APOBEC1 complementation factor

Overview
NameAPOBEC1 complementation factor
Smed IDSMED30002858
Length (bp)1996
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of APOBEC1 complementation factor (SMED30002858) t-SNE clustered cells

Violin plots show distribution of expression levels for APOBEC1 complementation factor (SMED30002858) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of APOBEC1 complementation factor (SMED30002858) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for APOBEC1 complementation factor (SMED30002858) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002858

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30002858SMESG000035182.1 PL08007A2E05ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30002858SMESG000035182.1 dd_Smed_v4_7056_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002858SMESG000035182.1 dd_Smed_v4_7056_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of APOBEC1 complementation factor vs. Ensembl Human
Match: A1CF (APOBEC1 complementation factor [Source:HGNC Symbol;Acc:HGNC:24086])

HSP 1 Score: 321.627 bits (823), Expect = 6.426e-101
Identity = 152/278 (54.68%), Postives = 200/278 (71.94%), Query Frame = 2
Query:  209 VIYESGQRR-CGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSK 1039
            ++ E+GQR+  GPP  W  + P +GCEIFI K+P+D FE +LIP+  +IG IY  R+MM+   ++RG+ F  ++    AK A+ +LNNY+I+    LGVC SVDNCRLFVGGIPK K + EI  EM+  TE +VD+IVYPSAADK KNRGFAFVEY +H+AAA+AR+K++   +QLWG  +AVDWAEPE +V+++ MS VKILYVRNLML+T+EE I + F+     P  + +VKKI D+AFVHF NR+ A      ++G  LDGS IEV  AKPV K
Sbjct:   31 LVQENGQRKYGGPPPGWDAAPPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYEIRNGRLLGVCASVDNCRLFVGGIPKTKKREEILSEMKKVTEGVVDVIVYPSAADKTKNRGFAFVEYESHRAAAMARRKLLPGRIQLWGHGIAVDWAEPEVEVDEDTMSSVKILYVRNLMLSTSEEMIEKEFNNI--KPGAVERVKKIRDYAFVHFSNREDAVEAMKALNGKVLDGSPIEVTLAKPVDK 306          
BLAST of APOBEC1 complementation factor vs. Ensembl Human
Match: A1CF (APOBEC1 complementation factor [Source:HGNC Symbol;Acc:HGNC:24086])

HSP 1 Score: 321.627 bits (823), Expect = 6.426e-101
Identity = 152/278 (54.68%), Postives = 200/278 (71.94%), Query Frame = 2
Query:  209 VIYESGQRR-CGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSK 1039
            ++ E+GQR+  GPP  W  + P +GCEIFI K+P+D FE +LIP+  +IG IY  R+MM+   ++RG+ F  ++    AK A+ +LNNY+I+    LGVC SVDNCRLFVGGIPK K + EI  EM+  TE +VD+IVYPSAADK KNRGFAFVEY +H+AAA+AR+K++   +QLWG  +AVDWAEPE +V+++ MS VKILYVRNLML+T+EE I + F+     P  + +VKKI D+AFVHF NR+ A      ++G  LDGS IEV  AKPV K
Sbjct:   31 LVQENGQRKYGGPPPGWDAAPPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYEIRNGRLLGVCASVDNCRLFVGGIPKTKKREEILSEMKKVTEGVVDVIVYPSAADKTKNRGFAFVEYESHRAAAMARRKLLPGRIQLWGHGIAVDWAEPEVEVDEDTMSSVKILYVRNLMLSTSEEMIEKEFNNI--KPGAVERVKKIRDYAFVHFSNREDAVEAMKALNGKVLDGSPIEVTLAKPVDK 306          
BLAST of APOBEC1 complementation factor vs. Ensembl Human
Match: A1CF (APOBEC1 complementation factor [Source:HGNC Symbol;Acc:HGNC:24086])

HSP 1 Score: 321.627 bits (823), Expect = 6.426e-101
Identity = 152/278 (54.68%), Postives = 200/278 (71.94%), Query Frame = 2
Query:  209 VIYESGQRR-CGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSK 1039
            ++ E+GQR+  GPP  W  + P +GCEIFI K+P+D FE +LIP+  +IG IY  R+MM+   ++RG+ F  ++    AK A+ +LNNY+I+    LGVC SVDNCRLFVGGIPK K + EI  EM+  TE +VD+IVYPSAADK KNRGFAFVEY +H+AAA+AR+K++   +QLWG  +AVDWAEPE +V+++ MS VKILYVRNLML+T+EE I + F+     P  + +VKKI D+AFVHF NR+ A      ++G  LDGS IEV  AKPV K
Sbjct:   31 LVQENGQRKYGGPPPGWDAAPPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYEIRNGRLLGVCASVDNCRLFVGGIPKTKKREEILSEMKKVTEGVVDVIVYPSAADKTKNRGFAFVEYESHRAAAMARRKLLPGRIQLWGHGIAVDWAEPEVEVDEDTMSSVKILYVRNLMLSTSEEMIEKEFNNI--KPGAVERVKKIRDYAFVHFSNREDAVEAMKALNGKVLDGSPIEVTLAKPVDK 306          
BLAST of APOBEC1 complementation factor vs. Ensembl Human
Match: A1CF (APOBEC1 complementation factor [Source:HGNC Symbol;Acc:HGNC:24086])

HSP 1 Score: 321.627 bits (823), Expect = 7.566e-101
Identity = 152/278 (54.68%), Postives = 200/278 (71.94%), Query Frame = 2
Query:  209 VIYESGQRR-CGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSK 1039
            ++ E+GQR+  GPP  W  + P +GCEIFI K+P+D FE +LIP+  +IG IY  R+MM+   ++RG+ F  ++    AK A+ +LNNY+I+    LGVC SVDNCRLFVGGIPK K + EI  EM+  TE +VD+IVYPSAADK KNRGFAFVEY +H+AAA+AR+K++   +QLWG  +AVDWAEPE +V+++ MS VKILYVRNLML+T+EE I + F+     P  + +VKKI D+AFVHF NR+ A      ++G  LDGS IEV  AKPV K
Sbjct:   31 LVQENGQRKYGGPPPGWDAAPPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYEIRNGRLLGVCASVDNCRLFVGGIPKTKKREEILSEMKKVTEGVVDVIVYPSAADKTKNRGFAFVEYESHRAAAMARRKLLPGRIQLWGHGIAVDWAEPEVEVDEDTMSSVKILYVRNLMLSTSEEMIEKEFNNI--KPGAVERVKKIRDYAFVHFSNREDAVEAMKALNGKVLDGSPIEVTLAKPVDK 306          
BLAST of APOBEC1 complementation factor vs. Ensembl Human
Match: A1CF (APOBEC1 complementation factor [Source:HGNC Symbol;Acc:HGNC:24086])

HSP 1 Score: 320.857 bits (821), Expect = 1.786e-100
Identity = 152/275 (55.27%), Postives = 198/275 (72.00%), Query Frame = 2
Query:  218 ESGQRR-CGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSK 1039
            E+GQR+  GPP  W  + P +GCEIFI K+P+D FE +LIP+  +IG IY  R+MM+   ++RG+ F  ++    AK A+ +LNNY+I+    LGVC SVDNCRLFVGGIPK K + EI  EM+  TE +VD+IVYPSAADK KNRGFAFVEY +H+AAA+AR+K++   +QLWG  +AVDWAEPE +V+++ MS VKILYVRNLML+T+EE I + F+     P  + +VKKI D+AFVHF NR+ A      ++G  LDGS IEV  AKPV K
Sbjct:   42 ENGQRKYGGPPPGWDAAPPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYEIRNGRLLGVCASVDNCRLFVGGIPKTKKREEILSEMKKVTEGVVDVIVYPSAADKTKNRGFAFVEYESHRAAAMARRKLLPGRIQLWGHGIAVDWAEPEVEVDEDTMSSVKILYVRNLMLSTSEEMIEKEFNNI--KPGAVERVKKIRDYAFVHFSNREDAVEAMKALNGKVLDGSPIEVTLAKPVDK 314          
BLAST of APOBEC1 complementation factor vs. Ensembl Celegans
Match: hrp-2 (HnRNP A1 homolog [Source:UniProtKB/TrEMBL;Acc:B3KYC2])

HSP 1 Score: 196.438 bits (498), Expect = 2.917e-54
Identity = 108/295 (36.61%), Postives = 167/295 (56.61%), Query Frame = 2
Query:  167 PNPLSVIGITETTPVIYES--GQRR-CGPPENWKDSS---PGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMME-TEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQK--NRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFA 1024
            P   ++  + ETT    E   GQR+  GPP +W+  +    G+G EI++  IP D FE  L+P+  + G I+  RLMM+    + RG+ F  Y   E A  A    + ++I     L V  S+ N RLF+G IPK K+K EI EE++   E +VD+IVY S  D +K  NRGF FV++ +HK A+  ++K+    ++ +   V VDWAE + + +++ MSKVK+LY+RN+    TEE +  +F +Y      + +VKK+ D+AF+HF  RD       + +G  L+G+ +E   A
Sbjct:  156 PELAALKNLLETTGYTIEVTIGQRKFGGPPPDWEGPATGPAGQGHEIYVGHIPTDVFEDTLVPLFEKSGKIWDLRLMMDPMSGASRGYAFVTYCNKEDAAAAAKTYDGHEISTGKPLKVNVSIANTRLFIGNIPKTKSKDEILEELKTHAEGVVDVIVY-SVPDNEKIKNRGFCFVDFIDHKTASDIKRKIAQHKIRPFNADVYVDWAEHQEEPDEDTMSKVKVLYIRNIKEAVTEEKLNELFKEYA----SLDRVKKVKDYAFIHFNERDDCLKAMEEWNGKELEGTVVEASLA 445          
BLAST of APOBEC1 complementation factor vs. Ensembl Celegans
Match: hrp-2 (HnRNP A1 homolog [Source:UniProtKB/TrEMBL;Acc:B3KYC2])

HSP 1 Score: 196.438 bits (498), Expect = 2.917e-54
Identity = 108/295 (36.61%), Postives = 167/295 (56.61%), Query Frame = 2
Query:  167 PNPLSVIGITETTPVIYES--GQRR-CGPPENWKDSS---PGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMME-TEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQK--NRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFA 1024
            P   ++  + ETT    E   GQR+  GPP +W+  +    G+G EI++  IP D FE  L+P+  + G I+  RLMM+    + RG+ F  Y   E A  A    + ++I     L V  S+ N RLF+G IPK K+K EI EE++   E +VD+IVY S  D +K  NRGF FV++ +HK A+  ++K+    ++ +   V VDWAE + + +++ MSKVK+LY+RN+    TEE +  +F +Y      + +VKK+ D+AF+HF  RD       + +G  L+G+ +E   A
Sbjct:  156 PELAALKNLLETTGYTIEVTIGQRKFGGPPPDWEGPATGPAGQGHEIYVGHIPTDVFEDTLVPLFEKSGKIWDLRLMMDPMSGASRGYAFVTYCNKEDAAAAAKTYDGHEISTGKPLKVNVSIANTRLFIGNIPKTKSKDEILEELKTHAEGVVDVIVY-SVPDNEKIKNRGFCFVDFIDHKTASDIKRKIAQHKIRPFNADVYVDWAEHQEEPDEDTMSKVKVLYIRNIKEAVTEEKLNELFKEYA----SLDRVKKVKDYAFIHFNERDDCLKAMEEWNGKELEGTVVEASLA 445          
BLAST of APOBEC1 complementation factor vs. Ensembl Celegans
Match: ZK616.1 (pep chromosome:WBcel235:IV:5402948:5405537:1 gene:WBGene00022771.1 transcript:ZK616.1.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK616.1)

HSP 1 Score: 56.6102 bits (135), Expect = 1.386e-8
Identity = 50/200 (25.00%), Postives = 92/200 (46.00%), Query Frame = 2
Query:  509 SVDN-C-RLFVGGIPKLKTKLEIQEEMRHFTENI-------VDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSKIEQQQKLLKKSTAT 1081
            S DN C RL+VGG     T L   E++R+    +       +DI+        +K+RGFAFV+  +   A +   K         G    V++A+ E K  + +MS +  ++VR +     +  +Y+ F   T+    +++      + FV F  R  A+    +M G  L+G  I V +A+P +   ++++ + + + T
Sbjct:    3 SADNFCDRLYVGG---FSTNLS-SEQIRNLITQLAAPFEVSIDIV----ENGSRKHRGFAFVQCRSLAEANVLLAK-------FSGLFTKVNFAKKEPKPAENVMSNISNVFVRGISRDMPDTELYQAFGGITDG---VVQCHVADGYGFVLFDTRANAQKKIVEMDGKTLNGKLISVSWARPDTVGRKRKRPMSEESPT 184          
BLAST of APOBEC1 complementation factor vs. Ensembl Celegans
Match: ZK616.1 (pep chromosome:WBcel235:IV:5402938:5405537:1 gene:WBGene00022771.1 transcript:ZK616.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK616.1)

HSP 1 Score: 56.6102 bits (135), Expect = 1.386e-8
Identity = 50/200 (25.00%), Postives = 92/200 (46.00%), Query Frame = 2
Query:  509 SVDN-C-RLFVGGIPKLKTKLEIQEEMRHFTENI-------VDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSKIEQQQKLLKKSTAT 1081
            S DN C RL+VGG     T L   E++R+    +       +DI+        +K+RGFAFV+  +   A +   K         G    V++A+ E K  + +MS +  ++VR +     +  +Y+ F   T+    +++      + FV F  R  A+    +M G  L+G  I V +A+P +   ++++ + + + T
Sbjct:    3 SADNFCDRLYVGG---FSTNLS-SEQIRNLITQLAAPFEVSIDIV----ENGSRKHRGFAFVQCRSLAEANVLLAK-------FSGLFTKVNFAKKEPKPAENVMSNISNVFVRGISRDMPDTELYQAFGGITDG---VVQCHVADGYGFVLFDTRANAQKKIVEMDGKTLNGKLISVSWARPDTVGRKRKRPMSEESPT 184          
BLAST of APOBEC1 complementation factor vs. Ensembl Celegans
Match: exc-7 (pep chromosome:WBcel235:II:9575971:9581490:1 gene:WBGene00001368.1 transcript:F35H8.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:exc-7)

HSP 1 Score: 51.2174 bits (121), Expect = 1.746e-6
Identity = 49/179 (27.37%), Postives = 78/179 (43.58%), Query Frame = 2
Query:  200 TTPV--IYESGQRRCGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHR-GFGFCLYTKHETAKLAV-----LKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKM 712
            T+PV   Y S QR C  P    D    K   + I  +P+   ++++  +   IG+I + +L+ +       G+GF  Y + E A  AV     L+L N  IK ++       +    L+V GIPK  T  E++   R F + I   I+  +     K  G  FV +     A +A K +
Sbjct:   16 TSPVQTTYTSTQRYCSAPN--VDIGESK-TNLIINYLPQGMTQEEVRSLFTSIGEIESCKLVRDKVTGQSLGYGFVNYVREEDALRAVSSFNGLRLQNKTIKVSYARPSNDQIKGSNLYVSGIPKSMTLHELESIFRPFGQIITSRILSDNVTGLSK--GVGFVRFDKKDEADVAIKTL 189          
BLAST of APOBEC1 complementation factor vs. Ensembl Fly
Match: Syp (gene:FBgn0038826 transcript:FBtr0083961)

