G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30002809
Length (bp)1426
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30002809) t-SNE clustered cells

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30002809) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30002809) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30002809) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002809

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30002809SMESG000042142.1 SmedASXL_003371SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30002809SMESG000042142.1 dd_Smed_v4_17288_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30002809SMESG000042142.1 dd_Smed_v6_17288_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: GHSR (growth hormone secretagogue receptor [Source:HGNC Symbol;Acc:HGNC:4267])

HSP 1 Score: 50.8322 bits (120), Expect = 3.263e-6
Identity = 52/196 (26.53%), Postives = 84/196 (42.86%), Query Frame = 1
Query:  268 NLTMSELPAYRRRLFNILVKKIPG---------KLITECIFHNWLWMLIPIFIVAMGSIGNFLSAVVLCRKSMSHISSYIYLATLAIFDELILLC---GLFRKWIEHVTDWSLENHSISFCKLFQVIGVSSSFISVWLIVTLTVERVLIIKRPFEXXXXXXXXXXXXIIVSLIIISFTTSCHFFETVTLQNLNHKN 819
            N T SE P +   L ++     PG         +L    +        + +F+V  G  GN L+ +V+ R      ++ +YL+++A  D LI LC    L R W      W   N     CKLFQ +  S ++ +V  I  L+VER   I  P  A       R K +I  +  ++F ++   F  V +++ N  +
Sbjct:    3 NATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVV--GIAGNLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLW--QYRPW---NFGDLLCKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFVLVGVEHENGTD 191          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: GHSR (growth hormone secretagogue receptor [Source:HGNC Symbol;Acc:HGNC:4267])

HSP 1 Score: 50.0618 bits (118), Expect = 3.763e-6
Identity = 52/197 (26.40%), Postives = 85/197 (43.15%), Query Frame = 1
Query:  265 FNLTMSELPAYRRRLFNILVKKIPG---------KLITECIFHNWLWMLIPIFIVAMGSIGNFLSAVVLCRKSMSHISSYIYLATLAIFDELILLC---GLFRKWIEHVTDWSLENHSISFCKLFQVIGVSSSFISVWLIVTLTVERVLIIKRPFEXXXXXXXXXXXXIIVSLIIISFTTSCHFFETVTLQNLNHKN 819
            +N T SE P +   L ++     PG         +L    +        + +F+V  G  GN L+ +V+ R      ++ +YL+++A  D LI LC    L R W      W   N     CKLFQ +  S ++ +V  I  L+VER   I  P  A       R K +I  +  ++F ++   F  V +++ N  +
Sbjct:    2 WNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVV--GIAGNLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLW--QYRPW---NFGDLLCKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFVLVGVEHENGTD 191          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: CNMaR (gene:FBgn0053696 transcript:FBtr0091684)

HSP 1 Score: 65.4698 bits (158), Expect = 4.271e-11
Identity = 40/105 (38.10%), Postives = 56/105 (53.33%), Query Frame = 1
Query:  385 IPIFIVAMGSIGNFLSAVVLCRKSMSHISSYIYLATLAIFDELILLCGLFRKWIEHV-TDWSLENHSISFCKLFQVIGVSSSFISVWLIVTLTVERVLIIKRPFE 696
            IP+ +   GSIGN LS  V  R  +  +SS  YLA LA+ D    L GLF +W+  +  D   +N+   FC+ F      +SF SVW +V  TVER + +  P +
Sbjct:   66 IPV-LCCTGSIGNILSVFVFFRTKLRKLSSSFYLAALAVSDT-CFLAGLFAQWLNFLNVDIYNQNY---FCQFFTFFSYLASFCSVWFVVAFTVERFIAVIYPLK 165          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: CapaR (gene:FBgn0037100 transcript:FBtr0333458)

