNIDSRGESVDKKIQKLDVELAKYREQMKKMREGPAKNMIKQKALRVLKQKKVYENQREQMSNQSFNLEQANFAIQTV 343
            M RLFG GKPK P  +L D V  IDSR ES+D+KI   DVEL K  +QM+ MR+GP KN++KQKA+RVL++KK+YE QR+Q+  QS N+++A   IQ +
Sbjct:    1 MQRLFGRGKPKDPALSLADCVTLIDSRVESMDEKISGFDVELKKCLQQMQTMRDGPPKNLVKQKAMRVLRRKKMYEAQRDQLKQQSVNMKRARDIIQAL 99          
BLAST of Charged multivesicular body protein 5 vs. Ensembl Sea Lamprey
Match: chmp5a (charged multivesicular body protein 5a [Source:ZFIN;Acc:ZDB-GENE-060503-60])

HSP 1 Score: 237.269 bits (604), Expect = 1.796e-78
Identity = 130/218 (59.63%), Postives = 172/218 (78.90%), Query Frame = 2
Query:   47 MNRLFGTGKPKQPPPNLNDAVLNIDSRGESVDKKIQKLDVELAKYREQMKKMREGPAKNMIKQKALRVLKQKKVYENQREQMSNQSFNLEQANFAIQTVKDTKTQVDAMKLGVKSFKKEYKNMNXXXXXXXXXXXXXMTEQSNEIQEVLGRSYGMPEVXXXXXXXXXXXXGDDIGLGE-GSYLDDALNVPGVPSTNPGESTVAPNELAVDEFGLPKIP 697
            MNR+FG  K K PP +L D + N++SRGES+DKKI +L+VEL KY++QM KMR+GPAKN++KQKALRVLKQK+ YE QR+ +S QSFN+EQAN+ IQT+KDTKT VDAMK+G K  KK YK+++++ IEDLQD+++DM  +++EIQE LGRSY MPEVD+ +LEAEL+ALGD++   E  SYLD+A   P  P + P + T   + + VDEFGLP+IP
Sbjct:    1 MNRIFGRSKAKVPPASLTDCIANVESRGESIDKKITRLEVELKKYKDQMNKMRDGPAKNLVKQKALRVLKQKRTYEQQRDNLSQQSFNMEQANYTIQTLKDTKTTVDAMKIGAKEMKKAYKHVDLEDIEDLQDQMEDMMGEADEIQEALGRSYEMPEVDDDELEAELEALGDELLADEDASYLDEASTAPAAPDSVPNDKTTTKDGVLVDEFGLPQIP 218          
BLAST of Charged multivesicular body protein 5 vs. Ensembl Yeast
Match: VPS60 (Protein involved in late endosome to vacuole transport; cytoplasmic and vacuolar membrane protein; required for normal filament maturation during pseudohyphal growth; may function in targeting cargo proteins for degradation; interacts with Vta1p [Source:SGD;Acc:S000002894])

HSP 1 Score: 62.3882 bits (150), Expect = 5.941e-12
Identity = 46/155 (29.68%), Postives = 95/155 (61.29%), Query Frame = 2
Query:   47 MNRLFGTGKPKQPPPNLNDAVLNIDSRGESVDKKIQKLDVELAKYREQMKKMREGPAKNMIKQ-----KALRVLKQKKVYENQREQMSNQSFNLEQANFAIQTVKDTKTQVDAMKLGVKSFKKEYKNMNXXXXXXXXXXXXXMTEQSNEIQEVLG 496
            MNR+FG G  K     L ++  +++   +S+  +I +LD ++A+   Q++ +++   ++  KQ     +AL++L ++K  EN ++ + +QS+++ QA      +++T   ++A+K    + K +Y  +NID+++D+QDE+ D+ EQ +E+QEVL 
Sbjct:    1 MNRIFGYGNKKSHDQLLQESNQSMNQAQQSLSNRISQLDTQIAQLNFQLQNIQKNLQRSNNKQPSLRKQALKILNKRKQLENMKDSLDSQSWSMTQAQLTNDNLQNTMITINALKQTNNAMKAQYGKINIDKLQDMQDEMLDLIEQGDELQEVLA 155          
BLAST of Charged multivesicular body protein 5 vs. Ensembl Nematostella
Match: EDO49015 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHP5])

