RING-type domain-containing protein

Overview
NameRING-type domain-containing protein
Smed IDSMED30002822
Length (bp)547
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RING-type domain-containing protein (SMED30002822) t-SNE clustered cells

Violin plots show distribution of expression levels for RING-type domain-containing protein (SMED30002822) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RING-type domain-containing protein (SMED30002822) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RING-type domain-containing protein (SMED30002822) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002822

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 31

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30002822SMESG000076482.1 SMESG000076410.1 SMESG000076223.1 SMESG000040665.1 PL08008B2E11ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30002822SMESG000076385.1 SMESG000076375.1 SMESG000076363.1 SMESG000076223.1 SMESG000076482.1 SMESG000076470.1 SMESG000076410.1 SMESG000076358.1 Contig1645GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30002822SMESG000076385.1 SMESG000076375.1 SMESG000076363.1 SMESG000076223.1 SMESG000076482.1 SMESG000076470.1 SMESG000076410.1 SMESG000076358.1 Contig1645GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30002822SMESG000076385.1 SMESG000076375.1 SMESG000076363.1 SMESG000076223.1 SMESG000076482.1 SMESG000076470.1 SMESG000076410.1 SMESG000076358.1 Contig1645GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30002822SMESG000076385.1 SMESG000076375.1 SMESG000076363.1 SMESG000076223.1 SMESG000076482.1 SMESG000076470.1 SMESG000076410.1 SMESG000076358.1 Contig1645GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30002822SMESG000076482.1 SMESG000076470.1 SMESG000076469.1 SMESG000076410.1 SMESG000076409.1 SMESG000076408.1 SMESG000076407.1 SMESG000076406.1 SMESG000076390.1 SMESG000076389.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 dd_Smed_v4_645_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30002822SMESG000076482.1 SMESG000076470.1 SMESG000076469.1 SMESG000076410.1 SMESG000076409.1 SMESG000076408.1 SMESG000076407.1 SMESG000076406.1 SMESG000076390.1 SMESG000076389.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 dd_Smed_v4_645_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30002822SMESG000076482.1 SMESG000076470.1 SMESG000076469.1 SMESG000076410.1 SMESG000076409.1 SMESG000076408.1 SMESG000076407.1 SMESG000076406.1 SMESG000076390.1 SMESG000076389.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 dd_Smed_v4_645_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002822SMESG000076482.1 SMESG000076470.1 SMESG000076469.1 SMESG000076410.1 SMESG000076409.1 SMESG000076408.1 SMESG000076407.1 SMESG000076406.1 SMESG000076390.1 SMESG000076389.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 dd_Smed_v4_645_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002822SMESG000076482.1 SMESG000076470.1 SMESG000076469.1 SMESG000076410.1 SMESG000076409.1 SMESG000076408.1 SMESG000076407.1 SMESG000076406.1 SMESG000076390.1 SMESG000076389.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 dd_Smed_v4_645_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002822SMESG000076482.1 SMESG000076470.1 SMESG000076469.1 SMESG000076410.1 SMESG000076409.1 SMESG000076408.1 SMESG000076407.1 SMESG000076406.1 SMESG000076390.1 SMESG000076389.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 dd_Smed_v4_645_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30002822SMESG000076482.1 SMESG000076470.1 SMESG000076469.1 SMESG000076410.1 SMESG000076409.1 SMESG000076408.1 SMESG000076407.1 SMESG000076406.1 SMESG000076390.1 SMESG000076389.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 dd_Smed_v4_645_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002822SMESG000076482.1 SMESG000076470.1 SMESG000076469.1 SMESG000076410.1 SMESG000076409.1 SMESG000076408.1 SMESG000076407.1 SMESG000076406.1 SMESG000076390.1 SMESG000076389.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 dd_Smed_v4_645_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002822SMESG000076410.1 SMESG000076408.1 SMESG000076406.1 SMESG000076389.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076369.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 Contig14133newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002822SMESG000076410.1 SMESG000076408.1 SMESG000076406.1 SMESG000076389.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076369.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 Contig14133uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002822SMESG000076482.1 SMESG000076469.1 SMESG000076410.1 SMESG000076409.1 SMESG000076408.1 SMESG000076407.1 SMESG000076406.1 SMESG000076390.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076369.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 Contig5395uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002822SMESG000076482.1 SMESG000076469.1 SMESG000076410.1 SMESG000076409.1 SMESG000076408.1 SMESG000076407.1 SMESG000076406.1 SMESG000076390.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076369.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 Contig5395newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002822SMESG000076410.1 SMESG000076408.1 SMESG000076406.1 SMESG000076389.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076369.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 Contig14877newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002822SMESG000076410.1 SMESG000076408.1 SMESG000076406.1 SMESG000076389.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076369.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 Contig14877uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002822SMESG000076482.1 SMESG000076410.1 SMESG000076408.1 SMESG000076405.1 SMESG000076390.1 SMESG000076389.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076369.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 Contig20188newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002822SMESG000076482.1 SMESG000076410.1 SMESG000076408.1 SMESG000076405.1 SMESG000076390.1 SMESG000076389.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076369.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 Contig20188uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002822SMESG000076482.1 SMESG000076410.1 SMESG000076408.1 SMESG000076406.1 SMESG000076389.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076369.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 Contig46004newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002822SMESG000076482.1 SMESG000076410.1 SMESG000076408.1 SMESG000076406.1 SMESG000076389.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076369.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 Contig46004uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002822SMESG000072849.1 Contig5395uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002822SMESG000072849.1 Contig5395newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30002822SMESG000076482.1 SMESG000076470.1 SMESG000076469.1 SMESG000076410.1 SMESG000076409.1 SMESG000076408.1 SMESG000076407.1 SMESG000076406.1 SMESG000076390.1 SMESG000076389.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076369.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 dd_Smed_v6_645_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002822SMESG000076482.1 SMESG000076470.1 SMESG000076469.1 SMESG000076410.1 SMESG000076409.1 SMESG000076408.1 SMESG000076407.1 SMESG000076406.1 SMESG000076390.1 SMESG000076389.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076369.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 dd_Smed_v6_645_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30002822SMESG000076482.1 SMESG000076470.1 SMESG000076469.1 SMESG000076410.1 SMESG000076409.1 SMESG000076408.1 SMESG000076407.1 SMESG000076406.1 SMESG000076390.1 SMESG000076389.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076369.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 dd_Smed_v6_645_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002822SMESG000076482.1 SMESG000076470.1 SMESG000076469.1 SMESG000076410.1 SMESG000076409.1 SMESG000076408.1 SMESG000076407.1 SMESG000076406.1 SMESG000076390.1 SMESG000076389.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076369.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 dd_Smed_v6_645_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002822SMESG000076482.1 SMESG000076470.1 SMESG000076469.1 SMESG000076410.1 SMESG000076409.1 SMESG000076408.1 SMESG000076407.1 SMESG000076406.1 SMESG000076390.1 SMESG000076389.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 dd_Smed_v4_645_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30002822SMESG000076482.1 SMESG000076470.1 SMESG000076469.1 SMESG000076410.1 SMESG000076409.1 SMESG000076408.1 SMESG000076407.1 SMESG000076406.1 SMESG000076390.1 SMESG000076389.1 SMESG000076385.1 SMESG000076375.1 SMESG000076371.1 SMESG000076363.1 SMESG000076358.1 SMESG000076223.1 SMESG000040665.1 dd_Smed_v4_645_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: MIB2 (mindbomb E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:30577])