HSP 1 Score: 58.9214 bits (141), Expect = 2.781e-9
Identity = 44/138 (31.88%), Postives = 69/138 (50.00%), Query Frame = 1
Query:  415 IGNFLSAVVLCRKSMSHISSYIYLATLAIFDELILLCGL----FRKWIEHVTDWSLENHSISFCKLFQVIGVSSSFISVWLIVTLTVERVLIIKRPFEXXXXXXXXXXXXIIVSLIIISFTTSCHFFETVTLQNLNHK 816
            +GN L  +V+ R S  H ++  YL +LA+ D L LL GL    F  W ++   + +      FCK+   I  + +++SV+ IV  ++ER L I  P          RA  II +L I+SF ++  F     +Q LN+ 
Sbjct:   84 VGNLLVCIVIIRHSAMHTATNYYLFSLAVSDLLYLLFGLPTEVFLYWHQYPDLFGMP-----FCKIRAFISEACTYVSVFTIVAFSMERFLAICHPLHLYAMVGFKRAIRIITALWIVSFISAIPFGLLSDIQYLNYP 216          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: CapaR (gene:FBgn0037100 transcript:FBtr0078379)

HSP 1 Score: 59.3066 bits (142), Expect = 3.922e-9
Identity = 44/138 (31.88%), Postives = 69/138 (50.00%), Query Frame = 1
Query:  415 IGNFLSAVVLCRKSMSHISSYIYLATLAIFDELILLCGL----FRKWIEHVTDWSLENHSISFCKLFQVIGVSSSFISVWLIVTLTVERVLIIKRPFEXXXXXXXXXXXXIIVSLIIISFTTSCHFFETVTLQNLNHK 816
            +GN L  +V+ R S  H ++  YL +LA+ D L LL GL    F  W ++   + +      FCK+   I  + +++SV+ IV  ++ER L I  P          RA  II +L I+SF ++  F     +Q LN+ 
Sbjct:   84 VGNLLVCIVIIRHSAMHTATNYYLFSLAVSDLLYLLFGLPTEVFLYWHQYPDLFGMP-----FCKIRAFISEACTYVSVFTIVAFSMERFLAICHPLHLYAMVGFKRAIRIITALWIVSFISAIPFGLLSDIQYLNYP 216          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: ghsra (growth hormone secretagogue receptor a [Source:ZFIN;Acc:ZDB-GENE-070912-238])

HSP 1 Score: 50.447 bits (119), Expect = 2.330e-6
Identity = 40/141 (28.37%), Postives = 69/141 (48.94%), Query Frame = 1
Query:  406 MGSIGNFLSAVVLCRKSMSHISSYIYLATLAIFDELILLC---GLFRKWIEHVTDWSLENHSISFCKLFQVIGVSSSFISVWLIVTLTVERVLIIKRPFEXXXXXXXXXXXXIIVSLIIISFTTSCHFFETVTLQNLNHKN 819
            +G  GN ++ +V+ +      ++ +YL+++A  D LI LC    L+R W      W+  N     CKLFQ +    ++ ++  I  L+VER   I  P  A       R + +I+ L I+SF ++   F  V +++ N  N
Sbjct:   50 VGVTGNLMTILVVTKYKDMRTTTNLYLSSMAFSDLLIFLCMPLDLYRIW--RYRPWNFGNI---LCKLFQFVSECCTYSTILNITALSVERYFAICFPLRAKVVVTKGRVRGVILVLWIVSFFSAGPVFVLVGVEHENGTN 185          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: ghsrb (growth hormone secretagogue receptor b [Source:ZFIN;Acc:ZDB-GENE-090327-1])