HSP 1 Score: 242.662 bits (618), Expect = 3.467e-80
Identity = 142/219 (64.84%), Postives = 174/219 (79.45%), Query Frame = 2
Query:   47 MNRLFGTGKPKQPPPNLNDAVLNIDSRGESVDKKIQKLDVELAKYREQMKKMREGPAKNMIKQKALRVLKQKKVYENQREQMSNQSFNLEQANFAIQTVKDTKTQVDAMKLGVKSFKKEYKNMNXXXXXXXXXXXXXMTEQSNEIQEVLGRSYGMP-EVXXXXXXXXXXXXGDDIGLGEGSYLDDALNVPGVPSTNPGE----STVAPNELAVDEFGLP 688
            MNRLFG GKPK+PPPNL D + N+DSRGES++KKI KLD EL KY++QMKKMR+GP+KNM+KQ+ALRVLKQKK YENQ E +  QSFN+EQANF  QT+KDTK  VDAMK G+K  KKEYK +NIDQIED+QD++ DM EQ+NEIQE LGR+YG+P ++DEADL+AEL+ALGDD+ L E +   D +N P  P T PGE     +   + +AVDEFGLP
Sbjct:    1 MNRLFGKGKPKEPPPNLTDCISNVDSRGESIEKKIAKLDQELLKYKDQMKKMRDGPSKNMLKQRALRVLKQKKQYENQLEGLRQQSFNMEQANFTTQTLKDTKHTVDAMKTGLKEMKKEYKKLNIDQIEDIQDDMADMMEQANEIQESLGRTYGLPDDIDEADLDAELEALGDDLALDEDTSYLDEVNAPAAPDTVPGERDPSGSRTQDGIAVDEFGLP 219          
BLAST of Charged multivesicular body protein 5 vs. Ensembl Medaka
Match: chmp5b (charged multivesicular body protein 5 [Source:NCBI gene;Acc:101159542])

HSP 1 Score: 251.521 bits (641), Expect = 2.514e-83
Identity = 141/218 (64.68%), Postives = 178/218 (81.65%), Query Frame = 2
Query:   47 MNRLFGTGKPKQPPPNLNDAVLNIDSRGESVDKKIQKLDVELAKYREQMKKMREGPAKNMIKQKALRVLKQKKVYENQREQMSNQSFNLEQANFAIQTVKDTKTQVDAMKLGVKSFKKEYKNMNXXXXXXXXXXXXXMTEQSNEIQEVLGRSYGMPEVXXXXXXXXXXXXGDDIGL-GEGSYLDDALNVPGVPSTNPGESTVAPNELAVDEFGLPKIP 697
            MNR+FGTGKPK PPPNL+D + N+DSR ESVDKKI +LD EL KY++QMKKMR+GP+KNM+KQKA+RVLKQK++YE QR+ +  QSFN+EQAN+ IQT+KDTKT VDAMK G+K  KK YK + ID+IED+QD+L+DM E +NEIQE +GRSYG PE+DE DLEAELDALGD++ +  + SYLD+A   P +P  NPG+ T   + + VDEFGLP+IP
Sbjct:    1 MNRIFGTGKPKAPPPNLSDCIGNVDSRTESVDKKIARLDAELVKYKDQMKKMRDGPSKNMVKQKAMRVLKQKRMYEGQRDNLMQQSFNMEQANYTIQTLKDTKTTVDAMKTGLKEMKKAYKQVKIDKIEDIQDQLEDMMEDANEIQEAMGRSYGTPEIDEDDLEAELDALGDELLMDDDSSYLDEAATAPSIPEGNPGDRTANRDGVLVDEFGLPQIP 218          
BLAST of Charged multivesicular body protein 5 vs. Ensembl Medaka
Match: chmp5a (charged multivesicular body protein 5 [Source:NCBI gene;Acc:101164680])