HSP 1 Score: 53.1434 bits (126), Expect = 6.048e-8
Identity = 20/47 (42.55%), Postives = 26/47 (55.32%), Query Frame = 3
Query:  288 RNLCNICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIY 428
            R  C IC+D+ + +  QCGH  C  C   L  CP+C   I DR QI+
Sbjct:  958 RITCPICIDSHIRLVFQCGHGACAPCGSALSACPICRQPIRDRIQIF 1004          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: MIB2 (mindbomb E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:30577])

HSP 1 Score: 53.1434 bits (126), Expect = 6.083e-8
Identity = 20/47 (42.55%), Postives = 26/47 (55.32%), Query Frame = 3
Query:  288 RNLCNICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIY 428
            R  C IC+D+ + +  QCGH  C  C   L  CP+C   I DR QI+
Sbjct: 1009 RITCPICIDSHIRLVFQCGHGACAPCGSALSACPICRQPIRDRIQIF 1055          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: MIB2 (mindbomb E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:30577])

HSP 1 Score: 53.1434 bits (126), Expect = 6.089e-8
Identity = 20/47 (42.55%), Postives = 26/47 (55.32%), Query Frame = 3
Query:  288 RNLCNICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIY 428
            R  C IC+D+ + +  QCGH  C  C   L  CP+C   I DR QI+
Sbjct: 1019 RITCPICIDSHIRLVFQCGHGACAPCGSALSACPICRQPIRDRIQIF 1065          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: MIB2 (mindbomb E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:30577])