HSP 1 Score: 49.6766 bits (117), Expect = 4.273e-6
Identity = 41/145 (28.28%), Postives = 69/145 (47.59%), Query Frame = 1
Query:  394 FIVAMGSIGNFLSAVVLCRKSMSHISSYIYLATLAIFDELILLC---GLFRKWIEHVTDWSLENHSISFCKLFQVIGVSSSFISVWLIVTLTVERVLIIKRPFEXXXXXXXXXXXXIIVSLIIISFTTSCHFFETVTLQNLNHKN 819
            F+  +G  GN L+ +V+ +      ++ +YL ++A+ D LI LC    L+R W      W   N     CKLFQ +  S ++ ++  I  L+VER   I  P  A       R K +I+ L  ++  ++   F  V +++ N  N
Sbjct:   51 FLFLVGIAGNLLTILVVTKYKDMRTTTNLYLCSMALSDLLIFLCMPLDLYRVW--RYRPW---NFGDELCKLFQFVSESCTYSTILNITALSVERYFAICFPLRAKVIVTRGRVKGVILLLWTVALCSAGPIFILVGVEHENGTN 190          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Match: GHSR (growth hormone secretagogue receptor [Source:NCBI gene;Acc:100497774])

HSP 1 Score: 50.8322 bits (120), Expect = 3.020e-6
Identity = 44/151 (29.14%), Postives = 74/151 (49.01%), Query Frame = 1
Query:  391 IFIVAMGSIGNFLSAVVLCRKSMSHISSYIYLATLAIFDELILLC---GLFRKWIEHVTDWSLENHSISFCKLFQVIGVSSSFISVWLIVTLTVERVLIIKRPFEXXXXXXXXXXXXIIVSLIIISFTTSCHFFETVTLQNLNHKN-VNTN 831
            I +  +G  GN ++ +V+ +      ++ +YL+++A  D LI LC    L+R W      W   N   S CKLFQ +    ++ ++  I  L+VER   I  P +A       R K +I  L  +SF ++   F  V +++ N  N ++TN
Sbjct:   49 ILLFIIGISGNVMTMLVVSKYKDMRTTTNLYLSSMAFSDLLIFLCMPLDLYRLW--QYRPW---NFGSSLCKLFQFVSECCTYSTILNITALSVERYFAICFPLKAKVVITKGRVKLVISVLWAVSFVSAGPIFVLVGVEHENGTNPLDTN 194          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Ghsr (growth hormone secretagogue receptor [Source:MGI Symbol;Acc:MGI:2441906])

HSP 1 Score: 50.0618 bits (118), Expect = 4.136e-6
Identity = 42/148 (28.38%), Postives = 71/148 (47.97%), Query Frame = 1
Query:  385 IPIFIVAMGSIGNFLSAVVLCRKSMSHISSYIYLATLAIFDELILLC---GLFRKWIEHVTDWSLENHSISFCKLFQVIGVSSSFISVWLIVTLTVERVLIIKRPFEXXXXXXXXXXXXIIVSLIIISFTTSCHFFETVTLQNLNHKN 819
            + +F+V +   GN L+ +V+ R      ++ +YL+++A  D LI LC    L R W      W   N     CKLFQ +  S ++ +V  I  L+VER   I  P  A       R K +I+ +  ++F ++   F  V +++ N  +
Sbjct:   50 VALFVVGIS--GNLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLW--QYRPW---NFGDLLCKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVILVIWAVAFCSAGPIFVLVGVEHENGTD 190          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8ITC7|CAPAR_DROME (Neuropeptides capa receptor OS=Drosophila melanogaster OX=7227 GN=CapaR PE=2 SV=3)