HSP 1 Score: 250.751 bits (639), Expect = 6.328e-75
Identity = 122/294 (41.50%), Postives = 189/294 (64.29%), Query Frame = 2
Query:  221 SGQRR-CGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMET-EFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSKIEQQQKLLKKSTATLTQSL 1096
            +GQR+  GPP +W+ + PG GCE+F  KIPKD +E +LIP+    G I+  RLMM+    ++RG+ F  +T  E A  AV +L+N++IK    L +  SV N RLFVG IPK K K EI EE    T  + ++I+Y S  DK+KNRGF F+EY +HKAA++A++++ +  +++WG  + VDWA+P+ + +++ MSKVK+LYVRNL    +E+ +   F QY     ++ +VKKI D+AF+HF++RD A      ++G  +  S IEV  AKP S  ++++++L+     + Q +
Sbjct:  143 TGQRKYGGPPPHWEGNVPGNGCEVFCGKIPKDMYEDELIPLFENCGIIWDLRLMMDPMTGTNRGYAFVTFTNREAAVNAVRQLDNHEIKPGKCLKINISVPNLRLFVGNIPKSKGKDEILEEFGKLTAGLYEVIIYSSPDDKKKNRGFCFLEYESHKAASLAKRRLGTGRIKVWGCDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVSEDKLKEQFEQYG----KVERVKKIKDYAFIHFEDRDSAVEAMRGLNGKEIGASNIEVSLAKPPSDKKKKEEILRARERRMMQMM 432          
BLAST of APOBEC1 complementation factor vs. Ensembl Fly
Match: Syp (gene:FBgn0038826 transcript:FBtr0113256)

HSP 1 Score: 250.751 bits (639), Expect = 7.856e-75
Identity = 122/294 (41.50%), Postives = 189/294 (64.29%), Query Frame = 2
Query:  221 SGQRR-CGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMET-EFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSKIEQQQKLLKKSTATLTQSL 1096
            +GQR+  GPP +W+ + PG GCE+F  KIPKD +E +LIP+    G I+  RLMM+    ++RG+ F  +T  E A  AV +L+N++IK    L +  SV N RLFVG IPK K K EI EE    T  + ++I+Y S  DK+KNRGF F+EY +HKAA++A++++ +  +++WG  + VDWA+P+ + +++ MSKVK+LYVRNL    +E+ +   F QY     ++ +VKKI D+AF+HF++RD A      ++G  +  S IEV  AKP S  ++++++L+     + Q +
Sbjct:  148 TGQRKYGGPPPHWEGNVPGNGCEVFCGKIPKDMYEDELIPLFENCGIIWDLRLMMDPMTGTNRGYAFVTFTNREAAVNAVRQLDNHEIKPGKCLKINISVPNLRLFVGNIPKSKGKDEILEEFGKLTAGLYEVIIYSSPDDKKKNRGFCFLEYESHKAASLAKRRLGTGRIKVWGCDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVSEDKLKEQFEQYG----KVERVKKIKDYAFIHFEDRDSAVEAMRGLNGKEIGASNIEVSLAKPPSDKKKKEEILRARERRMMQMM 437          
BLAST of APOBEC1 complementation factor vs. Ensembl Fly
Match: Syp (gene:FBgn0038826 transcript:FBtr0083963)

HSP 1 Score: 251.136 bits (640), Expect = 1.163e-74
Identity = 122/294 (41.50%), Postives = 189/294 (64.29%), Query Frame = 2
Query:  221 SGQRR-CGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMET-EFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSKIEQQQKLLKKSTATLTQSL 1096
            +GQR+  GPP +W+ + PG GCE+F  KIPKD +E +LIP+    G I+  RLMM+    ++RG+ F  +T  E A  AV +L+N++IK    L +  SV N RLFVG IPK K K EI EE    T  + ++I+Y S  DK+KNRGF F+EY +HKAA++A++++ +  +++WG  + VDWA+P+ + +++ MSKVK+LYVRNL    +E+ +   F QY     ++ +VKKI D+AF+HF++RD A      ++G  +  S IEV  AKP S  ++++++L+     + Q +
Sbjct:  185 TGQRKYGGPPPHWEGNVPGNGCEVFCGKIPKDMYEDELIPLFENCGIIWDLRLMMDPMTGTNRGYAFVTFTNREAAVNAVRQLDNHEIKPGKCLKINISVPNLRLFVGNIPKSKGKDEILEEFGKLTAGLYEVIIYSSPDDKKKNRGFCFLEYESHKAASLAKRRLGTGRIKVWGCDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVSEDKLKEQFEQYG----KVERVKKIKDYAFIHFEDRDSAVEAMRGLNGKEIGASNIEVSLAKPPSDKKKKEEILRARERRMMQMM 474          
BLAST of APOBEC1 complementation factor vs. Ensembl Fly
Match: Syp (gene:FBgn0038826 transcript:FBtr0083958)

HSP 1 Score: 251.136 bits (640), Expect = 1.188e-74
Identity = 122/294 (41.50%), Postives = 189/294 (64.29%), Query Frame = 2
Query:  221 SGQRR-CGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMET-EFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSKIEQQQKLLKKSTATLTQSL 1096
            +GQR+  GPP +W+ + PG GCE+F  KIPKD +E +LIP+    G I+  RLMM+    ++RG+ F  +T  E A  AV +L+N++IK    L +  SV N RLFVG IPK K K EI EE    T  + ++I+Y S  DK+KNRGF F+EY +HKAA++A++++ +  +++WG  + VDWA+P+ + +++ MSKVK+LYVRNL    +E+ +   F QY     ++ +VKKI D+AF+HF++RD A      ++G  +  S IEV  AKP S  ++++++L+     + Q +
Sbjct:  177 TGQRKYGGPPPHWEGNVPGNGCEVFCGKIPKDMYEDELIPLFENCGIIWDLRLMMDPMTGTNRGYAFVTFTNREAAVNAVRQLDNHEIKPGKCLKINISVPNLRLFVGNIPKSKGKDEILEEFGKLTAGLYEVIIYSSPDDKKKNRGFCFLEYESHKAASLAKRRLGTGRIKVWGCDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVSEDKLKEQFEQYG----KVERVKKIKDYAFIHFEDRDSAVEAMRGLNGKEIGASNIEVSLAKPPSDKKKKEEILRARERRMMQMM 466          
BLAST of APOBEC1 complementation factor vs. Ensembl Fly
Match: Syp (gene:FBgn0038826 transcript:FBtr0334720)

HSP 1 Score: 250.751 bits (639), Expect = 1.847e-74
Identity = 128/319 (40.13%), Postives = 198/319 (62.07%), Query Frame = 2
Query:  221 SGQRR-CGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMET-EFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSKIEQQQKLLKKSTATLTQSLPL-------LMPTDLNRLSLSSNGP 1150
            +GQR+  GPP +W+ + PG GCE+F  KIPKD +E +LIP+    G I+  RLMM+    ++RG+ F  +T  E A  AV +L+N++IK    L +  SV N RLFVG IPK K K EI EE    T  + ++I+Y S  DK+KNRGF F+EY +HKAA++A++++ +  +++WG  + VDWA+P+ + +++ MSKVK+LYVRNL    +E+ +   F QY     ++ +VKKI D+AF+HF++RD A      ++G  +  S IEV  AKP S  ++++++L+     + Q +         L PT  + +SL+   P
Sbjct:  143 TGQRKYGGPPPHWEGNVPGNGCEVFCGKIPKDMYEDELIPLFENCGIIWDLRLMMDPMTGTNRGYAFVTFTNREAAVNAVRQLDNHEIKPGKCLKINISVPNLRLFVGNIPKSKGKDEILEEFGKLTAGLYEVIIYSSPDDKKKNRGFCFLEYESHKAASLAKRRLGTGRIKVWGCDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVSEDKLKEQFEQYG----KVERVKKIKDYAFIHFEDRDSAVEAMRGLNGKEIGASNIEVSLAKPPSDKKKKEEILRARERRMMQMMQARPGIVGNLSPTHPSIMSLTPMRP 457          
BLAST of APOBEC1 complementation factor vs. Ensembl Zebrafish
Match: rbm47 (RNA binding motif protein 47 [Source:ZFIN;Acc:ZDB-GENE-030131-9612])

HSP 1 Score: 334.339 bits (856), Expect = 8.858e-106
Identity = 154/307 (50.16%), Postives = 218/307 (71.01%), Query Frame = 2
Query:  167 PNPLSVIGITETTP--VIYESGQRRCGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSKIEQQQKLLKKSTAT 1081
            PN  +++ + E +   ++ E+GQR+ GPP  W+ +SP +GCEIF+ KIP+D +E +L+P+   +G IY  RLMM+ +  +RG+ F +YT+   AK AV +LNN++I+    LGVC SVDNCRLF+GGIPK K + EI EE+   TE ++D+IVY SAADK KNRGFAFVEY +H+AAA+AR+K++   +QLWG  +AVDWAEPE  V++++M  VKILYVRNLM+ T+EE + + F Q+  +P  + +VKKI D+AFVHF +RD A +  + ++G  ++GS IEV  AKPV K EQ  +  K S  T
Sbjct:   42 PNEAALVSLMERSGYGMVQENGQRKYGPPPGWQGTSPPRGCEIFVGKIPRDVYEDELVPVFESVGRIYEMRLMMDFDGKNRGYAFVMYTQKHEAKRAVRELNNFEIRPGRLLGVCSSVDNCRLFIGGIPKTKKREEILEEVSKVTEGVLDVIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETSEEILRQTFGQF--NPGCVERVKKIRDYAFVHFASRDDAVVAMDNLNGTEIEGSRIEVTLAKPVDK-EQYTRYQKASKGT 345          
BLAST of APOBEC1 complementation factor vs. Ensembl Zebrafish
Match: a1cf (apobec1 complementation factor [Source:ZFIN;Acc:ZDB-GENE-060824-3])

HSP 1 Score: 314.309 bits (804), Expect = 2.806e-98
Identity = 148/275 (53.82%), Postives = 197/275 (71.64%), Query Frame = 2
Query:  218 ESGQRR-CGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSK 1039
            E+GQRR  GPP  W+ S P +G EIF+ K+P+D FE +L+P+  + G IY  R+MM+   ++RG+ F  ++  + AK A+ +LNNY+I+    LGVC SVDNCRLFVGGIPK K + EI  EM+  T+ ++D+IVYPSAADK KNRGFAFVEY  H+AAA+AR+K++   +QLWG  +AVDWAEPE +V+++ M+ VKILYVRNLML TTEETI + F+     P  + +VKKI D+AFVHF  R+ A    N ++G  +DGS IEV  AKPV K
Sbjct:   34 ENGQRRYGGPPPGWEGSPPERGSEIFVGKLPRDLFEDELVPLCEKFGKIYEVRMMMDFNGNNRGYAFVTFSTKQEAKNAMKQLNNYEIRNGRLLGVCASVDNCRLFVGGIPKTKKREEILAEMKKVTDGVLDVIVYPSAADKAKNRGFAFVEYETHRAAAMARRKLLPGRIQLWGHPIAVDWAEPEVEVDEDTMATVKILYVRNLMLPTTEETIEKEFNSI--KPGAVERVKKIRDYAFVHFSQREDAINAMNALNGKVIDGSPIEVTLAKPVDK 306          
BLAST of APOBEC1 complementation factor vs. Ensembl Zebrafish
Match: a1cf (apobec1 complementation factor [Source:ZFIN;Acc:ZDB-GENE-060824-3])

HSP 1 Score: 314.309 bits (804), Expect = 2.806e-98
Identity = 148/275 (53.82%), Postives = 197/275 (71.64%), Query Frame = 2
Query:  218 ESGQRR-CGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSK 1039
            E+GQRR  GPP  W+ S P +G EIF+ K+P+D FE +L+P+  + G IY  R+MM+   ++RG+ F  ++  + AK A+ +LNNY+I+    LGVC SVDNCRLFVGGIPK K + EI  EM+  T+ ++D+IVYPSAADK KNRGFAFVEY  H+AAA+AR+K++   +QLWG  +AVDWAEPE +V+++ M+ VKILYVRNLML TTEETI + F+     P  + +VKKI D+AFVHF  R+ A    N ++G  +DGS IEV  AKPV K
Sbjct:   34 ENGQRRYGGPPPGWEGSPPERGSEIFVGKLPRDLFEDELVPLCEKFGKIYEVRMMMDFNGNNRGYAFVTFSTKQEAKNAMKQLNNYEIRNGRLLGVCASVDNCRLFVGGIPKTKKREEILAEMKKVTDGVLDVIVYPSAADKAKNRGFAFVEYETHRAAAMARRKLLPGRIQLWGHPIAVDWAEPEVEVDEDTMATVKILYVRNLMLPTTEETIEKEFNSI--KPGAVERVKKIRDYAFVHFSQREDAINAMNALNGKVIDGSPIEVTLAKPVDK 306          
BLAST of APOBEC1 complementation factor vs. Ensembl Zebrafish
Match: rbm46 (RNA binding motif protein 46 [Source:NCBI gene;Acc:566042])

HSP 1 Score: 306.22 bits (783), Expect = 4.732e-96
Identity = 138/253 (54.55%), Postives = 186/253 (73.52%), Query Frame = 2
Query:  281 CEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSK 1039
            CE+F+ KIP+D +E +L+P+  + G IY FRLMME    +RG+ F +YT  E A+ A+  L+NY+I+   ++GVC S+DNCRLF+G IPK K K EIQEEM   TE ++D+IVYPSA D+ KNRGFAFVEY +HKAAA+AR+K+I  + QLWG T+ VDWAEPE+++++E M +V++LYVRNLML+TTEET+   FSQ    P  + +VKK+ D+AF+HF NR+ A      M+G  +DGS IEV  AKP SK
Sbjct:   45 CEVFVGKIPRDMYEDELVPVFEQAGHIYEFRLMMEFSGENRGYAFVMYTTREKAQRAIQLLDNYEIRPGKFIGVCVSLDNCRLFIGSIPKDKKKEEIQEEMMKVTEGVMDVIVYPSAVDRMKNRGFAFVEYESHKAAAMARRKLIPGTFQLWGHTIQVDWAEPEKELDEETMQRVRVLYVRNLMLSTTEETLRSEFSQLK--PGSVERVKKLTDYAFIHFYNREDALTALESMNGKVIDGSPIEVTLAKPASK 295          
BLAST of APOBEC1 complementation factor vs. Ensembl Zebrafish
Match: rbm46 (RNA binding motif protein 46 [Source:NCBI gene;Acc:566042])