HSP 1 Score: 53.1434 bits (126), Expect = 6.092e-8
Identity = 20/47 (42.55%), Postives = 26/47 (55.32%), Query Frame = 3
Query:  288 RNLCNICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIY 428
            R  C IC+D+ + +  QCGH  C  C   L  CP+C   I DR QI+
Sbjct: 1023 RITCPICIDSHIRLVFQCGHGACAPCGSALSACPICRQPIRDRIQIF 1069          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: MIB2 (mindbomb E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:30577])

HSP 1 Score: 52.7582 bits (125), Expect = 6.874e-8
Identity = 20/47 (42.55%), Postives = 26/47 (55.32%), Query Frame = 3
Query:  288 RNLCNICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIY 428
            R  C IC+D+ + +  QCGH  C  C   L  CP+C   I DR QI+
Sbjct:  922 RITCPICIDSHIRLVFQCGHGACAPCGSALSACPICRQPIRDRIQIF 968          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:ZFIN;Acc:ZDB-GENE-050628-1])

HSP 1 Score: 49.6766 bits (117), Expect = 5.338e-7
Identity = 20/47 (42.55%), Postives = 28/47 (59.57%), Query Frame = 3
Query:  288 RNLCNICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIY 428
            R  C IC+DN + +  QCGH  C +CS  L  CP+C   I +R Q++
Sbjct:  842 RITCPICIDNHIRLVFQCGHASCIDCSSALKTCPICRQTIRERIQLF 888          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 46.9802 bits (110), Expect = 5.359e-6
Identity = 17/47 (36.17%), Postives = 26/47 (55.32%), Query Frame = 3
Query:  288 RNLCNICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIY 428
            + +C +C+D L N+   CGH  C  C D++  CP+C   I  R  +Y
Sbjct:  995 QTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1041          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 46.595 bits (109), Expect = 5.880e-6
Identity = 17/47 (36.17%), Postives = 26/47 (55.32%), Query Frame = 3
Query:  288 RNLCNICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIY 428
            + +C +C+D L N+   CGH  C  C D++  CP+C   I  R  +Y
Sbjct:  984 QTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1030          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 46.595 bits (109), Expect = 5.941e-6
Identity = 17/47 (36.17%), Postives = 26/47 (55.32%), Query Frame = 3
Query:  288 RNLCNICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIY 428
            + +C +C+D L N+   CGH  C  C D++  CP+C   I  R  +Y
Sbjct:  992 QTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1038          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: coa7 (cytochrome c oxidase assembly factor 7 (putative) [Source:Xenbase;Acc:XB-GENE-6258829])

HSP 1 Score: 52.7582 bits (125), Expect = 8.099e-8
Identity = 21/47 (44.68%), Postives = 27/47 (57.45%), Query Frame = 3
Query:  288 RNLCNICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIY 428
            R  C IC+DN + +  QCGH  C  CS  L  CP+C   I +R QI+
Sbjct:  901 RITCPICIDNHIKLVFQCGHGSCTECSTSLTACPICRQLIRERIQIF 947          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: coa7 (cytochrome c oxidase assembly factor 7 (putative) [Source:Xenbase;Acc:XB-GENE-6258829])

HSP 1 Score: 52.7582 bits (125), Expect = 8.102e-8
Identity = 21/47 (44.68%), Postives = 27/47 (57.45%), Query Frame = 3
Query:  288 RNLCNICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIY 428
            R  C IC+DN + +  QCGH  C  CS  L  CP+C   I +R QI+
Sbjct:  904 RITCPICIDNHIKLVFQCGHGSCTECSTSLTACPICRQLIRERIQIF 950          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: coa7 (cytochrome c oxidase assembly factor 7 (putative) [Source:Xenbase;Acc:XB-GENE-6258829])

HSP 1 Score: 52.7582 bits (125), Expect = 8.113e-8
Identity = 21/47 (44.68%), Postives = 27/47 (57.45%), Query Frame = 3
Query:  288 RNLCNICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIY 428
            R  C IC+DN + +  QCGH  C  CS  L  CP+C   I +R QI+
Sbjct:  914 RITCPICIDNHIKLVFQCGHGSCTECSTSLTACPICRQLIRERIQIF 960          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: coa7 (cytochrome c oxidase assembly factor 7 (putative) [Source:Xenbase;Acc:XB-GENE-6258829])