HSP 1 Score: 59.3066 bits (142), Expect = 3.931e-8
Identity = 44/138 (31.88%), Postives = 69/138 (50.00%), Query Frame = 1
Query:  415 IGNFLSAVVLCRKSMSHISSYIYLATLAIFDELILLCGL----FRKWIEHVTDWSLENHSISFCKLFQVIGVSSSFISVWLIVTLTVERVLIIKRPFEXXXXXXXXXXXXIIVSLIIISFTTSCHFFETVTLQNLNHK 816
            +GN L  +V+ R S  H ++  YL +LA+ D L LL GL    F  W ++   + +      FCK+   I  + +++SV+ IV  ++ER L I  P          RA  II +L I+SF ++  F     +Q LN+ 
Sbjct:   84 VGNLLVCIVIIRHSAMHTATNYYLFSLAVSDLLYLLFGLPTEVFLYWHQYPDLFGMP-----FCKIRAFISEACTYVSVFTIVAFSMERFLAICHPLHLYAMVGFKRAIRIITALWIVSFISAIPFGLLSDIQYLNYP 216          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q95254|GHSR_PIG (Growth hormone secretagogue receptor type 1 OS=Sus scrofa OX=9823 GN=GHSR PE=2 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 3.058e-7
Identity = 45/148 (30.41%), Postives = 74/148 (50.00%), Query Frame = 1
Query:  385 IPIFIVAMGSIGNFLSAVVLCRKSMSHISSYIYLATLAIFDELILLC---GLFRKWIEHVTDWSLENHSISFCKLFQVIGVSSSFISVWLIVTLTVERVLIIKRPFEXXXXXXXXXXXXIIVSLIIISFTTSCHFFETVTLQNLNHKN 819
            + +F+V  G  GN L+ +V+ R      ++ +YL+++A  D LI LC    LFR W      W+L N     CKLFQ +  S ++ +V  I  L+VER   I  P  A       R K +I+ +  ++F ++   F  V +++ N  +
Sbjct:   51 VALFVV--GIAGNLLTMLVVSRFREMRTTTNLYLSSMAFSDLLIFLCMPLDLFRLW--QYRPWNLGNL---LCKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVILVIWAVAFCSAGPIFVLVGVEHDNGTD 191          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|A5A4K9|GHSR_RABIT (Growth hormone secretagogue receptor type 1 OS=Oryctolagus cuniculus OX=9986 GN=GHSR PE=2 SV=1)

HSP 1 Score: 51.9878 bits (123), Expect = 5.973e-6
Identity = 53/191 (27.75%), Postives = 86/191 (45.03%), Query Frame = 1
Query:  268 NLTMSEL----PAYRRRLFNILVKKIPGKLITECIFHNWLWMLIPIFIVAMGSIGNFLSAVVLCRKSMSHISSYIYLATLAIFDELILLC---GLFRKWIEHVTDWSLENHSISFCKLFQVIGVSSSFISVWLIVTLTVERVLIIKRPFEXXXXXXXXXXXXIIVSLIIISFTTSCHFFETVTLQNLNHKN 819
            NLT +EL    P     L + L++  P  L+            + +F+V  G  GN L+ +V+ R      ++ +YL+++A  D LI LC    L R W      W   N     CKLFQ +  S ++ +V  I  L+VER   I  P  A       R K +I+ +  ++F ++   F  V +++ N  +
Sbjct:   13 NLTRAELGWDAPPGNDSLADELLQLFPAPLLAGVTA-----TCVALFVV--GIAGNLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLW--QYRPW---NFGDLLCKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVILVIWALAFCSAGPIFVLVGVEHENGTD 191          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A2T7NJU4 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_19599 PE=3 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 1.500e-40
Identity = 91/278 (32.73%), Postives = 157/278 (56.47%), Query Frame = 1
Query:  370 WLWMLIPIFIVAMGSIGNFLSAVVLCRKSMSHISSYIYLATLAIFDELILLCGLFRKWIEHVTDWSLENHSISFCKLFQVIGVSSSFISVWLIVTLTVERVLIIKRPFEXXXXXXXXXXXXIIVSLIIISFTTSCHFFETVTLQNLNHKNVNTNFSSDKGSNSIKKCQFKTEYTKFT-NAWFFIDGAFYSWXXXXXXXXXXXXXXSEIYKAR----NIHNSMINTNHDENKTLGTSIVRTQLPRRMKESSSRNRETKQLTVMLLIVSFSFLITTSPLS 1188
            +L + IP  ++ +G+ GN +S +VL R++MS +SSY+YLA+LAI D L+L  GL R W++ +T  + +++S   CK+   +G  +S +SVWLI+ +TVER +++  P  A      +RAK +I+ ++ +    + HFF TV L                 S++I  C+    Y     + W ++D   YS++P  ++++ N++I++E+ +AR    N+ N M + ++ + K L      T         S  + E  +LTVMLL VSF+FL+TT P++
Sbjct:   21 YLLVYIPPVLIILGTFGNVVSFIVLRRRAMSKVSSYLYLASLAIADSLVLYIGLLRLWLDELTGVNFQDNSEWLCKVTMFLGYLASDLSVWLIIAVTVERYIVVCFPLRAFTMCNTNRAKLVIIFIVFLICCMNMHFFWTVGL-----------VERATDSDNITICEAAPAYNHLVDDVWPWVDACVYSFLPFVIILVCNVLIITEVVEARAHRLNLQN-MPDYHYHQQKQLQHRTSTTGTAISGCRRSCASGEGTKLTVMLLTVSFTFLLTTLPMN 286          