HSP 1 Score: 231.106 bits (588), Expect = 1.024e-74
Identity = 131/218 (60.09%), Postives = 174/218 (79.82%), Query Frame = 2
Query:   47 MNRLFGTGKPKQPPPNLNDAVLNIDSRGESVDKKIQKLDVELAKYREQMKKMREGPAKNMIKQKALRVLKQKKVYENQREQMSNQSFNLEQANFAIQTVKDTKTQVDAMKLGVKSFKKEYKNMNXXXXXXXXXXXXXMTEQSNEIQEVLGRSYGMPEVXXXXXXXXXXXXGDDIGLGE-GSYLDDALNVPGVPSTNPGESTVAPNELAVDEFGLPKIP 697
            M R+FG GKPK PPPNL+D +  +D+R ES++KKI +LD EL KY++Q+KKMR+GP+KN +KQKA+RVLKQK++YE QREQ++ QSFN+EQAN+ IQT+KDTKT V+AMK+G K  KK YK++ +DQI+DLQD+L+DM E++ E+QE L RSYG P++DE DLEAELDALGD++ L E  SYLD+A   P +P   P +S    + + VDEFGLP+IP
Sbjct:   43 MIRIFGRGKPKAPPPNLSDCISTVDARSESIEKKIGRLDAELLKYKDQLKKMRDGPSKNTVKQKAMRVLKQKRMYEGQREQLAQQSFNMEQANYTIQTLKDTKTTVEAMKIGAKEMKKAYKDVKLDQIDDLQDQLEDMMEEAGEVQESLSRSYGTPDIDEEDLEAELDALGDELLLDEDSSYLDEASAAPSIPEGIPSDSKTNKDGVLVDEFGLPQIP 260          
BLAST of Charged multivesicular body protein 5 vs. Planmine SMEST
Match: SMESG000078658.1 (SMESG000078658.1)

HSP 1 Score: 173.711 bits (439), Expect = 1.762e-53
Identity = 104/221 (47.06%), Postives = 143/221 (64.71%), Query Frame = 2
Query:   47 MNRLFGTGKPKQPPPNLNDAVLNIDSRGESVDKKIQKLDVELAKYREQMKKMREGPAKNMIKQKALRVLKQKKVYENQREQMSNQSFNLEQANFAIQTVKDTKTQVDAMKLGVKSFKKEYKNMNXXXXXXXXXXXXXMTEQSNEIQEVLGRSYGMPEVXXXXXXXXXXXXGDDIGLGEGS-YLDDALNVPGVPSTNP-GESTVAPNELAVDEFGLPKIPQK 703
            M R+FGTG+PK PPP+++DA+  ++SR E+VDKK+ KLD E+ KYR QM KM +GP+KN+IKQKALR LKQKKVYE Q EQ++NQSFNLE     +  ++D                  Y  M             D+ E  NE+Q++LG+  GMP++DE +LEAE +ALG ++   + + +LD+AL +PG+PS  P  +ST  P    +DEFGLPKIP+K
Sbjct:    1 MKRIFGTGQPKVPPPSIHDAISGVESRCETVDKKVAKLDAEINKYRAQMSKMPDGPSKNLIKQKALRCLKQKKVYEQQSEQLANQSFNLEMKGLNLTQIEDL-----------------YDEM------------ADINEDVNELQDILGQPMGMPDIDEDELEAEFEALGAEMDFEKDTQFLDEALKIPGIPSNEPEAKSTNVP----IDEFGLPKIPEK 188          
BLAST of Charged multivesicular body protein 5 vs. Planmine SMEST
Match: SMESG000078658.1 (SMESG000078658.1)

HSP 1 Score: 144.821 bits (364), Expect = 1.629e-42
Identity = 96/221 (43.44%), Postives = 130/221 (58.82%), Query Frame = 2
Query:   47 MNRLFGTGKPKQPPPNLNDAVLNIDSRGESVDKKIQKLDVELAKYREQMKKMREGPAKNMIKQKALRVLKQKKVYENQREQMSNQSFNLEQANFAIQTVKDTKTQVDAMKLGVKSFKKEYKNMNXXXXXXXXXXXXXMTEQSNEIQEVLGRSYGMPEVXXXXXXXXXXXXGDDIGLGEGS-YLDDALNVPGVPSTNP-GESTVAPNELAVDEFGLPKIPQK 703
            M R+FGTG+PK PPP+++DA+  ++SR E+VDKK+ KLD E+ KYR QM KM +GP+KN+IKQKALR LKQKKVYE Q         NL                              Y  M             D+ E  NE+Q++LG+  GMP++DE +LEAE +ALG ++   + + +LD+AL +PG+PS  P  +ST  P    +DEFGLPKIP+K
Sbjct:    1 MKRIFGTGQPKVPPPSIHDAISGVESRCETVDKKVAKLDAEINKYRAQMSKMPDGPSKNLIKQKALRCLKQKKVYEQQ---------NL------------------------------YDEM------------ADINEDVNELQDILGQPMGMPDIDEDELEAEFEALGAEMDFEKDTQFLDEALKIPGIPSNEPEAKSTNVP----IDEFGLPKIPEK 166          
BLAST of Charged multivesicular body protein 5 vs. Planmine SMEST
Match: SMESG000078658.1 (SMESG000078658.1)