HSP 1 Score: 52.7582 bits (125), Expect = 8.148e-8
Identity = 21/47 (44.68%), Postives = 27/47 (57.45%), Query Frame = 3
Query:  288 RNLCNICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIY 428
            R  C IC+DN + +  QCGH  C  CS  L  CP+C   I +R QI+
Sbjct:  876 RITCPICIDNHIKLVFQCGHGSCTECSTSLTACPICRQLIRERIQIF 922          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: coa7 (cytochrome c oxidase assembly factor 7 (putative) [Source:Xenbase;Acc:XB-GENE-6258829])

HSP 1 Score: 52.373 bits (124), Expect = 8.258e-8
Identity = 21/47 (44.68%), Postives = 27/47 (57.45%), Query Frame = 3
Query:  288 RNLCNICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIY 428
            R  C IC+DN + +  QCGH  C  CS  L  CP+C   I +R QI+
Sbjct:  905 RITCPICIDNHIKLVFQCGHGSCTECSTSLTACPICRQLIRERIQIF 951          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:MGI Symbol;Acc:MGI:2679684])

HSP 1 Score: 51.6026 bits (122), Expect = 1.196e-7
Identity = 20/47 (42.55%), Postives = 26/47 (55.32%), Query Frame = 3
Query:  288 RNLCNICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIY 428
            R  C IC+D+ + +  QCGH  C  C   L  CP+C   I DR QI+
Sbjct:  874 RITCPICIDSHIRLVFQCGHGACAPCGAALNACPICRQPIRDRIQIF 920          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5ZIJ9|MIB2_CHICK (E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus OX=9031 GN=MIB2 PE=2 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 1.976e-7
Identity = 21/47 (44.68%), Postives = 29/47 (61.70%), Query Frame = 3
Query:  288 RNLCNICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIY 428
            R  C IC+D+ + +  QCGH  C +CS  L VCP+C   I +R QI+
Sbjct:  907 RITCPICIDDQIKLVFQCGHGSCPDCSTALTVCPICRQAIRERIQIF 953          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q96AX9|MIB2_HUMAN (E3 ubiquitin-protein ligase MIB2 OS=Homo sapiens OX=9606 GN=MIB2 PE=1 SV=3)

HSP 1 Score: 53.1434 bits (126), Expect = 2.907e-7
Identity = 20/47 (42.55%), Postives = 26/47 (55.32%), Query Frame = 3
Query:  288 RNLCNICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIY 428
            R  C IC+D+ + +  QCGH  C  C   L  CP+C   I DR QI+
Sbjct:  966 RITCPICIDSHIRLVFQCGHGACAPCGSALSACPICRQPIRDRIQIF 1012          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9SAL0|RGLG4_ARATH (E3 ubiquitin-protein ligase RGLG4 OS=Arabidopsis thaliana OX=3702 GN=RGLG4 PE=1 SV=1)

HSP 1 Score: 52.7582 bits (125), Expect = 3.349e-7
Identity = 18/44 (40.91%), Postives = 29/44 (65.91%), Query Frame = 3
Query:  297 CNICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIY 428
            C IC+ N  ++A  CGH+ CG+C  ++  CP+C   IT+R ++Y
Sbjct:  357 CPICLTNRKDVAFSCGHMTCGDCGSKISNCPICRVRITNRLKLY 400          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8R516|MIB2_MOUSE (E3 ubiquitin-protein ligase MIB2 OS=Mus musculus OX=10090 GN=Mib2 PE=1 SV=2)

HSP 1 Score: 51.9878 bits (123), Expect = 7.450e-7
Identity = 20/47 (42.55%), Postives = 26/47 (55.32%), Query Frame = 3
Query:  288 RNLCNICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIY 428
            R  C IC+D+ + +  QCGH  C  C   L  CP+C   I DR QI+
Sbjct:  926 RITCPICIDSHIRLVFQCGHGACAPCGAALNACPICRQPIRDRIQIF 972          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q68LP1|MIB2_RAT (E3 ubiquitin-protein ligase MIB2 OS=Rattus norvegicus OX=10116 GN=Mib2 PE=1 SV=2)