HSP 2 Score: 68.5514 bits (166), Expect = 1.500e-40
Identity = 30/50 (60.00%), Postives = 40/50 (80.00%), Query Frame = 3
Query: 1224 NGDRKLAQLVLLDGIFEMLMYVNHAINFYLYCATGNKFRQQLIKILFCRR 1373
            +G R++AQL L   I E+LMYVNH+INF+LYCATG KFRQQ+  ++ CR+
Sbjct:  300 HGIRQIAQLKLAKTIAELLMYVNHSINFFLYCATGQKFRQQIAHLMCCRK 349          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A2T7NJT6 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_19600 PE=3 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 4.449e-39
Identity = 109/349 (31.23%), Postives = 176/349 (50.43%), Query Frame = 1
Query:  175 LCSELDHPMAETFMHLLSL-----NDSMLINYDSRFNLTMSELPAY--RRRLFNILVKKIPGKLITECIFHNWLWMLIPIFIVAMGSIGNFLSAVVLCRKSMSHISSYIYLATLAIFDELILLCGLFRKWIEHVTDWSLENHSISFCKLFQVIGVSSSFISVWLIVTLTVERVLIIKRPFEXXXXXXXXXXXXIIVSLIIISFTTSCHFFETVTLQNLNHKNVNTNFSSDKGSNSIKKCQFKTEYTKFTNA-WFFIDGAFYSWXXXXXXXXXXXXXXSEIYKARNIHNSMINTN----HDENKTLGTSIVRTQLPRRMKESSSRNRETKQLTVMLLIVSFSFLITTSPL 1185
            LCS + H  A +   LL++     ND + I  DS    + SEL +Y  +R   N   +      + E     +L   +P  ++ +G++GN +S +VL R++M  +SSY+YLA+LA+ D L+L  GL R W+  + +    N S   CKL    G  +S +SVW+I+ +TVER +++  P  A      +RAK +I  + ++ F  + HFF TV+L               + SN++  CQ    +    +  W ++D  FYS++P   ++I N++I+SE+ KAR    ++ + N    H +          T          S   E  +LTVMLL VSF+FL+TT P+
Sbjct:    3 LCSRMVHEGA-SLADLLTMLQGISNDDLQILLDSEGISSESELLSYLQKRSGANRSFETTVIAAMPEDQARKFLLTYVPPVLIVLGTLGNIVSFIVLRRRAMCKVSSYLYLASLAVADSLVLYIGLLRLWLIELIEVDFHNSSDWVCKLMVSFGYIASDLSVWMIIAVTVERYIVVCFPLRACTMCNTNRAKVVICFIALLIFCINIHFFWTVSLV--------------EDSNNVTNCQATPSHIYLVDEIWPWVDACFYSFLPFVTILILNILIISEVVKARTHRQNLQSMNEYHYHQQRPQRPQQRRSTAATVFGCRRFSSPGEGTKLTVMLLTVSFTFLLTTLPM 336          