HSP 1 Score: 59.3066 bits (142), Expect = 3.843e-11
Identity = 40/84 (47.62%), Postives = 60/84 (71.43%), Query Frame = 2
Query:  458 MTEQSNEIQEVLGRSYGMPEVXXXXXXXXXXXXGDDIGLGEGS-YLDDALNVPGVPSTNP-GESTVAPNELAVDEFGLPKIPQK 703
            + E  NE+Q++LG+  GMP++DE +LEAE +ALG ++   + + +LD+AL +PG+PS  P  +ST  P    +DEFGLPKIP+K
Sbjct:   19 INEDVNELQDILGQPMGMPDIDEDELEAEFEALGAEMDFEKDTQFLDEALKIPGIPSNEPEAKSTNVP----IDEFGLPKIPEK 98          
The following BLAST results are available for this feature:
BLAST of Charged multivesicular body protein 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CHMP59.635e-7864.68charged multivesicular body protein 5 [Source:HGNC... [more]
CHMP59.960e-6768.99charged multivesicular body protein 5 [Source:HGNC... [more]
back to top
BLAST of Charged multivesicular body protein 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
vps-608.390e-7261.19Related to yeast Vacuolar Protein Sorting factor ... [more]
back to top
BLAST of Charged multivesicular body protein 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Vps601.127e-7761.82gene:FBgn0036740 transcript:FBtr0333123[more]
Vps601.127e-7761.82gene:FBgn0036740 transcript:FBtr0075201[more]
back to top
BLAST of Charged multivesicular body protein 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
chmp5b5.699e-7759.63charged multivesicular body protein 5b [Source:NCB... [more]
chmp5a4.019e-6753.21charged multivesicular body protein 5a [Source:ZFI... [more]
chmp5a1.765e-6053.50charged multivesicular body protein 5a [Source:ZFI... [more]
back to top
BLAST of Charged multivesicular body protein 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
slc25a122.058e-7259.17solute carrier family 25 member 12 [Source:Xenbase... [more]
slc25a121.211e-7159.17solute carrier family 25 member 12 [Source:Xenbase... [more]
slc25a122.085e-6759.50solute carrier family 25 member 12 [Source:Xenbase... [more]
back to top
BLAST of Charged multivesicular body protein 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Chmp54.773e-7864.68charged multivesicular body protein 5 [Source:MGI ... [more]
back to top
BLAST of Charged multivesicular body protein 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q4QQV8|CHMP5_RAT3.339e-7764.68Charged multivesicular body protein 5 OS=Rattus no... [more]
sp|Q9D7S9|CHMP5_MOUSE3.339e-7764.68Charged multivesicular body protein 5 OS=Mus muscu... [more]
sp|Q5RBR3|CHMP5_PONAB4.627e-7764.68Charged multivesicular body protein 5 OS=Pongo abe... [more]
sp|Q9NZZ3|CHMP5_HUMAN4.627e-7764.68Charged multivesicular body protein 5 OS=Homo sapi... [more]
sp|Q9VVI9|CHMP5_DROME1.130e-7661.82Charged multivesicular body protein 5 OS=Drosophil... [more]
back to top
BLAST of Charged multivesicular body protein 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EH215.781e-9874.65Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8G7E91.880e-9774.19Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GI131.078e-9673.73Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A3S0ZIB61.019e-8869.41Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A0B7AUH32.998e-8868.04Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
back to top
BLAST of Charged multivesicular body protein 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
chmp5b6.079e-8265.60charged multivesicular body protein 5 [Source:NCBI... [more]
chmp5a2.446e-6954.59charged multivesicular body protein 5 [Source:NCBI... [more]
ENSAMXT00000025696.21.638e-6050.00pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000042675.11.834e-3055.56pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Charged multivesicular body protein 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
chmp5a1.796e-7859.63charged multivesicular body protein 5a [Source:ZFI... [more]
back to top
BLAST of Charged multivesicular body protein 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
VPS605.941e-1229.68Protein involved in late endosome to vacuole trans... [more]
back to top
BLAST of Charged multivesicular body protein 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO490153.467e-8064.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Charged multivesicular body protein 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
chmp5b2.514e-8364.68charged multivesicular body protein 5 [Source:NCBI... [more]
chmp5a1.024e-7460.09charged multivesicular body protein 5 [Source:NCBI... [more]
back to top
BLAST of Charged multivesicular body protein 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000078658.11.762e-5347.06SMESG000078658.1[more]
SMESG000078658.11.629e-4243.44SMESG000078658.1[more]
SMESG000078658.13.843e-1147.62SMESG000078658.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002863 ID=SMED30002863|Name=Charged multivesicular body protein 5|organism=Schmidtea mediterranea sexual|type=transcript|length=953bp
ATCTTACTATTTCATGTTTTTGTAAATTATATTTGGAAGTAGAAGTATGA
ATAGATTATTTGGTACCGGTAAACCGAAACAGCCACCCCCTAATTTAAAC
GATGCAGTGTTAAATATTGATAGTAGAGGCGAATCTGTTGATAAAAAAAT
TCAAAAATTAGATGTTGAATTGGCAAAATATCGCGAACAAATGAAAAAGA
TGAGGGAAGGTCCAGCTAAAAACATGATTAAACAAAAAGCTCTGAGAGTC
CTTAAACAGAAAAAAGTCTATGAGAATCAACGAGAACAAATGTCTAATCA
ATCGTTTAATTTAGAACAAGCAAATTTTGCAATTCAAACAGTTAAAGACA
CAAAAACCCAAGTTGATGCGATGAAATTGGGAGTTAAATCTTTCAAAAAA
GAATATAAAAATATGAACATTGATCAAATTGAAGATTTACAAGATGAATT
ACAAGATATGACTGAGCAATCAAATGAAATTCAAGAAGTTCTTGGTAGGT
CTTATGGAATGCCAGAAGTAGATGAAGCCGATCTGGAAGCAGAATTAGAT
GCCTTGGGAGATGATATAGGATTAGGAGAGGGTAGTTATTTAGACGATGC
ACTGAATGTTCCTGGGGTGCCATCAACAAATCCAGGTGAATCAACAGTGG
CTCCTAACGAGCTGGCCGTTGATGAATTTGGGTTGCCAAAAATTCCGCAG
AAAAATTGATAAATTATGATTGATTTTTGCGATCAAATAAGGACTGTGTA
CAAAAGAGATGGATTGTATACTTGTTTAATGAGTTTTATACGACTTTTAA
CGCTTTAATTATCTTCACGACAAAATTAGTTAATTGTTTACTACGTGTCA
TAAGATGGATTCAATATATTTTTTATGTGGTAATGAGAAGCTTGGGGAAA
TGATTTATATTTTCTTTTAAACTTTCATAAATTTATGCATTACGTTCTCT
CTG
back to top