HSP 1 Score: 51.9878 bits (123), Expect = 7.590e-7
Identity = 20/47 (42.55%), Postives = 26/47 (55.32%), Query Frame = 3
Query:  288 RNLCNICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIY 428
            R  C IC+D+ + +  QCGH  C  C   L  CP+C   I DR QI+
Sbjct:  924 RITCPICIDSHIRLVFQCGHGACAPCGAALNACPICRQPIRDRIQIF 970          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A0A9IHX1 (RING-type domain-containing protein OS=Arundo donax OX=35708 PE=4 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 3.455e-6
Identity = 22/45 (48.89%), Postives = 28/45 (62.22%), Query Frame = 3
Query:  294 LCNICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIY 428
            +C IC+ N  ++A QCGHL C  C   L  CPLC A IT R ++Y
Sbjct:  120 VCPICLTNPKDMAFQCGHLTCKECGPTLSTCPLCRAPITMRVRLY 164          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A452GYQ1 (Mindbomb E3 ubiquitin protein ligase 2 OS=Gopherus agassizii OX=38772 GN=MIB2 PE=4 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 3.468e-6
Identity = 23/47 (48.94%), Postives = 29/47 (61.70%), Query Frame = 3
Query:  288 RNLCNICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIY 428
            R  C IC+DN + +  QCGH  C  CS+ L VCP+C   I DR QI+
Sbjct:  907 RITCPICIDNQIKLVFQCGHGSCLECSEALTVCPICRQTIRDRIQIF 953          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: R7UQ79 (RING-type domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_125132 PE=4 SV=1)

HSP 1 Score: 51.9878 bits (123), Expect = 6.399e-6
Identity = 23/47 (48.94%), Postives = 32/47 (68.09%), Query Frame = 3
Query:  297 CNICMDNLVNIAL-QCGHLLCGNCSDQLFVCPLCNAEITDRTQIYFN 434
            C +C +  VNI L +CGHLLC +C+ Q+  CPLC   I DR Q++F+
Sbjct:   15 CKVCWNREVNIILVKCGHLLCEDCAPQVEDCPLCKKRIEDRIQVWFS 61          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A2D0QZU2 (E3 ubiquitin-protein ligase MIB2 isoform X2 OS=Ictalurus punctatus OX=7998 GN=mib2 PE=4 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 9.018e-6
Identity = 28/88 (31.82%), Postives = 43/88 (48.86%), Query Frame = 3
Query:  171 QGQRTIDACIDSNAKAE--IEEFYRKIHXXXXXXXXXXXXXRNLCNICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIY 428
            Q Q  +D+  +S +  +  + E YRK+ +            R  C IC+DN + +  QCGH  C  CS  L  CP+C   I +R Q++
Sbjct:  926 QDQTEVDSSPNSESSEQHHLLERYRKMEE------------RITCPICIDNYIKLVFQCGHASCMECSSALKTCPICRQSIRERIQLF 1001          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: W5UEF4 (E3 ubiquitin-protein ligase MIB2 OS=Ictalurus punctatus OX=7998 GN=MIB2 PE=2 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 9.825e-6
Identity = 28/88 (31.82%), Postives = 43/88 (48.86%), Query Frame = 3
Query:  171 QGQRTIDACIDSNAKAE--IEEFYRKIHXXXXXXXXXXXXXRNLCNICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIY 428
            Q Q  +D+  +S +  +  + E YRK+ +            R  C IC+DN + +  QCGH  C  CS  L  CP+C   I +R Q++
Sbjct:  928 QDQTEVDSSPNSESSEQHHLLERYRKMEE------------RITCPICIDNYIKLVFQCGHASCMECSSALKTCPICRQSIRERIQLF 1003          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:103034310])

HSP 1 Score: 52.7582 bits (125), Expect = 4.547e-8
Identity = 20/47 (42.55%), Postives = 28/47 (59.57%), Query Frame = 3
Query:  288 RNLCNICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIY 428
            R  C IC+DN + +  QCGH  C +CS  L  CP+C   I +R Q++
Sbjct:  970 RITCPICIDNQIKLVFQCGHASCIDCSAALKTCPICRQTIRERIQLF 1016          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:103034310])

HSP 1 Score: 52.7582 bits (125), Expect = 4.862e-8
Identity = 20/47 (42.55%), Postives = 28/47 (59.57%), Query Frame = 3
Query:  288 RNLCNICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIY 428
            R  C IC+DN + +  QCGH  C +CS  L  CP+C   I +R Q++
Sbjct:  900 RITCPICIDNQIKLVFQCGHASCIDCSAALKTCPICRQTIRERIQLF 946          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:103034310])