HSP 2 Score: 65.4698 bits (158), Expect = 4.449e-39
Identity = 29/67 (43.28%), Postives = 46/67 (68.66%), Query Frame = 3
Query: 1173 NVSFVILKLLIKLKGYPNGDRKLAQLVLLDGIFEMLMYVNHAINFYLYCATGNKFRQQLIKILFCRR 1373
            N+S ++     + K   + +R++AQ  L   I E+LMYVNH+INF+LYCATG KFR+Q+ +++ C +
Sbjct:  337 NISLIVTAFWNQQK---HSERQMAQFNLAKTITELLMYVNHSINFFLYCATGQKFRKQIAELICCSK 400          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: H2KNW0 (G-protein coupled receptor OS=Clonorchis sinensis OX=79923 GN=CLF_100861 PE=4 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 4.402e-38
Identity = 116/360 (32.22%), Postives = 184/360 (51.11%), Query Frame = 1
Query:  169 AGLCSELDHPMAETFMHLLSLNDSMLINYDSRFNLTMSELPAYRRRLFNILVKKIPGKLITECIFHNWLWMLIPIFIVAMGSIGNFLSAVVLCRKSMSHISSYIYLATLAIFDELILLCGLFRKWIEHVTDWSLENHSISFCKLFQVIGVSSSFISVWLIVTLTVERVLIIKRPFEXXXXXXXXXXXXIIVSLIIISFTTSCHFFETVTLQNLNHKN----VNTNFSS--DKGSN-------SIKK----------CQFKTEYTKFTNAWFFIDGAFYSWXXXXXXXXXXXXXXSEIYKARNIHNSMINTNHDENKTLGTSIVRTQLPRRMKESS-SRNRETKQLTVMLLIVSFSFLITT 1176
            A +CS++D  + +    L  +  +     D  F   +S+ P     +  ++++K PG  +T C  H++LW  +P  +  +GS+GN L+ +VL   +  H+S ++YL   ++ DE++L+ GL R+WI+++    LEN S  FCKL Q +G SSS +SVWL V LT ER L++  P + ++    ++ +  IV L ++    S HFF TV L +LN +N    V  N SS  D+GS+       S+K           C F  E       W  +D   Y ++P  L+   N++IL  +Y A           H +        +R Q P R+K  S   +   +QLT+ML +VSFSFL+TT
Sbjct:    3 ADVCSKIDLNVVKAAERLRQIMQA----EDGNFVPNLSQTP--DDLIKTVIMRKSPGVFLTTCKIHHFLWTFVPPIVFLLGSLGNTLAFLVLRHPATRHVSVFVYLTARSVVDEIVLIVGLLRRWIDYLVGTKLENTSAIFCKLAQFLGTSSSLLSVWLTVLLTAERALVVTFPLQGNRLVTFAKVRRAIVFLSVVCVAISMHFFFTVDLVHLNAENCVLRVEMNGSSMLDEGSHEFLLNITSLKGKSTKSVCDGHCSFPDEMATMRWLWTTVDAIIYCYLPFCLIFSLNIVILHYVYAA-----------HKDQYG-----IRAQ-PERLKSGSLGVDNNIRQLTIMLQVVSFSFLVTT 339          