HSP 1 Score: 306.605 bits (784), Expect = 4.809e-96
Identity = 138/253 (54.55%), Postives = 186/253 (73.52%), Query Frame = 2
Query:  281 CEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSK 1039
            CE+F+ KIP+D +E +L+P+  + G IY FRLMME    +RG+ F +YT  E A+ A+  L+NY+I+   ++GVC S+DNCRLF+G IPK K K EIQEEM   TE ++D+IVYPSA D+ KNRGFAFVEY +HKAAA+AR+K+I  + QLWG T+ VDWAEPE+++++E M +V++LYVRNLML+TTEET+   FSQ    P  + +VKK+ D+AF+HF NR+ A      M+G  +DGS IEV  AKP SK
Sbjct:   58 CEVFVGKIPRDMYEDELVPVFEQAGHIYEFRLMMEFSGENRGYAFVMYTTREKAQRAIQLLDNYEIRPGKFIGVCVSLDNCRLFIGSIPKDKKKEEIQEEMMKVTEGVMDVIVYPSAVDRMKNRGFAFVEYESHKAAAMARRKLIPGTFQLWGHTIQVDWAEPEKELDEETMQRVRVLYVRNLMLSTTEETLRSEFSQLK--PGSVERVKKLTDYAFIHFYNREDALTALESMNGKVIDGSPIEVTLAKPASK 308          
BLAST of APOBEC1 complementation factor vs. Ensembl Xenopus
Match: tom1 (target of myb1 membrane trafficking protein [Source:Xenbase;Acc:XB-GENE-5834946])

HSP 1 Score: 326.25 bits (835), Expect = 2.298e-104
Identity = 158/316 (50.00%), Postives = 223/316 (70.57%), Query Frame = 2
Query:  167 PNPLSVIGITETT--PVIYESGQRR-CGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSKIE--QQQKLLK---KSTATLTQ 1090
            PN  ++I + E T   ++ E+GQR+  GPP  W+ S P +GCE+F+ KIP+D +E +L+P+    G I+  RLMM+ +  +RG+ F ++TK   AK AV +LNNY+I+    LGVC SVDNCRLF+GGIPK+K + EI EE+   TE ++D+IVY SAADK KNRGFAFVEY +H+AAA+AR+K++   +QLWG  +AVDWAEPE  V++++M  VKILYVRNLM+ T+E+TI ++F Q+  +P  + +VKKI D+AFVHF +R+ A     +++G  L+GS IEV  AKPV K +  + QK  K    +TAT T+
Sbjct:   30 PNEAALINLMERTGYTMVQENGQRKYGGPPPGWEGSPPPRGCEVFVGKIPRDVYEDELVPVFESAGRIFEMRLMMDFDGKNRGYAFVMFTKKHEAKQAVRELNNYEIRPGRLLGVCCSVDNCRLFIGGIPKMKKREEILEEISKVTEGVLDVIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETSEDTIKKIFGQF--NPGCVERVKKIRDYAFVHFSSREDAVQSMRKLNGTELEGSCIEVTLAKPVDKEQYTRYQKAAKGGAPATATATE 343          
BLAST of APOBEC1 complementation factor vs. Ensembl Xenopus
Match: tom1 (target of myb1 membrane trafficking protein [Source:Xenbase;Acc:XB-GENE-5834946])

HSP 1 Score: 326.25 bits (835), Expect = 1.875e-103
Identity = 158/316 (50.00%), Postives = 223/316 (70.57%), Query Frame = 2
Query:  167 PNPLSVIGITETT--PVIYESGQRR-CGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSKIE--QQQKLLK---KSTATLTQ 1090
            PN  ++I + E T   ++ E+GQR+  GPP  W+ S P +GCE+F+ KIP+D +E +L+P+    G I+  RLMM+ +  +RG+ F ++TK   AK AV +LNNY+I+    LGVC SVDNCRLF+GGIPK+K + EI EE+   TE ++D+IVY SAADK KNRGFAFVEY +H+AAA+AR+K++   +QLWG  +AVDWAEPE  V++++M  VKILYVRNLM+ T+E+TI ++F Q+  +P  + +VKKI D+AFVHF +R+ A     +++G  L+GS IEV  AKPV K +  + QK  K    +TAT T+
Sbjct:   30 PNEAALINLMERTGYTMVQENGQRKYGGPPPGWEGSPPPRGCEVFVGKIPRDVYEDELVPVFESAGRIFEMRLMMDFDGKNRGYAFVMFTKKHEAKQAVRELNNYEIRPGRLLGVCCSVDNCRLFIGGIPKMKKREEILEEISKVTEGVLDVIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETSEDTIKKIFGQF--NPGCVERVKKIRDYAFVHFSSREDAVQSMRKLNGTELEGSCIEVTLAKPVDKEQYTRYQKAAKGGAPATATATE 343          
BLAST of APOBEC1 complementation factor vs. Ensembl Xenopus
Match: tom1 (target of myb1 membrane trafficking protein [Source:Xenbase;Acc:XB-GENE-5834946])

HSP 1 Score: 327.02 bits (837), Expect = 2.130e-103
Identity = 158/316 (50.00%), Postives = 223/316 (70.57%), Query Frame = 2
Query:  167 PNPLSVIGITETT--PVIYESGQRR-CGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSKIE--QQQKLLK---KSTATLTQ 1090
            PN  ++I + E T   ++ E+GQR+  GPP  W+ S P +GCE+F+ KIP+D +E +L+P+    G I+  RLMM+ +  +RG+ F ++TK   AK AV +LNNY+I+    LGVC SVDNCRLF+GGIPK+K + EI EE+   TE ++D+IVY SAADK KNRGFAFVEY +H+AAA+AR+K++   +QLWG  +AVDWAEPE  V++++M  VKILYVRNLM+ T+E+TI ++F Q+  +P  + +VKKI D+AFVHF +R+ A     +++G  L+GS IEV  AKPV K +  + QK  K    +TAT T+
Sbjct:   30 PNEAALINLMERTGYTMVQENGQRKYGGPPPGWEGSPPPRGCEVFVGKIPRDVYEDELVPVFESAGRIFEMRLMMDFDGKNRGYAFVMFTKKHEAKQAVRELNNYEIRPGRLLGVCCSVDNCRLFIGGIPKMKKREEILEEISKVTEGVLDVIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETSEDTIKKIFGQF--NPGCVERVKKIRDYAFVHFSSREDAVQSMRKLNGTELEGSCIEVTLAKPVDKEQYTRYQKAAKGGAPATATATE 343          
BLAST of APOBEC1 complementation factor vs. Ensembl Xenopus
Match: tom1 (target of myb1 membrane trafficking protein [Source:Xenbase;Acc:XB-GENE-5834946])

HSP 1 Score: 327.405 bits (838), Expect = 4.633e-103
Identity = 158/316 (50.00%), Postives = 223/316 (70.57%), Query Frame = 2
Query:  167 PNPLSVIGITETT--PVIYESGQRR-CGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSKIE--QQQKLLK---KSTATLTQ 1090
            PN  ++I + E T   ++ E+GQR+  GPP  W+ S P +GCE+F+ KIP+D +E +L+P+    G I+  RLMM+ +  +RG+ F ++TK   AK AV +LNNY+I+    LGVC SVDNCRLF+GGIPK+K + EI EE+   TE ++D+IVY SAADK KNRGFAFVEY +H+AAA+AR+K++   +QLWG  +AVDWAEPE  V++++M  VKILYVRNLM+ T+E+TI ++F Q+  +P  + +VKKI D+AFVHF +R+ A     +++G  L+GS IEV  AKPV K +  + QK  K    +TAT T+
Sbjct:   30 PNEAALINLMERTGYTMVQENGQRKYGGPPPGWEGSPPPRGCEVFVGKIPRDVYEDELVPVFESAGRIFEMRLMMDFDGKNRGYAFVMFTKKHEAKQAVRELNNYEIRPGRLLGVCCSVDNCRLFIGGIPKMKKREEILEEISKVTEGVLDVIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETSEDTIKKIFGQF--NPGCVERVKKIRDYAFVHFSSREDAVQSMRKLNGTELEGSCIEVTLAKPVDKEQYTRYQKAAKGGAPATATATE 343          
BLAST of APOBEC1 complementation factor vs. Ensembl Xenopus
Match: tom1 (target of myb1 membrane trafficking protein [Source:Xenbase;Acc:XB-GENE-5834946])

HSP 1 Score: 327.405 bits (838), Expect = 4.761e-103
Identity = 158/316 (50.00%), Postives = 223/316 (70.57%), Query Frame = 2
Query:  167 PNPLSVIGITETT--PVIYESGQRR-CGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSKIE--QQQKLLK---KSTATLTQ 1090
            PN  ++I + E T   ++ E+GQR+  GPP  W+ S P +GCE+F+ KIP+D +E +L+P+    G I+  RLMM+ +  +RG+ F ++TK   AK AV +LNNY+I+    LGVC SVDNCRLF+GGIPK+K + EI EE+   TE ++D+IVY SAADK KNRGFAFVEY +H+AAA+AR+K++   +QLWG  +AVDWAEPE  V++++M  VKILYVRNLM+ T+E+TI ++F Q+  +P  + +VKKI D+AFVHF +R+ A     +++G  L+GS IEV  AKPV K +  + QK  K    +TAT T+
Sbjct:   30 PNEAALINLMERTGYTMVQENGQRKYGGPPPGWEGSPPPRGCEVFVGKIPRDVYEDELVPVFESAGRIFEMRLMMDFDGKNRGYAFVMFTKKHEAKQAVRELNNYEIRPGRLLGVCCSVDNCRLFIGGIPKMKKREEILEEISKVTEGVLDVIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETSEDTIKKIFGQF--NPGCVERVKKIRDYAFVHFSSREDAVQSMRKLNGTELEGSCIEVTLAKPVDKEQYTRYQKAAKGGAPATATATE 343          
BLAST of APOBEC1 complementation factor vs. Ensembl Mouse
Match: A1cf (APOBEC1 complementation factor [Source:MGI Symbol;Acc:MGI:1917115])

HSP 1 Score: 308.145 bits (788), Expect = 2.100e-98
Identity = 152/278 (54.68%), Postives = 201/278 (72.30%), Query Frame = 2
Query:  209 VIYESGQRR-CGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSK 1039
            ++ E+GQR+  GPP  W  + P +GCEIFI K+P+D FE +LIP+  +IG IY  RLMM+   ++RG+ F  ++  + AK A+ +LNNY+I+    LGVC SVDNCRLFVGGIPK K + EI  EM+  TE +VD+IVYPSAADK KNRGFAFVEY +H+AAA+AR++++   +QLWG  +AVDWAEPE +V+++ MS VKILYVRNLML+T+EE I + F+     P  + +VKKI D+AFVHF NR+ A      ++G  LDGS IEV  AKPV K
Sbjct:   31 LVQENGQRKYGGPPPGWDSTPPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRLMMDFNGNNRGYAFVTFSNKQEAKNAIKQLNNYEIRTGRLLGVCASVDNCRLFVGGIPKTKKREEILSEMKKVTEGVVDVIVYPSAADKTKNRGFAFVEYESHRAAAMARRRLLPGRIQLWGHPIAVDWAEPEVEVDEDTMSSVKILYVRNLMLSTSEEMIEKEFNSI--KPGAVERVKKIRDYAFVHFSNREDAVEAMKALNGKVLDGSPIEVTLAKPVDK 306          
BLAST of APOBEC1 complementation factor vs. Ensembl Mouse
Match: A1cf (APOBEC1 complementation factor [Source:MGI Symbol;Acc:MGI:1917115])

HSP 1 Score: 308.916 bits (790), Expect = 3.683e-96
Identity = 152/278 (54.68%), Postives = 201/278 (72.30%), Query Frame = 2
Query:  209 VIYESGQRR-CGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSK 1039
            ++ E+GQR+  GPP  W  + P +GCEIFI K+P+D FE +LIP+  +IG IY  RLMM+   ++RG+ F  ++  + AK A+ +LNNY+I+    LGVC SVDNCRLFVGGIPK K + EI  EM+  TE +VD+IVYPSAADK KNRGFAFVEY +H+AAA+AR++++   +QLWG  +AVDWAEPE +V+++ MS VKILYVRNLML+T+EE I + F+     P  + +VKKI D+AFVHF NR+ A      ++G  LDGS IEV  AKPV K
Sbjct:   31 LVQENGQRKYGGPPPGWDSTPPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRLMMDFNGNNRGYAFVTFSNKQEAKNAIKQLNNYEIRTGRLLGVCASVDNCRLFVGGIPKTKKREEILSEMKKVTEGVVDVIVYPSAADKTKNRGFAFVEYESHRAAAMARRRLLPGRIQLWGHPIAVDWAEPEVEVDEDTMSSVKILYVRNLMLSTSEEMIEKEFNSI--KPGAVERVKKIRDYAFVHFSNREDAVEAMKALNGKVLDGSPIEVTLAKPVDK 306          
BLAST of APOBEC1 complementation factor vs. Ensembl Mouse
Match: Rbm46 (RNA binding motif protein 46 [Source:MGI Symbol;Acc:MGI:3645057])

HSP 1 Score: 304.294 bits (778), Expect = 6.837e-96
Identity = 138/253 (54.55%), Postives = 190/253 (75.10%), Query Frame = 2
Query:  281 CEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSK 1039
            CE+F+ KIP+D +E +L+P+    G IY FRLMME    +RG+ F +YT  E A+LA+  LNNY+I+   ++GVC S+DNCRLF+G IPK K K EI +EM+  TE +VD+IVYPSA DK KNRGFAFVEY +H+AAA+AR+K+I  + QLWG T+ VDWA+PE++V++E M +VK+LYVRNLM++TTEETI   FS++   P  + +VKK+ D+AFVHF +R+ A    + M+G  +DG++IEV  AKPV+K
Sbjct:   61 CEVFVGKIPRDMYEDELVPVFERAGKIYEFRLMMEFSGENRGYAFVMYTTKEEAQLAIRILNNYEIRPGKFIGVCVSLDNCRLFIGAIPKEKKKEEILDEMKKVTEGVVDVIVYPSATDKTKNRGFAFVEYESHRAAAMARRKLIPGTFQLWGHTIQVDWADPEKEVDEETMQRVKVLYVRNLMISTTEETIKAEFSKF--KPGAVERVKKLRDYAFVHFFHREDAVAAMSVMNGKCIDGASIEVTLAKPVNK 311          
BLAST of APOBEC1 complementation factor vs. Ensembl Mouse
Match: A1cf (APOBEC1 complementation factor [Source:MGI Symbol;Acc:MGI:1917115])

HSP 1 Score: 308.531 bits (789), Expect = 7.166e-96
Identity = 152/278 (54.68%), Postives = 201/278 (72.30%), Query Frame = 2
Query:  209 VIYESGQRR-CGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSK 1039
            ++ E+GQR+  GPP  W  + P +GCEIFI K+P+D FE +LIP+  +IG IY  RLMM+   ++RG+ F  ++  + AK A+ +LNNY+I+    LGVC SVDNCRLFVGGIPK K + EI  EM+  TE +VD+IVYPSAADK KNRGFAFVEY +H+AAA+AR++++   +QLWG  +AVDWAEPE +V+++ MS VKILYVRNLML+T+EE I + F+     P  + +VKKI D+AFVHF NR+ A      ++G  LDGS IEV  AKPV K
Sbjct:   31 LVQENGQRKYGGPPPGWDSTPPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRLMMDFNGNNRGYAFVTFSNKQEAKNAIKQLNNYEIRTGRLLGVCASVDNCRLFVGGIPKTKKREEILSEMKKVTEGVVDVIVYPSAADKTKNRGFAFVEYESHRAAAMARRRLLPGRIQLWGHPIAVDWAEPEVEVDEDTMSSVKILYVRNLMLSTSEEMIEKEFNSI--KPGAVERVKKIRDYAFVHFSNREDAVEAMKALNGKVLDGSPIEVTLAKPVDK 306          
BLAST of APOBEC1 complementation factor vs. Ensembl Mouse
Match: Rbm46 (RNA binding motif protein 46 [Source:MGI Symbol;Acc:MGI:3645057])