HSP 1 Score: 52.7582 bits (125), Expect = 4.901e-8
Identity = 20/47 (42.55%), Postives = 28/47 (59.57%), Query Frame = 3
Query:  288 RNLCNICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIY 428
            R  C IC+DN + +  QCGH  C +CS  L  CP+C   I +R Q++
Sbjct:  964 RITCPICIDNQIKLVFQCGHASCIDCSAALKTCPICRQTIRERIQLF 1010          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 46.595 bits (109), Expect = 5.017e-6
Identity = 17/47 (36.17%), Postives = 26/47 (55.32%), Query Frame = 3
Query:  288 RNLCNICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIY 428
            + +C +C+D L N+   CGH  C  C D++  CP+C   I  R  +Y
Sbjct:  960 QTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1006          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 46.595 bits (109), Expect = 5.076e-6
Identity = 17/47 (36.17%), Postives = 26/47 (55.32%), Query Frame = 3
Query:  288 RNLCNICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIY 428
            + +C +C+D L N+   CGH  C  C D++  CP+C   I  R  +Y
Sbjct:  981 QTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1027          
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Match: EDO44591 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV74])

HSP 1 Score: 45.4394 bits (106), Expect = 4.014e-6
Identity = 20/46 (43.48%), Postives = 32/46 (69.57%), Query Frame = 3
Query:  297 CNICMDNLVN-IALQCGHLL-CGNCSDQLFVCPLCNAEITDRTQIY 428
            C +CMDNL++ + L+CGH++ C NCS QL  CP+C   I+   +++
Sbjct:  256 CKVCMDNLIDCVLLECGHMVACINCSKQLAECPICRQNISRIVRVF 301          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:101175479])

HSP 1 Score: 51.9878 bits (123), Expect = 7.099e-8
Identity = 20/47 (42.55%), Postives = 27/47 (57.45%), Query Frame = 3
Query:  288 RNLCNICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIY 428
            R  C IC+DN + +  QCGH  C  CS  L  CP+C   I +R Q++
Sbjct: 1037 RITCPICIDNHIKLVFQCGHASCIECSAALKTCPICRQTIRERIQLF 1083          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:101175479])

HSP 1 Score: 51.9878 bits (123), Expect = 8.056e-8
Identity = 20/47 (42.55%), Postives = 27/47 (57.45%), Query Frame = 3
Query:  288 RNLCNICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIY 428
            R  C IC+DN + +  QCGH  C  CS  L  CP+C   I +R Q++
Sbjct:  981 RITCPICIDNHIKLVFQCGHASCIECSAALKTCPICRQTIRERIQLF 1027          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:101158637])

HSP 1 Score: 46.595 bits (109), Expect = 5.041e-6
Identity = 17/47 (36.17%), Postives = 26/47 (55.32%), Query Frame = 3
Query:  288 RNLCNICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIY 428
            + +C +C+D L N+   CGH  C  C D++  CP+C   I  R  +Y
Sbjct:  974 QTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1020          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000076385.1 (SMESG000076385.1)

HSP 1 Score: 251.906 bits (642), Expect = 2.655e-81
Identity = 136/144 (94.44%), Postives = 137/144 (95.14%), Query Frame = 3
Query:    3 IDESGEFNSENADGQTTLFQLLGKISISKAPHLKRKVILLIRSIIVLGGDIYQVTSQGQRTIDACIDSNAKAEIEEFYRKIHXXXXXXXXXXXXXRNLCNICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIYFN 434
            I ESGEFNSENADGQTTLFQLLGKISIS APHLKRKVILLIRSIIVLGGDIYQVTSQGQRTIDACIDS AKAEIEEFY KIHKDMKEEKNENDKE NLC ICMDNLVNIALQCGHLLCGNCSDQLF+CPLCNAEITDR QIYFN
Sbjct:  435 IHESGEFNSENADGQTTLFQLLGKISISTAPHLKRKVILLIRSIIVLGGDIYQVTSQGQRTIDACIDSKAKAEIEEFYTKIHKDMKEEKNENDKETNLCKICMDNLVNIALQCGHLLCGNCSDQLFICPLCNAEITDRIQIYFN 578          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000076385.1 (SMESG000076385.1)

HSP 1 Score: 251.906 bits (642), Expect = 4.997e-81
Identity = 136/144 (94.44%), Postives = 137/144 (95.14%), Query Frame = 3
Query:    3 IDESGEFNSENADGQTTLFQLLGKISISKAPHLKRKVILLIRSIIVLGGDIYQVTSQGQRTIDACIDSNAKAEIEEFYRKIHXXXXXXXXXXXXXRNLCNICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIYFN 434
            I ESGEFNSENADGQTTLFQLLGKISIS APHLKRKVILLIRSIIVLGGDIYQVTSQGQRTIDACIDS AKAEIEEFY KIHKDMKEEKNENDKE NLC ICMDNLVNIALQCGHLLCGNCSDQLF+CPLCNAEITDR QIYFN
Sbjct:  464 IHESGEFNSENADGQTTLFQLLGKISISTAPHLKRKVILLIRSIIVLGGDIYQVTSQGQRTIDACIDSKAKAEIEEFYTKIHKDMKEEKNENDKETNLCKICMDNLVNIALQCGHLLCGNCSDQLFICPLCNAEITDRIQIYFN 607          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000076369.1 (SMESG000076369.1)