protein sequence of SMED30002863-orf-1

>SMED30002863-orf-1 ID=SMED30002863-orf-1|Name=SMED30002863-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=221bp
MNRLFGTGKPKQPPPNLNDAVLNIDSRGESVDKKIQKLDVELAKYREQMK
KMREGPAKNMIKQKALRVLKQKKVYENQREQMSNQSFNLEQANFAIQTVK
DTKTQVDAMKLGVKSFKKEYKNMNIDQIEDLQDELQDMTEQSNEIQEVLG
RSYGMPEVDEADLEAELDALGDDIGLGEGSYLDDALNVPGVPSTNPGEST
VAPNELAVDEFGLPKIPQKN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000429neoblast
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR005024Snf7_fam
Vocabulary: biological process
TermDefinition
GO:0007034vacuolar transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 35..55
NoneNo IPR availableCOILSCoilCoilcoord: 121..148
NoneNo IPR availableCOILSCoilCoilcoord: 65..92
NoneNo IPR availablePANTHERPTHR22761SNF7 - RELATEDcoord: 1..217
NoneNo IPR availablePANTHERPTHR22761:SF48CHARGED MULTIVESICULAR BODY PROTEIN 5coord: 1..217
IPR005024Snf7 familyPFAMPF03357Snf7coord: 12..195
e-value: 5.5E-53
score: 179.1