HSP 1 Score: 306.22 bits (783), Expect = 8.393e-96
Identity = 138/253 (54.55%), Postives = 190/253 (75.10%), Query Frame = 2
Query:  281 CEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSK 1039
            CE+F+ KIP+D +E +L+P+    G IY FRLMME    +RG+ F +YT  E A+LA+  LNNY+I+   ++GVC S+DNCRLF+G IPK K K EI +EM+  TE +VD+IVYPSA DK KNRGFAFVEY +H+AAA+AR+K+I  + QLWG T+ VDWA+PE++V++E M +VK+LYVRNLM++TTEETI   FS++   P  + +VKK+ D+AFVHF +R+ A    + M+G  +DG++IEV  AKPV+K
Sbjct:   61 CEVFVGKIPRDMYEDELVPVFERAGKIYEFRLMMEFSGENRGYAFVMYTTKEEAQLAIRILNNYEIRPGKFIGVCVSLDNCRLFIGAIPKEKKKEEILDEMKKVTEGVVDVIVYPSATDKTKNRGFAFVEYESHRAAAMARRKLIPGTFQLWGHTIQVDWADPEKEVDEETMQRVKVLYVRNLMISTTEETIKAEFSKF--KPGAVERVKKLRDYAFVHFFHREDAVAAMSVMNGKCIDGASIEVTLAKPVNK 311          
BLAST of APOBEC1 complementation factor vs. UniProt/SwissProt
Match: sp|Q9NQ94|A1CF_HUMAN (APOBEC1 complementation factor OS=Homo sapiens OX=9606 GN=A1CF PE=1 SV=1)

HSP 1 Score: 321.627 bits (823), Expect = 3.634e-100
Identity = 152/278 (54.68%), Postives = 200/278 (71.94%), Query Frame = 2
Query:  209 VIYESGQRR-CGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSK 1039
            ++ E+GQR+  GPP  W  + P +GCEIFI K+P+D FE +LIP+  +IG IY  R+MM+   ++RG+ F  ++    AK A+ +LNNY+I+    LGVC SVDNCRLFVGGIPK K + EI  EM+  TE +VD+IVYPSAADK KNRGFAFVEY +H+AAA+AR+K++   +QLWG  +AVDWAEPE +V+++ MS VKILYVRNLML+T+EE I + F+     P  + +VKKI D+AFVHF NR+ A      ++G  LDGS IEV  AKPV K
Sbjct:   31 LVQENGQRKYGGPPPGWDAAPPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYEIRNGRLLGVCASVDNCRLFVGGIPKTKKREEILSEMKKVTEGVVDVIVYPSAADKTKNRGFAFVEYESHRAAAMARRKLLPGRIQLWGHGIAVDWAEPEVEVDEDTMSSVKILYVRNLMLSTSEEMIEKEFNNI--KPGAVERVKKIRDYAFVHFSNREDAVEAMKALNGKVLDGSPIEVTLAKPVDK 306          
BLAST of APOBEC1 complementation factor vs. UniProt/SwissProt
Match: sp|Q5R9H4|A1CF_PONAB (APOBEC1 complementation factor OS=Pongo abelii OX=9601 GN=A1CF PE=2 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 4.268e-100
Identity = 152/278 (54.68%), Postives = 200/278 (71.94%), Query Frame = 2
Query:  209 VIYESGQRR-CGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSK 1039
            ++ E+GQR+  GPP  W  + P +GCEIFI K+P+D FE +LIP+  +IG IY  R+MM+   ++RG+ F  ++    AK A+ +LNNY+I+    LGVC SVDNCRLFVGGIPK K + EI  EM+  TE +VD+IVYPSAADK KNRGFAFVEY +H+AAA+AR+K++   +QLWG  +AVDWAEPE +V+++ MS VKILYVRNLML+T+EE I + F+     P  + +VKKI D+AFVHF NR+ A      ++G  LDGS IEV  AKPV K
Sbjct:   31 LVQENGQRKYGGPPPGWDAAPPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKLEAKNAIKQLNNYEIRNGRLLGVCASVDNCRLFVGGIPKTKKREEILSEMKKVTEGVVDVIVYPSAADKTKNRGFAFVEYESHRAAAMARRKLLPGRIQLWGHPIAVDWAEPEVEVDEDTMSSVKILYVRNLMLSTSEEMIEKEFNNI--KPGAVERVKKIRDYAFVHFSNREDAVEAMKALNGKVLDGSPIEVTLAKPVDK 306          
BLAST of APOBEC1 complementation factor vs. UniProt/SwissProt
Match: sp|Q5YD48|A1CF_MOUSE (APOBEC1 complementation factor OS=Mus musculus OX=10090 GN=A1cf PE=1 SV=2)

HSP 1 Score: 308.531 bits (789), Expect = 5.013e-95
Identity = 152/278 (54.68%), Postives = 201/278 (72.30%), Query Frame = 2
Query:  209 VIYESGQRR-CGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSK 1039
            ++ E+GQR+  GPP  W  + P +GCEIFI K+P+D FE +LIP+  +IG IY  RLMM+   ++RG+ F  ++  + AK A+ +LNNY+I+    LGVC SVDNCRLFVGGIPK K + EI  EM+  TE +VD+IVYPSAADK KNRGFAFVEY +H+AAA+AR++++   +QLWG  +AVDWAEPE +V+++ MS VKILYVRNLML+T+EE I + F+     P  + +VKKI D+AFVHF NR+ A      ++G  LDGS IEV  AKPV K
Sbjct:   31 LVQENGQRKYGGPPPGWDSTPPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRLMMDFNGNNRGYAFVTFSNKQEAKNAIKQLNNYEIRTGRLLGVCASVDNCRLFVGGIPKTKKREEILSEMKKVTEGVVDVIVYPSAADKTKNRGFAFVEYESHRAAAMARRRLLPGRIQLWGHPIAVDWAEPEVEVDEDTMSSVKILYVRNLMLSTSEEMIEKEFNSI--KPGAVERVKKIRDYAFVHFSNREDAVEAMKALNGKVLDGSPIEVTLAKPVDK 306          
BLAST of APOBEC1 complementation factor vs. UniProt/SwissProt
Match: sp|P86049|RBM46_MOUSE (Probable RNA-binding protein 46 OS=Mus musculus OX=10090 GN=Rbm46 PE=1 SV=1)

HSP 1 Score: 306.22 bits (783), Expect = 5.871e-95
Identity = 138/253 (54.55%), Postives = 190/253 (75.10%), Query Frame = 2
Query:  281 CEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSK 1039
            CE+F+ KIP+D +E +L+P+    G IY FRLMME    +RG+ F +YT  E A+LA+  LNNY+I+   ++GVC S+DNCRLF+G IPK K K EI +EM+  TE +VD+IVYPSA DK KNRGFAFVEY +H+AAA+AR+K+I  + QLWG T+ VDWA+PE++V++E M +VK+LYVRNLM++TTEETI   FS++   P  + +VKK+ D+AFVHF +R+ A    + M+G  +DG++IEV  AKPV+K
Sbjct:   61 CEVFVGKIPRDMYEDELVPVFERAGKIYEFRLMMEFSGENRGYAFVMYTTKEEAQLAIRILNNYEIRPGKFIGVCVSLDNCRLFIGAIPKEKKKEEILDEMKKVTEGVVDVIVYPSATDKTKNRGFAFVEYESHRAAAMARRKLIPGTFQLWGHTIQVDWADPEKEVDEETMQRVKVLYVRNLMISTTEETIKAEFSKF--KPGAVERVKKLRDYAFVHFFHREDAVAAMSVMNGKCIDGASIEVTLAKPVNK 311          
BLAST of APOBEC1 complementation factor vs. UniProt/SwissProt
Match: sp|Q923K9|A1CF_RAT (APOBEC1 complementation factor OS=Rattus norvegicus OX=10116 GN=A1cf PE=1 SV=1)

HSP 1 Score: 307.76 bits (787), Expect = 7.613e-95
Identity = 151/278 (54.32%), Postives = 201/278 (72.30%), Query Frame = 2
Query:  209 VIYESGQRR-CGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSK 1039
            ++ E+GQR+  GPP  W  + P +GCEIFI K+P+D FE +LIP+  +IG IY  R+MM+   ++RG+ F  ++  + AK A+ +LNNY+I+    LGVC SVDNCRLFVGGIPK K + EI  EM+  TE +VD+IVYPSAADK KNRGFAFVEY +H+AAA+AR++++   +QLWG  +AVDWAEPE +V+++ MS VKILYVRNLML+T+EE I + F+     P  + +VKKI D+AFVHF NR+ A      ++G  LDGS IEV  AKPV K
Sbjct:   31 LVQENGQRKYGGPPPGWDTTPPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKQEAKNAIKQLNNYEIRNGRLLGVCASVDNCRLFVGGIPKTKKREEILSEMKKVTEGVVDVIVYPSAADKTKNRGFAFVEYESHRAAAMARRRLLPGRIQLWGHPIAVDWAEPEVEVDEDTMSSVKILYVRNLMLSTSEEMIEKEFNSI--KPGAVERVKKIRDYAFVHFSNREDAVEAMKALNGKVLDGSPIEVTLAKPVDK 306          
BLAST of APOBEC1 complementation factor vs. TrEMBL
Match: A0A0R3SKU4 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS5557 PE=4 SV=1)

HSP 1 Score: 372.474 bits (955), Expect = 3.956e-118
Identity = 201/450 (44.67%), Postives = 273/450 (60.67%), Query Frame = 2
Query:  209 VIYESGQRRCGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTE-DPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSKIEQQQKLLKKSTATLTQ-------SLPLLMPTDLNRLSLSSNGPILSNSENHERNAMNSNRSYRNAA-GRCSIKSRQMMKNMENSENFYNVINLLAETCQLYGWGAPFYAVQLIPVMLSSSESPVNGFMAQAYIPGLNVHFTGKMPTFSQEESILQSCETALLWLLYSGINI 1531
            +  E+GQRR GPP NW    P +GCE+F+ KIP+D FE +LIPI  +IG IY FRLMME    +RG+GFC+YT  + AK AV +LNNY+I+K   +GVC SVDNCRLFVGGIPK KTK EI  EM+  T+ + D+I YPS ADK KNRGFAFVEY +HKAAA+AR+K+I   +Q WGQ +AVDWAEPER+V +EIMSKVKILYVRNLML+TTEE +   F    E + Q I +VKKI D+AF+HFK+R+ A+    +++G  +DGST+EV +AKP  K EQ +    +S   +         S P     D     L+   P++ +         ++    RNAA GR +   R+    +E  E+F          CQ  G   P Y    + ++  ++   V  F+ Q  I  L +H+       + EE+ + + ETA+  L Y+ + +
Sbjct:   77 IAKENGQRRYGPPPNWTGEIPPRGCEVFVGKIPRDCFEDELIPIFEKIGPIYMFRLMMELSGHNRGYGFCVYTNRDDAKRAVDELNNYEIRKGKTIGVCLSVDNCRLFVGGIPKNKTKEEIFIEMQKVTDGVKDVICYPSVADKTKNRGFAFVEYESHKAAAMARRKLIPGRIQPWGQQIAVDWAEPEREVNEEIMSKVKILYVRNLMLSTTEEQLRAKFLGAGEVEDQAIERVKKITDYAFIHFKDREVAQKCLEKLNGAVIDGSTVEVTWAKPADKGEQVRSQSARSGKQMMDWNLNGDLSSPANYFLDPTAALLTGLNPLMLSGSTGCTRGTSTRLGRRNAAGGRSAAAQRERKHPVEIMEDF----------CQRNGLEPPVYMTLPVDIVDYTTGGKVQLFIGQVIISSLRLHYITPRYYNTAEEAKVGAAETAVYNLHYNQLQL 516          
BLAST of APOBEC1 complementation factor vs. TrEMBL
Match: A0A5K3FHJ4 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 378.637 bits (971), Expect = 9.796e-118
Identity = 202/453 (44.59%), Postives = 281/453 (62.03%), Query Frame = 2
Query:  218 ESGQRRCGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYT-EDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSKIEQQQKLLKKS---------TATLTQSLPLLMPTDLNRLSLSSNGPILSNSENHERNAMNSNRSYRNAAGRCSIKSRQMMKN-----MENSENFYNVINLLAETCQLYGWGAPFYAVQLIPVMLSSSESPVNGFMAQAYIPGLNVHFTGKMPTFSQEESILQSCETALLWLLYSGINI 1531
            E+GQRR GPP NWK  +P +GCE+F+ KIP+D FE +LIPI  +IG I+ FRLMME    +RG+GFC++T  E AK AV +LNNY+I+K   +GVC SVDNCRLFVGGIPK KTK EI  EM+  TE + D+I YPS ADK KNRGFAFVEY +HKAAA+AR+K+I   +Q WGQ +AVDWAEPER+V +EIMSKVKILYVRNLML+TTE+ +   F +      Q I +VKKI D+AF+HFK+R+ A+I  ++++G  +DGS +EV +AKP  K E  +    +S          A  T +    +  D     L+   P++       RN+ +S    RNAAG  S  +++  K+      ++  N      ++ + CQ  G  +P Y    + ++  SS   +  F+ Q  IP L +H+       + EE+ + + ETA+  L Y+ + +
Sbjct:   79 ENGQRRYGPPPNWKGDTPPRGCEVFVGKIPRDCFEDELIPIFEKIGPIFMFRLMMEFNGHNRGYGFCVFTNREDAKRAVEELNNYEIRKGKTIGVCLSVDNCRLFVGGIPKNKTKEEIFVEMQKVTEGVKDVICYPSVADKTKNRGFAFVEYESHKAAAMARRKLIPGRIQPWGQQIAVDWAEPEREVNEEIMSKVKILYVRNLMLSTTEDQLRAQFLEVAGAGDQAIERVKKISDYAFIHFKDREVAQICLDKLNGTIIDGSIVEVTWAKPADKGEPARSQAARSGKQLMDWNINADFTNATNYFL--DPATALLTGYNPLMLPGSGCTRNS-SSRIGRRNAAGGRSAAAQRERKHPVEKLQQHQSNPLVFQEIMEDFCQRNGLESPVYTALPVDIVDYSSGGKIQLFIGQVIIPSLRLHYLTPRYYGTAEEAKVGAAETAVYNLHYNQLQM 528          
BLAST of APOBEC1 complementation factor vs. TrEMBL
Match: A0A0R3TAV7 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS4194 PE=4 SV=1)