HSP 1 Score: 246.514 bits (628), Expect = 8.330e-81
Identity = 132/144 (91.67%), Postives = 137/144 (95.14%), Query Frame = 3
Query:    3 IDESGEFNSENADGQTTLFQLLGKISISKAPHLKRKVILLIRSIIVLGGDIYQVTSQGQRTIDACIDSNAKAEIEEFYRKIHXXXXXXXXXXXXXRNLCNICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIYFN 434
            I ESGEFN+E A+G+TTL QLLGKISIS APHLKRKVILLIRSIIVLGGDIYQVTSQGQRTIDACIDS AKAEIEEFYRKIHKDMKEEKNENDKERNLCNICMDNLVNIALQCGHLLCGNCSDQLF+CPLCNAEITDR  +YFN
Sbjct:  287 IHESGEFNTEKANGKTTLIQLLGKISISTAPHLKRKVILLIRSIIVLGGDIYQVTSQGQRTIDACIDSKAKAEIEEFYRKIHKDMKEEKNENDKERNLCNICMDNLVNIALQCGHLLCGNCSDQLFICPLCNAEITDRIHLYFN 430          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000076410.1 (SMESG000076410.1)

HSP 1 Score: 251.136 bits (640), Expect = 2.008e-80
Identity = 133/144 (92.36%), Postives = 138/144 (95.83%), Query Frame = 3
Query:    3 IDESGEFNSENADGQTTLFQLLGKISISKAPHLKRKVILLIRSIIVLGGDIYQVTSQGQRTIDACIDSNAKAEIEEFYRKIHXXXXXXXXXXXXXRNLCNICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIYFN 434
            I ESGEFN+E ADG+TTL QLLGKISIS APHLKRKVILLIRSIIVLGGDIYQVTSQGQRTID+C DSNAKAEIEEFYRKIHKDMKEEKNENDK+RNLCNICMDNLVNIALQCGHLLCGNCSDQLF+CPLCNAEITDR QIYFN
Sbjct:  499 IHESGEFNTEKADGKTTLIQLLGKISISTAPHLKRKVILLIRSIIVLGGDIYQVTSQGQRTIDSCTDSNAKAEIEEFYRKIHKDMKEEKNENDKDRNLCNICMDNLVNIALQCGHLLCGNCSDQLFICPLCNAEITDRIQIYFN 642          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000076385.1 (SMESG000076385.1)