HSP 1 Score: 368.622 bits (945), Expect = 1.465e-116
Identity = 201/447 (44.97%), Postives = 273/447 (61.07%), Query Frame = 2
Query:  218 ESGQRRCGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTE-DPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSKIEQQQKLLKKSTATLTQ-SLPLLMPTDLNRLS------LSSNGPILSNSENHERNAMNSNRSYRNAA-GRCSIKSRQMMKNMENSENFYNVINLLAETCQLYGWGAPFYAVQLIPVMLSSSESPVNGFMAQAYIPGLNVHFTGKMPTFSQEESILQSCETALLWLLYSGINI 1531
            E+GQRR GPP NW +  P +GCE+F+ KIP+D FE +L+PI  +IG IY FRLMME    +RG+GFC+YT  + AK AV +LNNY+I+K   +GVC SVDNCRLFVGGIPK KTK EI  EM+  T+ + D+I YPS ADK KNRGFAFVEY +HKAAA+AR+K+I   +Q WGQ +AVDWAEPER+V +EIMSKVKILYVRNLML+TTEE +   F    E   Q I +VKKI D+AF+HFK+R+ A+    +++G  +DGST+EV +AKP  K EQ +    +S   L   +L    P   N         L+   P++ +         +S    RNAA GR +   R+    +E  E+F          CQ  G   P Y    + ++  ++   +  F+ Q  I  L +H+       + EE+ + + ETA+  L Y+ + +
Sbjct:   80 ENGQRRYGPPPNWTEEIPPRGCEVFVGKIPRDCFEDELVPIFEKIGPIYLFRLMMEFNGHNRGYGFCVYTNRDDAKRAVDELNNYEIRKGKTIGVCLSVDNCRLFVGGIPKNKTKEEIFIEMQKVTDGVKDVICYPSVADKTKNRGFAFVEYESHKAAAMARRKLIPGRIQPWGQQIAVDWAEPEREVNEEIMSKVKILYVRNLMLSTTEEQLRAKFLGAGEVGDQAIERVKKITDYAFIHFKDREVAQRCLEKLNGAVIDGSTVEVTWAKPADKGEQVRSQSARSGRQLMDWNLNGDFPNAANYFLDPTAAFLTGLNPLMLSGSTGCTKGTSSRIGRRNAAGGRSAAAQRERKHPVEIMEDF----------CQRNGLEPPVYMALPVDIVDYATGGKIQLFIGQVIISSLRLHYITPRYYNTAEEAKVGAAETAVYNLHYNQLQL 516          
BLAST of APOBEC1 complementation factor vs. TrEMBL
Match: A0A0X3PRX0 (APOBEC1 complementation factor OS=Schistocephalus solidus OX=70667 GN=A1CF PE=4 SV=1)

HSP 1 Score: 374.4 bits (960), Expect = 2.436e-115
Identity = 205/467 (43.90%), Postives = 280/467 (59.96%), Query Frame = 2
Query:  218 ESGQRRCGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYT-EDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSK---IEQQQK---------------------LLKKSTATLTQS---LPLLMPTDLNRLSLSSNGPILSNSENHERNAMNSNRS-YRNAAGRCSIKSRQMMKNMENSENFYNVINLLAETCQLYGWGAPFYAVQLIPVMLSSSESPVNGFMAQAYIPGLNVHFTGKMPTFSQEESILQSCETALLWLLYSGINI 1531
            E GQRR GPP +W   +P +GCE+FI KIP+D FE +LIPI  +IG IY FRLM+E   ++RG+GFC+YT  E  K AV +LNNY+I+K   +GVC SVDNCRLFVGGIPK KT+ EI  EM+  TE + D+I YPS  DK KNRGFAFVEY +HKAAA+AR+K+I   +QLWGQ +AVDWAEPER+V ++IMSKVKILYVRNLML+T+EE +  +F +    DPQ I +VKKI D+AF+HFK R+ A+     + G N+DGS IEV +AKP  K   +  Q                        L  +TA    S    P ++P+ L+  ++SS G +L  + +     + S RS  RNAAG  S  +++  K         + + LL + C   G   P YA   + ++   S   V+ ++ Q  IP L +    +    + EE+ + + E A  +L  + I +
Sbjct:   78 EHGQRRYGPPPDWTGETPQRGCEVFIGKIPRDCFEDELIPIFEKIGPIYMFRLMIEFNGTNRGYGFCVYTNREDTKRAVDELNNYEIRKGKTIGVCLSVDNCRLFVGGIPKNKTRSEILAEMQKVTEGVKDVISYPSVTDKTKNRGFAFVEYESHKAAAMARRKLIPGRIQLWGQQIAVDWAEPEREVNEDIMSKVKILYVRNLMLSTSEERLREIFLEAAGGDPQSIERVKKISDYAFIHFKEREIAKRCMEALSGANIDGSIIEVTWAKPADKGDPVRPQSSRSSKQLMDWSFNNDLTNASNLFLDPATAIFAGSAPGAPFIIPS-LSNDAVSSVGQLLLPNSSSCGFRLGSARSGRRNAAGGRSAAAQRERK---------HPVELLEDICLRNGLEPPVYAALPVDMIEYGSGGKVSLYIGQVTIPSLRIQCHTQKYCRTAEEAKVGAAEAAFFYLHQAHIQL 534          
BLAST of APOBEC1 complementation factor vs. TrEMBL
Match: A0A564YY18 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS10323 PE=4 SV=1)

HSP 1 Score: 370.163 bits (949), Expect = 3.112e-115
Identity = 199/451 (44.12%), Postives = 275/451 (60.98%), Query Frame = 2
Query:  218 ESGQRRCGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTE-DPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSKIEQQQKLLKKSTATLTQ-------SLPLLMPTDLNRLSLSSNGPILSNSENHERNAMNSNRSYRNAAGRCSIKSRQMMKN-----MENSENFYNVINLLAETCQLYGWGAPFYAVQLIPVMLSSSESPVNGFMAQAYIPGLNVHFTGKMPTFSQEESILQSCETALLWLLYSGINI 1531
            E+GQRR GPP NW    P +GCE+F+ KIP+D FE +LIPI  +IG IY FRLMME    +RG+GFC+YT  + AK AV +LNNY+I+K   +GVC SVDNCRLFVGGIPK KTK EI  EM+  T+ + D+I YPS ADK KNRGFAFVEY +HKAAA+AR+K+I   +Q WGQ +AVDWAEPER+V +EIMSKVKILYVRNLML+TTEE +   F    E + Q I +VKKI D+AF+HFK+R+ A+    +++G  +DGST+EV +AKP  K EQ +    +S   +         S P     D     L+   P++ +         ++    RNAAG  S  +++  K+      ++  N      ++ + CQ  G   P Y    + ++  ++   V  F+ Q  I  L +H+       + EE+ + + ETA+  L Y+ + +
Sbjct:   10 ENGQRRYGPPPNWTGEIPPRGCEVFVGKIPRDCFEDELIPIFEKIGPIYMFRLMMELSGHNRGYGFCVYTNRDDAKRAVDELNNYEIRKGKTIGVCLSVDNCRLFVGGIPKNKTKEEIFIEMQKVTDGVKDVICYPSVADKTKNRGFAFVEYESHKAAAMARRKLIPGRIQPWGQQIAVDWAEPEREVNEEIMSKVKILYVRNLMLSTTEEQLRAKFLGAGEVEDQAIERVKKITDYAFIHFKDREVAQKCLEKLNGAVIDGSTVEVTWAKPADKGEQVRSQSARSGKQMMDWNLNGDLSSPANYFLDPTAALLTGLNPLMLSGSTGCTRGTSTRLGRRNAAGGRSAAAQRERKHPVEKLQQHQSNPIIYQEIMEDFCQRNGLEPPVYMTLPVDIVDYTTGGKVQLFIGQVIISSLRLHYITPRYYNTAEEAKVGAAETAVYNLHYNQLQL 460          
BLAST of APOBEC1 complementation factor vs. Ensembl Cavefish
Match: rbm47 (RNA binding motif protein 47 [Source:NCBI gene;Acc:103026221])

HSP 1 Score: 332.028 bits (850), Expect = 5.579e-105
Identity = 154/308 (50.00%), Postives = 219/308 (71.10%), Query Frame = 2
Query:  167 PNPLSVIGITETTP--VIYESGQRRCGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSKIE--QQQKLLKKSTA 1078
            PN  +++ + E +   ++ E+GQR+ GPP  W+  SP +GCEIF+ KIP+D +E +L+P+   +G IY  RLMM+ +  +RG+ F +YT+   AK AV +LNNY+++    LGVC SVDNCRLF+GGIPK K + EI +E+   TE ++D+IVY SAADK KNRGFAFVEY +H+AAA+AR+K++   +QLWG  +AVDWAEPE  V++++M  VKILYVRNLM+ T+EE + + F Q+  +P  + +VKKI D+AFVHF +RD A +  + ++G  ++GS IEV  AKPV K +  + QK  K STA
Sbjct:   42 PNESALLALMERSGYRMVQENGQRKYGPPPGWQGPSPPRGCEIFVGKIPRDVYEDELVPVFEMVGRIYEMRLMMDFDGKNRGYAFVMYTQKHEAKRAVRELNNYEVRPGRLLGVCSSVDNCRLFIGGIPKTKKREEILDEVSKVTEGVLDVIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETSEEILRQTFGQF--NPGCVERVKKIRDYAFVHFTSRDDAVVAMDNLNGTEIEGSCIEVTLAKPVDKEQYTRYQKASKGSTA 347          
BLAST of APOBEC1 complementation factor vs. Ensembl Cavefish
Match: rbm46 (RNA binding motif protein 46 [Source:NCBI gene;Acc:566042])

HSP 1 Score: 319.701 bits (818), Expect = 2.821e-102
Identity = 146/278 (52.52%), Postives = 199/278 (71.58%), Query Frame = 2
Query:  209 VIYESGQRR-CGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSK 1039
            ++ E+GQR+  GPP  W+   P +GCE+F+ KIP+D +E +L+P+    G +Y FRLMME    +RG+ F  YT  E A+ A+  L+NY+I    ++GVC S+DNCRLF+G +PK KTK EIQEEM   T+ +VD+IVYPS  DK KNRGFAFVEY +HKAAA+AR+K+I E+ QLWG T+ V WAEPE+ V++E M +V++LYVRNLML TTEET+   FS+  + P  + +VKK+ D+AF+HF +R+ A   +  M+G  +DGS IEV  AKPV K
Sbjct:   28 MVQENGQRKFGGPPPGWEGLPPPRGCEVFVGKIPRDIYEDELVPVFERAGRMYEFRLMMEFSGENRGYAFVRYTTQEAAQRAINLLDNYEIHPGKFIGVCVSLDNCRLFIGSLPKDKTKEEIQEEMMKVTDGVVDVIVYPSTTDKSKNRGFAFVEYESHKAAAMARRKLIPETFQLWGHTLQVHWAEPEKDVDEETMQRVRVLYVRNLMLHTTEETLRLEFSR--QKPGSVERVKKLTDYAFIHFHSREDALAAQESMNGKLIDGSPIEVSLAKPVGK 303          
BLAST of APOBEC1 complementation factor vs. Ensembl Cavefish
Match: ENSAMXT00000021508.2 (probable RNA-binding protein 46 [Source:NCBI gene;Acc:103038610])

HSP 1 Score: 301.597 bits (771), Expect = 3.619e-94
Identity = 140/255 (54.90%), Postives = 185/255 (72.55%), Query Frame = 2
Query:  275 KGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSK 1039
            +GCEIF+ KIP+D +E +L+P+    G IY FRLMME    +RG+ F  YT  E A+ A+  L++Y+I+   ++GVC S++NCRLF+G IPK   K EIQEEM   T+ +VD+IVYPSAADK  NRGFAFVEY +HKAAA+AR+K++  + Q+WG T+ VDWAEPER V+DEIM KV++LYVRNLML TTEET+   FS+    P  + +VKK+ D+AF+HF +R+ A   K  M+G  +DGS IEV  AKP SK
Sbjct:   43 RGCEIFVGKIPRDMYEDELVPLFERAGCIYEFRLMMEFSGENRGYAFVRYTTPEAAQQAIYLLDHYEIRPGKFIGVCVSLNNCRLFIGSIPKDMKKEEIQEEMMKVTDGVVDVIVYPSAADKSMNRGFAFVEYESHKAAAMARRKLVPGTFQMWGHTIQVDWAEPERNVDDEIMQKVRVLYVRNLMLHTTEETLCSEFSRLK--PGSVERVKKLSDYAFIHFHSREDALTAKQFMNGKLIDGSQIEVTLAKPSSK 295          
BLAST of APOBEC1 complementation factor vs. Ensembl Cavefish
Match: a1cf (apobec1 complementation factor [Source:ZFIN;Acc:ZDB-GENE-060824-3])

HSP 1 Score: 266.159 bits (679), Expect = 4.214e-80
Identity = 127/231 (54.98%), Postives = 167/231 (72.29%), Query Frame = 2
Query:  347 EIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSK 1039
            + G +Y  R+MM+   ++RG+ F  +T  + AK A+ +LNNY+I+    LGVC SVDNCRLFVGGIPK K K EI  EM+  T+ +V++IVYPSAADK KNRGFAFVEY +H+AAA+AR+K++   +QLWG  +AVDWAEPE +V+++ M+ VKILYVRNLML TTEETI + F+     P  + +VKKI D+AFVHF  R+ A    N ++G  +DGS IEV  AKPV K
Sbjct:   57 QFGKLYEVRMMMDFNGNNRGYAFVTFTTKQEAKNAMKQLNNYEIRNGRLLGVCASVDNCRLFVGGIPKTKKKEEILAEMKKVTDGVVEVIVYPSAADKTKNRGFAFVEYESHRAAAMARRKLLPGRIQLWGHAIAVDWAEPEVEVDEDTMATVKILYVRNLMLATTEETIEKEFNSI--KPGAVERVKKIRDYAFVHFSQREDAITAMNALNGKIIDGSPIEVTLAKPVDK 285          
BLAST of APOBEC1 complementation factor vs. Ensembl Cavefish
Match: syncripl (heterogeneous nuclear ribonucleoprotein Q [Source:NCBI gene;Acc:103026145])

HSP 1 Score: 248.054 bits (632), Expect = 5.987e-74
Identity = 124/291 (42.61%), Postives = 188/291 (64.60%), Query Frame = 2
Query:  221 SGQRRCG--PPENWKDSS-PGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFS-HRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSKIEQQQKLLKKSTAT 1081
            +GQR+ G  PPE+    + P  G EIF+ KIP+D FE +L+P+  + G I+  RLMM+     +RG+ F  +   E A+ AV   NN +I+   ++GVC SV N RLFVG IPK KTK +I +E    TE + D+I+Y    DK+KNRGF F+EY +HK AA AR++++S  V++WG  V V+WA+P    + E+M+KVK+L+VRNL  T +EE + + FSQ+     ++ +VKK+ D+AF+HF+ RD A     +M+G +L+G  IE+ FAKP  +  +++K  +++  T
Sbjct:   99 TGQRKYGGPPPESTHSGAQPSVGTEIFVGKIPRDLFEDELVPLFEKAGPIWDLRLMMDPLSGLNRGYAFVTFCTKEAAQEAVKLCNNNEIRPGKHIGVCISVANNRLFVGSIPKSKTKEQIVDEFAKVTEGLNDVILYHQPDDKKKNRGFCFLEYEDHKTAAQARRRLMSGKVKVWGNVVTVEWADPIEDPDPEVMAKVKVLFVRNLASTVSEELLEKTFSQFG----KLERVKKLKDYAFIHFEERDGAVKALAEMNGKDLEGEQIEIVFAKPPDQKRKERKAQRQAAKT 385          
BLAST of APOBEC1 complementation factor vs. Ensembl Sea Lamprey
Match: syncripl (synaptotagmin binding, cytoplasmic RNA interacting protein, like [Source:ZFIN;Acc:ZDB-GENE-030131-3104])

HSP 1 Score: 231.491 bits (589), Expect = 2.538e-67
Identity = 115/272 (42.28%), Postives = 175/272 (64.34%), Query Frame = 2
Query:  221 SGQRR-CGPPEN--WKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFS-HRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFA 1024
            +GQR+  GPP +  +    PG G E+F+ KIP+D FE  L+P+  + G I+  RLMM+     +RG+ F  Y   + A  AV   +NY+I+   ++GVC SV N RLFVG IPK KTK +I EE +  TE + D+I+Y    DK++NRGF F+E+ +HK AA AR++++S  ++++G  V+V+WA+P  + + EIMSKVK+L+VRNL    TEE +   FS +     ++ +VKK+ D+AFVHF++RD A    ++M+G  L+G  + +  A
Sbjct:  147 TGQRKYGGPPPDPVYSGPQPGTGTEVFVGKIPRDLFEDTLVPLFEKAGPIWDLRLMMDPLTGLNRGYAFLTYCSKDAALEAVKLCDNYEIRPGKHVGVCLSVANNRLFVGSIPKSKTKEQIMEEFQDITEGLTDVILYQQVEDKRRNRGFCFLEFEDHKTAAQARRRLMSGKIKVFGIPVSVEWADPIEEPDPEIMSKVKVLFVRNLASAVTEEILQDTFSVFG----KLERVKKLKDYAFVHFEDRDDAVKAMDEMNGKPLEGEPLVIVLA 414          
BLAST of APOBEC1 complementation factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009756.1 (pep scaffold:Pmarinus_7.0:GL478948:7772:26420:1 gene:ENSPMAG00000008818.1 transcript:ENSPMAT00000009756.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 206.068 bits (523), Expect = 1.761e-61
Identity = 106/282 (37.59%), Postives = 161/282 (57.09%), Query Frame = 2
Query:  209 VIYESGQRRCGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPER------KVEDEIMSKVKILYVRNLMLTTTEETI--YRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKP 1030
            +I E+GQR+ GPP +W+   P +GCE+F+ KIP+D +E +L+P+L  +G +Y  RLMME    +RG+ F  YT    A+ A+ KLNN++I+    +GVC SVDNCRL++GG+PK KT+ E+   M   T  +VD+ +     DK +NRG+AFVEY +H+AAA+AR+K++ E+ +LWG T+ VDWA+P+R        E E  +                +      V      +P +  +    GD A +HF +R  A      + G  L G+ +    A+P
Sbjct:   16 MIQENGQRKFGPPPDWQGPPPARGCEVFLGKIPRDLYEDELVPVLETVGKLYLLRLMMEFSGENRGYAFATYTTRTHAEDAIKKLNNFEIRPGCAIGVCISVDNCRLYIGGLPKDKTQEEVMLAMSCATMGVVDVKMSVCPTDKTRNRGYAFVEYESHRAAAMARRKLVPETFELWGHTIKVDWADPKRDTAVVAATEKEASTPGSRRGRVPPPPRRLPDGAPGGAVVEATAPEPLQPERAGA-GDAALLHFGSRGDAATALRTLRGAALLGAQVRAAAAEP 296          
BLAST of APOBEC1 complementation factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003808.1 (pep scaffold:Pmarinus_7.0:GL483076:13225:15644:1 gene:ENSPMAG00000003482.1 transcript:ENSPMAT00000003808.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 163.31 bits (412), Expect = 4.818e-47
Identity = 80/174 (45.98%), Postives = 118/174 (67.82%), Query Frame = 2
Query:  209 VIYESGQRRCGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYT-KHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESV 727
            +I E+GQR+ GPP +W+   P +GCE+F+ KIP+D +E +L+P+L  +G +Y  RLMME    +RG+ F  YT +H  A  A+ KLNN++I+     GVC SVDNCRL++GG+PK K + E+   M   T  +VD+ +     DK +NRG+AFVEY +H+AAA+AR+K++   V
Sbjct:   19 MIQENGQRKFGPPPDWQGPPPARGCEVFLGKIPRDLYEDELVPVLETVGRLYQLRLMMEFSGENRGYAFATYTTRHAVA--AIKKLNNFEIRPGHPFGVCISVDNCRLYIGGLPKDKKQEEVMLAMSCATMGVVDVKMSVCPTDKTRNRGYAFVEYESHRAAAMARRKLVPGPV 190          
BLAST of APOBEC1 complementation factor vs. Ensembl Sea Lamprey
Match: ncl (nucleolin [Source:ZFIN;Acc:ZDB-GENE-030131-6986])

HSP 1 Score: 54.299 bits (129), Expect = 7.385e-8
Identity = 40/132 (30.30%), Postives = 64/132 (48.48%), Query Frame = 2
Query:  644 KNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGD---FAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKP 1030
            K RG AFV++ +   A  A K      V+  G+ + ++++ P         S    L+VR L   T+E+T+   F   T     I+  +  G    +A+V F + D+A+   N M G+ +DGS I V FA+P
Sbjct:  495 KPRGMAFVDFASIDDAKAAMKAHSGAEVE--GRAIRLEFSTPRGTPGPSEASST--LFVRGLGEDTSEDTLMDSFEGATA--ARIVTDRDSGQSKGYAYVDFSSADEAKSALNAMKGVEIDGSQIYVDFARP 620          
BLAST of APOBEC1 complementation factor vs. Ensembl Sea Lamprey
Match: pabpc4 (poly(A) binding protein, cytoplasmic 4 (inducible form) [Source:ZFIN;Acc:ZDB-GENE-030131-9663])

HSP 1 Score: 51.6026 bits (122), Expect = 4.854e-7
Identity = 63/279 (22.58%), Postives = 119/279 (42.65%), Query Frame = 2
Query:  287 IFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLN----NYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEI--------QEEMRHFTENIVDIIVYPSAADK-QKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKI-------------LYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGD------FAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAK 1027
            +FI  + K    K +       G+I + +++ + E   RG+GF  +   E A  A+ K+N    N ++ +  ++G   S       +G   K  T + I        ++++R F       +     +D+  K+RGF FV +  H+ A  A  +M  +  +L G+TV V  A+ + + + E+  K ++             LYV+NL     +E + + F+ Y      I   K + +      F FV F + ++A     +M+G  +    + V  A+
Sbjct:  101 VFIKNLDKSIDNKAMYDTFSAFGNILSCKVVCD-ENGSRGYGFVHFETQEAADRAIEKMNGMLLNDRLARRRFVGRFKSRKEREQEMGARAKEFTNVYIKNFGDDMDEDKLREFFGKFGKALSVCVMSDECGKSRGFGFVSFEQHEDAQRAVNEMNGK--ELNGRTVFVGRAQKKGERQAELKRKFEMLKQERISRYQGVNLYVKNLDDNIDDEQLRKEFAPYG----TITSTKVMSEEGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQ 372          
BLAST of APOBEC1 complementation factor vs. Ensembl Nematostella
Match: EDO46547 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPQ1])

HSP 1 Score: 315.464 bits (807), Expect = 1.883e-101
Identity = 148/293 (50.51%), Postives = 202/293 (68.94%), Query Frame = 2
Query:  167 PNPLSVIGITETT--PVIYESGQRRCGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSK 1039
            P   ++  + E T  P+   +GQRR GPP  W    P +GCE+F+ KIP+D +E +L+P+    G IY  RLMM+    +RG+ F +YT  + AK  V  LNNY+I+K   +GVC SVDNCRLFVGGIPK   K EI  E+   T+N+VD+IVYPSA DK KNRGFAFVEY +H+ AA+AR+K+++  +QLWG  +AVDWAEPE++V+ EIM +VK+LY RNL+L+TTEETI + FS++     E+ +VKKI D+ F+HF+ +++A      M+   LDG+ IEV  AKPV K
Sbjct:   17 PKEAALRALMERTKFPIRQCNGQRRYGPPPGWDRPIPPRGCEVFVGKIPRDLYEDELVPVFETAGPIYEVRLMMDFNGQNRGYAFVVYTSKDDAKRCVKTLNNYEIRKGKCIGVCSSVDNCRLFVGGIPKKVKKDEIMAEVSKVTDNVVDVIVYPSAQDKTKNRGFAFVEYISHRDAAMARRKLMTGKIQLWGHQIAVDWAEPEQEVDQEIMDQVKVLYARNLLLSTTEETIEQAFSKFG----EVERVKKIKDYCFIHFRTKEQARDAMEAMNETELDGNEIEVTLAKPVDK 305          
BLAST of APOBEC1 complementation factor vs. Ensembl Nematostella
Match: EDO38763 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC28])

HSP 1 Score: 252.292 bits (643), Expect = 2.949e-75
Identity = 128/287 (44.60%), Postives = 180/287 (62.72%), Query Frame = 2
Query:  221 SGQRR-CGPPENWKDSSPGKGCE-----IFIAKIPKDFFEKDLIPILREIGDIYTFRLMMET-EFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQ-TVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSKIEQQQK 1057
            +GQR+  GPP  W+   PG G E     +FI K+P+D FE +LIP+  E G IY FRLM++      +GF FC ++  + A+ AV KL+N +I+    LGVC SV N RLFVG IPK K+K EI EE    T  + D+IVY SA  K KNRGFAF+EY +H+AA++AR+++ S  +++WG   V VDWA+P+ + +D+ M KVK++Y+RNL  + TEE +   +SQY      + +VKK+ D+AFVHF  RD A     +  G  +DG  IE   AKP    + +Q+
Sbjct:  126 TGQRKYGGPPPGWEGKPPGTGSEKVCSQVFIGKVPRDCFEDELIPVFEECGHIYDFRLMIDPISGLTKGFAFCTFSNKDEAQNAVKKLDNKEIRPGKRLGVCISVANSRLFVGSIPKTKSKQEILEEFSKVTNGLDDVIVYLSADQKGKNRGFAFLEYESHQAASLARRRLASGRIKVWGNIVVTVDWADPQEEPDDDAMKKVKVVYLRNLSPSITEEKLKEEYSQYG----AVDRVKKLKDYAFVHFTERDHALKAIEETDGKEMDGLKIEASLAKPQPGNKDRQR 408          
BLAST of APOBEC1 complementation factor vs. Ensembl Nematostella
Match: EDO38734 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC26])

HSP 1 Score: 189.504 bits (480), Expect = 3.219e-54
Identity = 108/277 (38.99%), Postives = 157/277 (56.68%), Query Frame = 2
Query:  230 RRCGPPE---NWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFS-HRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQK---NRGFAFVEYTNHKAAAIARKKMISESVQLWGQTV-AVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVS 1036
            R C P +   +++      G E+FI KIP+D  E +LIP+L + G+I  FRL M+     ++GF FC +TK  +A  A+  LN+  I+    L +C S  N RLFV GIPK K+K EI +E    T ++ D+IVY S         NRGF F+EY N+ A A A  +     V++WG+ + AV WAE     +  +MSKVK +YVRN+ L  +E  +  VF++Y     +I KV+KI D+ FV+F  R+ A    + ++G  +DG  +EV  A P S
Sbjct:   90 RECTPRQRNHSYESVFQESGTEVFIGKIPRDCLEDELIPLLEKCGEIREFRLQMDPATGLNKGFAFCTFTKQTSAYQAITTLNDKDIRPGRRLAICKSRSNSRLFVKGIPKRKSKEEIFQEFSKVTTDLQDVIVYQSCDQGNHGDLNRGFVFLEYANYIAGASALHRFTDGKVRIWGKVLEAVTWAEAREIPDYAVMSKVKSIYVRNVPLPMSETQLKAVFTKYG----QIEKVRKIRDYGFVYFAKRESAVQAIDGINGAYIDGCKLEVSLAIPQS 362          
BLAST of APOBEC1 complementation factor vs. Ensembl Nematostella
Match: EDO44940 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU25])

HSP 1 Score: 59.3066 bits (142), Expect = 1.251e-9
Identity = 51/176 (28.98%), Postives = 86/176 (48.86%), Query Frame = 2
Query:  509 SVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVS 1036
             VD   L V G+P   T+ E++E    F E  +D        + +++RGF FV +   + A    K ++S S ++ G+   V    P+     E ++  K L+V  L  +TTE+T+   F+Q+ E   ++   K    F FV F + + A+ V +Q H   + GS + + FA+P S
Sbjct:  111 GVDVGDLIVLGLPYATTESEMKEYFTRFGE--IDFCEVKLDPNTRRSRGFGFVRFKKDEDA----KNVLSTSHRIQGRLCEVRLPRPK-----EELNVPKKLFVGRLPESTTEKTLMEYFAQFGE-VTDVYIPKPFRHFGFVTFASGELAKKVLSQNH--RISGSLLNITFAEPKS 272          
BLAST of APOBEC1 complementation factor vs. Ensembl Nematostella
Match: EDO38417 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCX6])

HSP 1 Score: 50.8322 bits (120), Expect = 8.860e-7
Identity = 57/199 (28.64%), Postives = 91/199 (45.73%), Query Frame = 2
Query:  485 NWYLGVCFSVDNCR---------LFVGGIPKLKTKLEIQEEMRHFTENI-VDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKV------KKIGDFAFVHFKNRDKAE-IVKNQMHGMNLDGSTIEVHFAKP 1030
            N Y+G     +  R         LFVGG+    TK  ++E    + E + VDI +    A   + RGFAFV++  H++ A A    +   V L G+T+    A P   +      +VK ++V  L   T++E I   F +     +EI  +      ++ G F FV F + D  + I + Q H  N++G+ +EV  A P
Sbjct:    8 NGYIGTSLDSNKTRMTKDDDIGKLFVGGLSYETTKESLKEYFSKYGELVGVDIKM---DALTGRPRGFAFVQF-KHQSEADAVLNQVDPHV-LDGRTIDPKPAAP---IGKPPHLRVKKIFVGGLKPETSDEKIREYFGKAYAPVKEIEYITEHSSNRRRG-FCFVSFDSEDTVDKICETQFH--NIEGNKVEVKRALP 195          

HSP 2 Score: 48.1358 bits (113), Expect = 5.556e-6
Identity = 33/93 (35.48%), Postives = 50/93 (53.76%), Query Frame = 2
Query:  773 RKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGD----FAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSK 1039
            R  +D+ + K   L+V  L   TT+E++   FS+Y E     IK+  +      FAFV FK++ +A+ V NQ+    LDG TI+   A P+ K
Sbjct:   21 RMTKDDDIGK---LFVGGLSYETTKESLKEYFSKYGELVGVDIKMDALTGRPRGFAFVQFKHQSEADAVLNQVDPHVLDGRTIDPKPAAPIGK 110          
BLAST of APOBEC1 complementation factor vs. Ensembl Medaka
Match: rbm47 (RNA binding motif protein 47 [Source:NCBI gene;Acc:101167848])