HSP 1 Score: 251.136 bits (640), Expect = 2.074e-80
Identity = 136/144 (94.44%), Postives = 137/144 (95.14%), Query Frame = 3
Query:    3 IDESGEFNSENADGQTTLFQLLGKISISKAPHLKRKVILLIRSIIVLGGDIYQVTSQGQRTIDACIDSNAKAEIEEFYRKIHXXXXXXXXXXXXXRNLCNICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIYFN 434
            I ESGEFNSENADGQTTLFQLLGKISIS APHLKRKVILLIRSIIVLGGDIYQVTSQGQRTIDACIDS AKAEIEEFY KIHKDMKEEKNENDKE NLC ICMDNLVNIALQCGHLLCGNCSDQLF+CPLCNAEITDR QIYFN
Sbjct:  499 IHESGEFNSENADGQTTLFQLLGKISISTAPHLKRKVILLIRSIIVLGGDIYQVTSQGQRTIDACIDSKAKAEIEEFYTKIHKDMKEEKNENDKETNLCKICMDNLVNIALQCGHLLCGNCSDQLFICPLCNAEITDRIQIYFN 642          
The following BLAST results are available for this feature:
BLAST of RING-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MIB26.048e-842.55mindbomb E3 ubiquitin protein ligase 2 [Source:HGN... [more]
MIB26.083e-842.55mindbomb E3 ubiquitin protein ligase 2 [Source:HGN... [more]
MIB26.089e-842.55mindbomb E3 ubiquitin protein ligase 2 [Source:HGN... [more]
MIB26.092e-842.55mindbomb E3 ubiquitin protein ligase 2 [Source:HGN... [more]
MIB26.874e-842.55mindbomb E3 ubiquitin protein ligase 2 [Source:HGN... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mib25.338e-742.55mindbomb E3 ubiquitin protein ligase 2 [Source:ZFI... [more]
mib15.359e-636.17mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib15.880e-636.17mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib15.941e-636.17mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
coa78.099e-844.68cytochrome c oxidase assembly factor 7 (putative) ... [more]
coa78.102e-844.68cytochrome c oxidase assembly factor 7 (putative) ... [more]
coa78.113e-844.68cytochrome c oxidase assembly factor 7 (putative) ... [more]
coa78.148e-844.68cytochrome c oxidase assembly factor 7 (putative) ... [more]
coa78.258e-844.68cytochrome c oxidase assembly factor 7 (putative) ... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Mib21.196e-742.55mindbomb E3 ubiquitin protein ligase 2 [Source:MGI... [more]
back to top
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5ZIJ9|MIB2_CHICK1.976e-744.68E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus ... [more]
sp|Q96AX9|MIB2_HUMAN2.907e-742.55E3 ubiquitin-protein ligase MIB2 OS=Homo sapiens O... [more]
sp|Q9SAL0|RGLG4_ARATH3.349e-740.91E3 ubiquitin-protein ligase RGLG4 OS=Arabidopsis t... [more]
sp|Q8R516|MIB2_MOUSE7.450e-742.55E3 ubiquitin-protein ligase MIB2 OS=Mus musculus O... [more]
sp|Q68LP1|MIB2_RAT7.590e-742.55E3 ubiquitin-protein ligase MIB2 OS=Rattus norvegi... [more]
back to top
BLAST of RING-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0A9IHX13.455e-648.89RING-type domain-containing protein OS=Arundo dona... [more]
A0A452GYQ13.468e-648.94Mindbomb E3 ubiquitin protein ligase 2 OS=Gopherus... [more]
R7UQ796.399e-648.94RING-type domain-containing protein OS=Capitella t... [more]
A0A2D0QZU29.018e-631.82E3 ubiquitin-protein ligase MIB2 isoform X2 OS=Ict... [more]
W5UEF49.825e-631.82E3 ubiquitin-protein ligase MIB2 OS=Ictalurus punc... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mib24.547e-842.55mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib24.862e-842.55mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib24.901e-842.55mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib15.017e-636.17mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib15.076e-636.17mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO445914.014e-643.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mib27.099e-842.55mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib28.056e-842.55mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib15.041e-636.17mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
back to top
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000076385.12.655e-8194.44SMESG000076385.1[more]
SMESG000076385.14.997e-8194.44SMESG000076385.1[more]
SMESG000076369.18.330e-8191.67SMESG000076369.1[more]
SMESG000076410.12.008e-8092.36SMESG000076410.1[more]
SMESG000076385.12.074e-8094.44SMESG000076385.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002822 ID=SMED30002822|Name=RING-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=547bp
TGATTGATGAATCCGGGGAATTCAATAGTGAAAATGCTGATGGCCAAACC
ACATTATTCCAATTATTGGGGAAAATATCGATTTCAAAAGCACCACATTT
GAAAAGAAAAGTCATTTTATTAATTAGATCAATAATCGTTTTGGGTGGAG
ACATTTACCAAGTAACATCTCAAGGTCAACGGACAATTGACGCATGCATT
GACTCCAATGCCAAGGCAGAAATTGAGGAATTTTACAGGAAAATCCACAA
AGATATGAAAGAAGAGAAAAATGAAAATGATAAAGAGAGAAATCTATGCA
ACATTTGCATGGACAATCTCGTGAATATTGCTCTTCAATGTGGGCATTTG
CTTTGCGGCAATTGTTCCGATCAATTATTCGTTTGTCCTCTTTGTAACGC
TGAGATCACTGATCGGACCCAGATCTATTTCAACTGAATCTGAGGATTTT
TATTCAACTTTACTGCTAATTCTGACATTTGATTGCTCTATATAATAAAT
ATTATATTGCTGCTTTATCAATACATTTTTTTATATTCAAAAGATCG
back to top

protein sequence of SMED30002822-orf-1

>SMED30002822-orf-1 ID=SMED30002822-orf-1|Name=SMED30002822-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=145bp
IDESGEFNSENADGQTTLFQLLGKISISKAPHLKRKVILLIRSIIVLGGD
IYQVTSQGQRTIDACIDSNAKAEIEEFYRKIHKDMKEEKNENDKERNLCN
ICMDNLVNIALQCGHLLCGNCSDQLFVCPLCNAEITDRTQIYFN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001841Znf_RING
IPR013083Znf_RING/FYVE/PHD
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
GO:0016874ligase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0016567protein ubiquitination