HSP 1 Score: 333.183 bits (853), Expect = 3.307e-106
Identity = 151/293 (51.54%), Postives = 209/293 (71.33%), Query Frame = 2
Query:  209 VIYESGQRRCGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSKIEQQQKLLKKSTATLT 1087
            ++ E+GQR+ GPP  W   SP +GCEIF+ KIP+D +E +L+P+   +G IY  RLMM+ +  +RG+ F +YT+   AK AV +LNNY+++    LGVC SVDNCRLF+GGIPK K + EI EE+   TE ++D+IVY SAADK KNRGFAFVEY +H+AAA+AR+K++   +QLWG  +AVDWAEPE  V++++M  VKILYVRNLM+ T EETI ++FSQ+  +P  + +VKKI D+AFVHF +RD A +  + ++G  ++GS IEV  AKPV K +  ++   K     T
Sbjct:   59 MVQENGQRKYGPPPGWNGPSPPRGCEIFVGKIPRDVYEDELVPVFESVGRIYEMRLMMDFDGKNRGYAFVMYTEKHEAKRAVRELNNYEVRPGRLLGVCSSVDNCRLFIGGIPKTKKREEILEEVSKVTEGVLDVIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMMETNEETIRQIFSQW--NPGCVERVKKIRDYAFVHFTSRDDAVLAMDNLNGTEIEGSCIEVTLAKPVDKEQYSRQKASKGAIPAT 349          
BLAST of APOBEC1 complementation factor vs. Ensembl Medaka
Match: rbm47 (RNA binding motif protein 47 [Source:NCBI gene;Acc:101167848])

HSP 1 Score: 334.339 bits (856), Expect = 5.774e-106
Identity = 151/293 (51.54%), Postives = 209/293 (71.33%), Query Frame = 2
Query:  209 VIYESGQRRCGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSKIEQQQKLLKKSTATLT 1087
            ++ E+GQR+ GPP  W   SP +GCEIF+ KIP+D +E +L+P+   +G IY  RLMM+ +  +RG+ F +YT+   AK AV +LNNY+++    LGVC SVDNCRLF+GGIPK K + EI EE+   TE ++D+IVY SAADK KNRGFAFVEY +H+AAA+AR+K++   +QLWG  +AVDWAEPE  V++++M  VKILYVRNLM+ T EETI ++FSQ+  +P  + +VKKI D+AFVHF +RD A +  + ++G  ++GS IEV  AKPV K +  ++   K     T
Sbjct:   44 MVQENGQRKYGPPPGWNGPSPPRGCEIFVGKIPRDVYEDELVPVFESVGRIYEMRLMMDFDGKNRGYAFVMYTEKHEAKRAVRELNNYEVRPGRLLGVCSSVDNCRLFIGGIPKTKKREEILEEVSKVTEGVLDVIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMMETNEETIRQIFSQW--NPGCVERVKKIRDYAFVHFTSRDDAVLAMDNLNGTEIEGSCIEVTLAKPVDKEQYSRQKASKGAIPAT 334          
BLAST of APOBEC1 complementation factor vs. Ensembl Medaka
Match: rbm47 (RNA binding motif protein 47 [Source:NCBI gene;Acc:101167848])

HSP 1 Score: 333.954 bits (855), Expect = 1.126e-105
Identity = 151/293 (51.54%), Postives = 209/293 (71.33%), Query Frame = 2
Query:  209 VIYESGQRRCGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSKIEQQQKLLKKSTATLT 1087
            ++ E+GQR+ GPP  W   SP +GCEIF+ KIP+D +E +L+P+   +G IY  RLMM+ +  +RG+ F +YT+   AK AV +LNNY+++    LGVC SVDNCRLF+GGIPK K + EI EE+   TE ++D+IVY SAADK KNRGFAFVEY +H+AAA+AR+K++   +QLWG  +AVDWAEPE  V++++M  VKILYVRNLM+ T EETI ++FSQ+  +P  + +VKKI D+AFVHF +RD A +  + ++G  ++GS IEV  AKPV K +  ++   K     T
Sbjct:   59 MVQENGQRKYGPPPGWNGPSPPRGCEIFVGKIPRDVYEDELVPVFESVGRIYEMRLMMDFDGKNRGYAFVMYTEKHEAKRAVRELNNYEVRPGRLLGVCSSVDNCRLFIGGIPKTKKREEILEEVSKVTEGVLDVIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMMETNEETIRQIFSQW--NPGCVERVKKIRDYAFVHFTSRDDAVLAMDNLNGTEIEGSCIEVTLAKPVDKEQYSRQKASKGAIPAT 349          
BLAST of APOBEC1 complementation factor vs. Ensembl Medaka
Match: rbm47 (RNA binding motif protein 47 [Source:NCBI gene;Acc:101167848])

HSP 1 Score: 333.954 bits (855), Expect = 1.371e-105
Identity = 151/293 (51.54%), Postives = 209/293 (71.33%), Query Frame = 2
Query:  209 VIYESGQRRCGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSKIEQQQKLLKKSTATLT 1087
            ++ E+GQR+ GPP  W   SP +GCEIF+ KIP+D +E +L+P+   +G IY  RLMM+ +  +RG+ F +YT+   AK AV +LNNY+++    LGVC SVDNCRLF+GGIPK K + EI EE+   TE ++D+IVY SAADK KNRGFAFVEY +H+AAA+AR+K++   +QLWG  +AVDWAEPE  V++++M  VKILYVRNLM+ T EETI ++FSQ+  +P  + +VKKI D+AFVHF +RD A +  + ++G  ++GS IEV  AKPV K +  ++   K     T
Sbjct:   59 MVQENGQRKYGPPPGWNGPSPPRGCEIFVGKIPRDVYEDELVPVFESVGRIYEMRLMMDFDGKNRGYAFVMYTEKHEAKRAVRELNNYEVRPGRLLGVCSSVDNCRLFIGGIPKTKKREEILEEVSKVTEGVLDVIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMMETNEETIRQIFSQW--NPGCVERVKKIRDYAFVHFTSRDDAVLAMDNLNGTEIEGSCIEVTLAKPVDKEQYSRQKASKGAIPAT 349          
BLAST of APOBEC1 complementation factor vs. Ensembl Medaka
Match: rbm47 (RNA binding motif protein 47 [Source:NCBI gene;Acc:101167848])

HSP 1 Score: 333.954 bits (855), Expect = 1.371e-105
Identity = 151/293 (51.54%), Postives = 209/293 (71.33%), Query Frame = 2
Query:  209 VIYESGQRRCGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSKIEQQQKLLKKSTATLT 1087
            ++ E+GQR+ GPP  W   SP +GCEIF+ KIP+D +E +L+P+   +G IY  RLMM+ +  +RG+ F +YT+   AK AV +LNNY+++    LGVC SVDNCRLF+GGIPK K + EI EE+   TE ++D+IVY SAADK KNRGFAFVEY +H+AAA+AR+K++   +QLWG  +AVDWAEPE  V++++M  VKILYVRNLM+ T EETI ++FSQ+  +P  + +VKKI D+AFVHF +RD A +  + ++G  ++GS IEV  AKPV K +  ++   K     T
Sbjct:   59 MVQENGQRKYGPPPGWNGPSPPRGCEIFVGKIPRDVYEDELVPVFESVGRIYEMRLMMDFDGKNRGYAFVMYTEKHEAKRAVRELNNYEVRPGRLLGVCSSVDNCRLFIGGIPKTKKREEILEEVSKVTEGVLDVIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMMETNEETIRQIFSQW--NPGCVERVKKIRDYAFVHFTSRDDAVLAMDNLNGTEIEGSCIEVTLAKPVDKEQYSRQKASKGAIPAT 349          
BLAST of APOBEC1 complementation factor vs. Planmine SMEST
Match: SMESG000035182.1 (SMESG000035182.1)

HSP 1 Score: 1181.39 bits (3055), Expect = 0.000e+0
Identity = 563/566 (99.47%), Postives = 565/566 (99.82%), Query Frame = 2
Query:  152 MNHCQPNPLSVIGITETTPVIYESGQRRCGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSKIEQQQKLLKKSTATLTQSLPLLMPTDLNRLSLSSNGPILSNSENHERNAMNSNRSYRNAAGRCSIKSRQMMKNMENSENFYNVINLLAETCQLYGWGAPFYAVQLIPVMLSSSESPVNGFMAQAYIPGLNVHFTGKMPTFSQEESILQSCETALLWLLYSGINIPYLSGDVKNNIQTVKTEIYRKSFSDCETFDNSKNNYYATDSMVHTNGNAIENPSKISTSQSVHYNESNLLCPGVSKSSNKSKTFVETNERVQDNKNRNNYSASTNK 1849
            M+HCQPNPLSVIGITETTPVIYESGQRRCGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSKIEQQQKLLKKSTATLTQSLPLLMPTDL+RLSLSSNGPILSNSENHERNAMNSNRSYRNAAGRCSIKSRQMMKNMENSENFYNVINLLAETCQLYGWG PFYAVQLIPVMLSSSESPVNGFMAQAYIPGLNVHFTGKMPTFSQEESILQSCETALLWLLYSGINIPYLSGDVKNNIQTVKTEIYRKSFSDCETFDNSKNNYYATDSMVHTNGNAIENPSKISTSQSVHYNESNLLCPGVSKSSNKSKTFVETNERVQDNKNRNNYSASTNK
Sbjct:    1 MDHCQPNPLSVIGITETTPVIYESGQRRCGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEIIKVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSKIEQQQKLLKKSTATLTQSLPLLMPTDLSRLSLSSNGPILSNSENHERNAMNSNRSYRNAAGRCSIKSRQMMKNMENSENFYNVINLLAETCQLYGWGTPFYAVQLIPVMLSSSESPVNGFMAQAYIPGLNVHFTGKMPTFSQEESILQSCETALLWLLYSGINIPYLSGDVKNNIQTVKTEIYRKSFSDCETFDNSKNNYYATDSMVHTNGNAIENPSKISTSQSVHYNESNLLCPGVSKSSNKSKTFVETNERVQDNKNRNNYSASTNK 566          
BLAST of APOBEC1 complementation factor vs. Planmine SMEST
Match: SMESG000032489.1 (SMESG000032489.1)

HSP 1 Score: 356.681 bits (914), Expect = 8.992e-114
Identity = 191/421 (45.37%), Postives = 255/421 (60.57%), Query Frame = 2
Query:  206 PVIYESGQRRCGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEII-KVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSKIEQQQKLLKKSTATLTQSLPLLMPT-----DLNRLSLSSNGPILSNSENHERNAMNSNRSYRNAAGRCSIKSRQMMKNMENSENFYNV------INLLAETCQLYGWGAPFYAVQLIPVMLSSSESPVNGFMAQAYIPGLNV 1432
            PV++++G RR GPP +W    P +GCE+FI KIP+D  E +LIPI   IG IY FRLM++    +RG+GFC+Y K E +  AV KLNNY+I+    +GVCFSVDNCRLFVGGIPK KTK EI  EM+  T  +V++I YPS A+K KNRGFAFVEY +HK+AA+AR+K+I   + LWGQ +AVDWAEPER+V + IMS VKILY RNLMLTTTE+T+   F   +  P   I +VKK+ D+AF+HF  R  AE  K  ++   +DGS +EV +AKP  K   +Q  ++ +   L  SL  L  T     D N   LS  GP           AM S  +  N  G  SI+++ + +N   S N  +       I  L E    Y WG P Y      + ++  ++P+  F AQ ++P +N 
Sbjct:   47 PVVHDNGHRRFGPPSDWIGDPPSRGCEVFIGKIPRDCLEDELIPIFETIGLIYEFRLMVDFNGVNRGYGFCVYQKKEDSNRAVEKLNNYEIRPGKTIGVCFSVDNCRLFVGGIPKNKTKEEIFMEMQRVTSGVVNVIAYPSIANKNKNRGFAFVEYESHKSAAVARRKLIPGRIPLWGQQIAVDWAEPEREVHETIMSTVKILYARNLMLTTTEDTLREKFLTASGGPYSCIERVKKMKDYAFIHFTERQYAENAKESLNNSEIDGSIVEVTWAKPADKATTKQNKIQSNLNEL--SLSDLQATTQIYFDPN-TGLSYIGP-----------AMGSWSNSLNILGDPSIRNKPVRRNAAGSRNSNSFKEKKQSIEYLEELANTYNWGMPQYTASASDIDINGVKTPL--FSAQVFLPNINT 451          
BLAST of APOBEC1 complementation factor vs. Planmine SMEST
Match: SMESG000044930.1 (SMESG000044930.1)

HSP 1 Score: 353.984 bits (907), Expect = 2.884e-112
Identity = 163/281 (58.01%), Postives = 208/281 (74.02%), Query Frame = 2
Query:  206 PVIYESGQRRCGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEII-KVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSKIE 1045
            P++ E+GQRR GPP +WK   P +GCE+FI KIP+D FE +L+P+   IG IY FRLMM+   ++RG+GFC+Y   E  K AV +LNN++I+++  LGVC SVDNCRLFVGGIPK KTK EI  EM   TE + D+I YPS ADK KNRGFAFVEY +HKAAA+AR+K+I   +QLWGQ +AVDWAEPER+V ++IMS VKILYVRNLMLTTTEETI   F   +  P + + +VKKI D+AFVHFK+R+ A+     ++   +D S IEV++AKP  K E
Sbjct:   52 PIVQENGQRRYGPPPDWKGFPPRRGCEVFIGKIPRDCFEDELVPVFERIGPIYMFRLMMDFTGTNRGYGFCIYMNREDTKRAVAELNNFEIRRDKPLGVCLSVDNCRLFVGGIPKNKTKEEIFIEMVRVTEGVKDVIAYPSVADKTKNRGFAFVEYESHKAAAMARRKLIPGRIQLWGQQIAVDWAEPEREVNEDIMSTVKILYVRNLMLTTTEETIREKFVACSNGPPDCVERVKKIKDYAFVHFKDRNLADNALKALNNTQIDSSWIEVNWAKPADKTE 332          
BLAST of APOBEC1 complementation factor vs. Planmine SMEST
Match: SMESG000044930.1 (SMESG000044930.1)

HSP 1 Score: 353.984 bits (907), Expect = 3.251e-112
Identity = 163/281 (58.01%), Postives = 208/281 (74.02%), Query Frame = 2
Query:  206 PVIYESGQRRCGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEII-KVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSKIE 1045
            P++ E+GQRR GPP +WK   P +GCE+FI KIP+D FE +L+P+   IG IY FRLMM+   ++RG+GFC+Y   E  K AV +LNN++I+++  LGVC SVDNCRLFVGGIPK KTK EI  EM   TE + D+I YPS ADK KNRGFAFVEY +HKAAA+AR+K+I   +QLWGQ +AVDWAEPER+V ++IMS VKILYVRNLMLTTTEETI   F   +  P + + +VKKI D+AFVHFK+R+ A+     ++   +D S IEV++AKP  K E
Sbjct:   52 PIVQENGQRRYGPPPDWKGFPPRRGCEVFIGKIPRDCFEDELVPVFERIGPIYMFRLMMDFTGTNRGYGFCIYMNREDTKRAVAELNNFEIRRDKPLGVCLSVDNCRLFVGGIPKNKTKEEIFIEMVRVTEGVKDVIAYPSVADKTKNRGFAFVEYESHKAAAMARRKLIPGRIQLWGQQIAVDWAEPEREVNEDIMSTVKILYVRNLMLTTTEETIREKFVACSNGPPDCVERVKKIKDYAFVHFKDRNLADNALKALNNTQIDSSWIEVNWAKPADKTE 332          
BLAST of APOBEC1 complementation factor vs. Planmine SMEST
Match: SMESG000044930.1 (SMESG000044930.1)

HSP 1 Score: 353.599 bits (906), Expect = 6.066e-112
Identity = 163/281 (58.01%), Postives = 208/281 (74.02%), Query Frame = 2
Query:  206 PVIYESGQRRCGPPENWKDSSPGKGCEIFIAKIPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLAVLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTENIVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVAVDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEII-KVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSKIE 1045
            P++ E+GQRR GPP +WK   P +GCE+FI KIP+D FE +L+P+   IG IY FRLMM+   ++RG+GFC+Y   E  K AV +LNN++I+++  LGVC SVDNCRLFVGGIPK KTK EI  EM   TE + D+I YPS ADK KNRGFAFVEY +HKAAA+AR+K+I   +QLWGQ +AVDWAEPER+V ++IMS VKILYVRNLMLTTTEETI   F   +  P + + +VKKI D+AFVHFK+R+ A+     ++   +D S IEV++AKP  K E
Sbjct:   69 PIVQENGQRRYGPPPDWKGFPPRRGCEVFIGKIPRDCFEDELVPVFERIGPIYMFRLMMDFTGTNRGYGFCIYMNREDTKRAVAELNNFEIRRDKPLGVCLSVDNCRLFVGGIPKNKTKEEIFIEMVRVTEGVKDVIAYPSVADKTKNRGFAFVEYESHKAAAMARRKLIPGRIQLWGQQIAVDWAEPEREVNEDIMSTVKILYVRNLMLTTTEETIREKFVACSNGPPDCVERVKKIKDYAFVHFKDRNLADNALKALNNTQIDSSWIEVNWAKPADKTE 349          
The following BLAST results are available for this feature:
BLAST of APOBEC1 complementation factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
A1CF6.426e-10154.68APOBEC1 complementation factor [Source:HGNC Symbol... [more]
A1CF6.426e-10154.68APOBEC1 complementation factor [Source:HGNC Symbol... [more]
A1CF6.426e-10154.68APOBEC1 complementation factor [Source:HGNC Symbol... [more]
A1CF7.566e-10154.68APOBEC1 complementation factor [Source:HGNC Symbol... [more]
A1CF1.786e-10055.27APOBEC1 complementation factor [Source:HGNC Symbol... [more]
back to top
BLAST of APOBEC1 complementation factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hrp-22.917e-5436.61HnRNP A1 homolog [Source:UniProtKB/TrEMBL;Acc:B3K... [more]
hrp-22.917e-5436.61HnRNP A1 homolog [Source:UniProtKB/TrEMBL;Acc:B3K... [more]
ZK616.11.386e-825.00pep chromosome:WBcel235:IV:5402948:5405537:1 gene:... [more]
ZK616.11.386e-825.00pep chromosome:WBcel235:IV:5402938:5405537:1 gene:... [more]
exc-71.746e-627.37pep chromosome:WBcel235:II:9575971:9581490:1 gene:... [more]
back to top
BLAST of APOBEC1 complementation factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Syp6.328e-7541.50gene:FBgn0038826 transcript:FBtr0083961[more]
Syp7.856e-7541.50gene:FBgn0038826 transcript:FBtr0113256[more]
Syp1.163e-7441.50gene:FBgn0038826 transcript:FBtr0083963[more]
Syp1.188e-7441.50gene:FBgn0038826 transcript:FBtr0083958[more]
Syp1.847e-7440.13gene:FBgn0038826 transcript:FBtr0334720[more]
back to top
BLAST of APOBEC1 complementation factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbm478.858e-10650.16RNA binding motif protein 47 [Source:ZFIN;Acc:ZDB-... [more]
a1cf2.806e-9853.82apobec1 complementation factor [Source:ZFIN;Acc:ZD... [more]
a1cf2.806e-9853.82apobec1 complementation factor [Source:ZFIN;Acc:ZD... [more]
rbm464.732e-9654.55RNA binding motif protein 46 [Source:NCBI gene;Acc... [more]
rbm464.809e-9654.55RNA binding motif protein 46 [Source:NCBI gene;Acc... [more]
back to top
BLAST of APOBEC1 complementation factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tom12.298e-10450.00target of myb1 membrane trafficking protein [Sourc... [more]
tom11.875e-10350.00target of myb1 membrane trafficking protein [Sourc... [more]
tom12.130e-10350.00target of myb1 membrane trafficking protein [Sourc... [more]
tom14.633e-10350.00target of myb1 membrane trafficking protein [Sourc... [more]
tom14.761e-10350.00target of myb1 membrane trafficking protein [Sourc... [more]
back to top
BLAST of APOBEC1 complementation factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
A1cf2.100e-9854.68APOBEC1 complementation factor [Source:MGI Symbol;... [more]
A1cf3.683e-9654.68APOBEC1 complementation factor [Source:MGI Symbol;... [more]
Rbm466.837e-9654.55RNA binding motif protein 46 [Source:MGI Symbol;Ac... [more]
A1cf7.166e-9654.68APOBEC1 complementation factor [Source:MGI Symbol;... [more]
Rbm468.393e-9654.55RNA binding motif protein 46 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of APOBEC1 complementation factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9NQ94|A1CF_HUMAN3.634e-10054.68APOBEC1 complementation factor OS=Homo sapiens OX=... [more]
sp|Q5R9H4|A1CF_PONAB4.268e-10054.68APOBEC1 complementation factor OS=Pongo abelii OX=... [more]
sp|Q5YD48|A1CF_MOUSE5.013e-9554.68APOBEC1 complementation factor OS=Mus musculus OX=... [more]
sp|P86049|RBM46_MOUSE5.871e-9554.55Probable RNA-binding protein 46 OS=Mus musculus OX... [more]
sp|Q923K9|A1CF_RAT7.613e-9554.32APOBEC1 complementation factor OS=Rattus norvegicu... [more]
back to top
BLAST of APOBEC1 complementation factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3SKU43.956e-11844.67Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A5K3FHJ49.796e-11844.59Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3TAV71.465e-11644.97Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A0X3PRX02.436e-11543.90APOBEC1 complementation factor OS=Schistocephalus ... [more]
A0A564YY183.112e-11544.12Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
back to top
BLAST of APOBEC1 complementation factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbm475.579e-10550.00RNA binding motif protein 47 [Source:NCBI gene;Acc... [more]
rbm462.821e-10252.52RNA binding motif protein 46 [Source:NCBI gene;Acc... [more]
ENSAMXT00000021508.23.619e-9454.90probable RNA-binding protein 46 [Source:NCBI gene;... [more]
a1cf4.214e-8054.98apobec1 complementation factor [Source:ZFIN;Acc:ZD... [more]
syncripl5.987e-7442.61heterogeneous nuclear ribonucleoprotein Q [Source:... [more]
back to top
BLAST of APOBEC1 complementation factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syncripl2.538e-6742.28synaptotagmin binding, cytoplasmic RNA interacting... [more]
ENSPMAT00000009756.11.761e-6137.59pep scaffold:Pmarinus_7.0:GL478948:7772:26420:1 ge... [more]
ENSPMAT00000003808.14.818e-4745.98pep scaffold:Pmarinus_7.0:GL483076:13225:15644:1 g... [more]
ncl7.385e-830.30nucleolin [Source:ZFIN;Acc:ZDB-GENE-030131-6986][more]
pabpc44.854e-722.58poly(A) binding protein, cytoplasmic 4 (inducible ... [more]
back to top
BLAST of APOBEC1 complementation factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of APOBEC1 complementation factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO465471.883e-10150.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387632.949e-7544.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387343.219e-5438.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449401.251e-928.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384178.860e-728.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of APOBEC1 complementation factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbm473.307e-10651.54RNA binding motif protein 47 [Source:NCBI gene;Acc... [more]
rbm475.774e-10651.54RNA binding motif protein 47 [Source:NCBI gene;Acc... [more]
rbm471.126e-10551.54RNA binding motif protein 47 [Source:NCBI gene;Acc... [more]
rbm471.371e-10551.54RNA binding motif protein 47 [Source:NCBI gene;Acc... [more]
rbm471.371e-10551.54RNA binding motif protein 47 [Source:NCBI gene;Acc... [more]
back to top
BLAST of APOBEC1 complementation factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000035182.10.000e+099.47SMESG000035182.1[more]
SMESG000032489.18.992e-11445.37SMESG000032489.1[more]
SMESG000044930.12.884e-11258.01SMESG000044930.1[more]
SMESG000044930.13.251e-11258.01SMESG000044930.1[more]
SMESG000044930.16.066e-11258.01SMESG000044930.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002858 ID=SMED30002858|Name=APOBEC1 complementation factor|organism=Schmidtea mediterranea sexual|type=transcript|length=1996bp
TGGAGTTGCATGTATGTATATTAGAATTGTGAACCATAACAGATACAGAT
CTTGAACTTTGATCGGTTCTGTCTCGTCATTTCATCTGTCTCATCTATTG
TATTGAATTCTATGAAGTTATTGATTGTTCACTCATAATCATCTTTTAAT
TATGAATCATTGTCAGCCAAATCCATTATCAGTGATCGGGATCACAGAAA
CTACACCCGTAATCTATGAATCCGGTCAAAGACGATGTGGGCCACCAGAA
AATTGGAAAGATTCTTCACCGGGAAAAGGCTGTGAAATATTTATCGCTAA
AATTCCGAAAGACTTTTTTGAAAAAGATCTCATTCCGATTTTACGAGAGA
TTGGTGATATTTACACTTTTCGTTTGATGATGGAGACTGAATTCAGTCAT
CGGGGATTTGGGTTTTGTCTCTATACGAAACATGAAACCGCAAAACTTGC
CGTATTGAAGCTAAATAATTATCAAATTAAAAAGAATTGGTATCTAGGAG
TTTGTTTTAGTGTGGATAACTGTCGATTATTTGTTGGAGGCATACCAAAA
TTGAAAACTAAACTTGAAATCCAAGAGGAAATGAGACATTTCACGGAGAA
TATTGTGGATATTATAGTGTATCCTAGTGCTGCGGATAAGCAAAAAAATA
GAGGTTTTGCATTTGTGGAATATACCAATCATAAAGCAGCCGCTATTGCT
CGAAAGAAAATGATTTCAGAAAGCGTTCAGTTATGGGGTCAGACAGTTGC
TGTTGATTGGGCAGAACCAGAAAGAAAAGTTGAAGACGAAATAATGTCTA
AGGTAAAGATCCTCTATGTTCGAAATCTAATGCTTACAACAACGGAAGAA
ACGATTTATCGCGTATTTTCACAGTATACAGAAGATCCACAAGAAATTAT
CAAAGTGAAAAAGATCGGAGATTTTGCCTTTGTACATTTTAAAAATCGAG
ATAAAGCTGAAATTGTTAAAAATCAGATGCATGGTATGAATCTTGATGGT
AGTACAATAGAAGTACATTTTGCTAAACCTGTAAGTAAAATAGAACAGCA
GCAAAAGCTTTTGAAGAAATCCACGGCAACTCTCACTCAGTCTCTACCGC
TTCTTATGCCAACGGATCTAAACCGGTTGTCCCTCAGTTCGAATGGGCCA
ATATTGTCAAATTCAGAAAACCATGAAAGAAATGCAATGAACTCTAACAG
ATCTTACAGAAATGCAGCAGGTCGGTGCAGTATCAAATCTAGGCAAATGA
TGAAAAATATGGAAAATAGCGAGAATTTTTACAATGTCATTAATCTACTA
GCCGAAACATGCCAGCTGTATGGGTGGGGGGCACCATTTTATGCAGTTCA
GTTGATACCAGTGATGCTATCAAGCAGTGAGAGCCCAGTTAATGGATTTA
TGGCACAAGCTTATATTCCCGGATTAAATGTTCATTTTACTGGTAAAATG
CCTACATTTTCACAAGAAGAGTCAATTTTGCAATCTTGTGAAACTGCACT
TCTATGGTTGTTATATAGTGGAATCAACATTCCTTATTTATCAGGTGACG
TGAAAAATAATATTCAAACAGTCAAAACAGAAATTTATAGAAAAAGCTTT
TCTGATTGTGAGACTTTTGATAATTCTAAGAATAATTATTACGCAACGGA
TTCCATGGTTCATACCAACGGAAATGCAATAGAAAATCCTTCCAAGATTT
CTACATCTCAATCAGTCCATTATAACGAAAGTAATCTTTTATGCCCAGGT
GTTTCTAAATCATCAAATAAATCGAAAACATTTGTGGAGACTAATGAAAG
GGTTCAGGACAATAAAAATCGGAACAACTATTCAGCATCGACAAACAAAA
AAATTGTTGAAAAATTCCAATCGCAATAAATGAGAAATTATGAATTTGTA
ATAAATTCCAATATTCGTGTTAATGCTTACAAAACATTATTTTAAATCAA
AGTATTGTTTATTCGATGACTATTTGTAAATAGTTAATTTGATTAT
back to top

protein sequence of SMED30002858-orf-1

>SMED30002858-orf-1 ID=SMED30002858-orf-1|Name=SMED30002858-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=576bp
MNHCQPNPLSVIGITETTPVIYESGQRRCGPPENWKDSSPGKGCEIFIAK
IPKDFFEKDLIPILREIGDIYTFRLMMETEFSHRGFGFCLYTKHETAKLA
VLKLNNYQIKKNWYLGVCFSVDNCRLFVGGIPKLKTKLEIQEEMRHFTEN
IVDIIVYPSAADKQKNRGFAFVEYTNHKAAAIARKKMISESVQLWGQTVA
VDWAEPERKVEDEIMSKVKILYVRNLMLTTTEETIYRVFSQYTEDPQEII
KVKKIGDFAFVHFKNRDKAEIVKNQMHGMNLDGSTIEVHFAKPVSKIEQQ
QKLLKKSTATLTQSLPLLMPTDLNRLSLSSNGPILSNSENHERNAMNSNR
SYRNAAGRCSIKSRQMMKNMENSENFYNVINLLAETCQLYGWGAPFYAVQ
LIPVMLSSSESPVNGFMAQAYIPGLNVHFTGKMPTFSQEESILQSCETAL
LWLLYSGINIPYLSGDVKNNIQTVKTEIYRKSFSDCETFDNSKNNYYATD
SMVHTNGNAIENPSKISTSQSVHYNESNLLCPGVSKSSNKSKTFVETNER
VQDNKNRNNYSASTNKKIVEKFQSQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
GO:0003727single-stranded RNA binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: biological process
TermDefinition
GO:0016556mRNA modification
Vocabulary: cellular component
TermDefinition
GO:0030895apolipoprotein B mRNA editing enzyme complex