HSP 2 Score: 62.003 bits (149), Expect = 1.713e-6
Identity = 34/78 (43.59%), Postives = 50/78 (64.10%), Query Frame = 3
Query: 1149 SFFFLSNHNVSFVILKLLIKLKGYPN--GDRKLAQLVLLDGIFEMLMYVNHAINFYLYCATGNKFRQQLIKILF-CRR 1373
            SF FL    VS V++K LI++    +    +  A   L D + E+LMY+NHA+NFYL+CATG +FR +L+ +L  C+R
Sbjct:  332 SFSFLVT-TVSIVVMKTLIQVPAMKSVTSVQNKAAFQLADTVAELLMYINHAMNFYLFCATGKRFRSRLVFLLMKCKR 408          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A4S2KQC3 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010711 PE=4 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 4.962e-38
Identity = 118/360 (32.78%), Postives = 182/360 (50.56%), Query Frame = 1
Query:  169 AGLCSELDHPMAETFMHLLSLNDSMLINYDSRFNLTMSELPAYRRRLFNILVKKIPGKLITECIFHNWLWMLIPIFIVAMGSIGNFLSAVVLCRKSMSHISSYIYLATLAIFDELILLCGLFRKWIEHVTDWSLENHSISFCKLFQVIGVSSSFISVWLIVTLTVERVLIIKRPFEXXXXXXXXXXXXIIVSLIIISFTTSCHFFETVTLQNLNHKN----VNTNFSS--DKGSN-------SIKK----------CQFKTEYTKFTNAWFFIDGAFYSWXXXXXXXXXXXXXXSEIYKARNIHNSMINTNHDENKTLGTSIVRTQLPRRMKESS-SRNRETKQLTVMLLIVSFSFLITT 1176
            A +CS++D  + +    L      ML   DS F  + S+ P     +  ++++K PG  +T C  H++LW  +P  +  +GS+GN L+ +VL   +  H+S ++YL   ++ DE++L  GL R+WI+++    LEN S  FCKL Q +G SSS +SVWL V LT ER L++  P + ++    ++ +  IV L ++    S HFF TV L +LN +N    V  N SS  D GS+       S+K           C F          W  +D   Y ++P  L+   N++IL  +Y A           H +        +R Q P R+K  S   +   +QLT+ML +VSFSFL+TT
Sbjct:    3 ADVCSKIDLNVVKAVERL----RQMLQAEDSTFVPSFSQTP--DDLIKTVIMRKSPGVFLTTCKIHHFLWTFVPPIVFLLGSLGNTLAFLVLRHPATRHVSVFVYLTARSVVDEIVLTVGLLRRWIDYLVGTKLENTSAIFCKLAQFLGTSSSLLSVWLTVLLTAERALVVTFPLQGNRLVTFAKVRRAIVFLSVVCVAVSMHFFFTVDLVHLNAENCVLRVEMNGSSMLDDGSHEFLFNITSLKGKSAKSVCDGHCSFPDGMATMRWLWTTVDAIIYCYLPFCLIFSLNIVILHYVYAA-----------HKDQYG-----IRAQ-PERLKSGSLGVDNNIRQLTIMLQVVSFSFLVTT 339          

HSP 2 Score: 60.4622 bits (145), Expect = 5.120e-6
Identity = 33/78 (42.31%), Postives = 49/78 (62.82%), Query Frame = 3
Query: 1149 SFFFLSNHNVSFVILKLLIKLKGYPN--GDRKLAQLVLLDGIFEMLMYVNHAINFYLYCATGNKFRQQLIKILF-CRR 1373
            SF FL    VS V++K L ++    +    +  A   L D + E+LMY+NHA+NFYL+CATG +FR +L+ +L  C+R
Sbjct:  332 SFSFLVT-TVSIVVMKTLTQVPAMKSVTSVQTKAAFQLADTVAELLMYINHAMNFYLFCATGKRFRSRLVFLLMKCKR 408          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A1S8WXZ4 (7 transmembrane receptor OS=Opisthorchis viverrini OX=6198 GN=X801_04808 PE=4 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 1.278e-35
Identity = 114/360 (31.67%), Postives = 180/360 (50.00%), Query Frame = 1
Query:  169 AGLCSELDHPMAETFMHLLSLNDSMLINYDSRFNLTMSELPAYRRRLFNILVKKIPGKLITECIFHNWLWMLIPIFIVAMGSIGNFLSAVVLCRKSMSHISSYIYLATLAIFDELILLCGLFRKWIEHVTDWSLENHSISFCKLFQVIGVSSSFISVWLIVTLTVERVLIIKRPFEXXXXXXXXXXXXIIVSLIIISFTTSCHFFETVTLQNLNHKN----VNTNFSS--DKGSN-------SIKK----------CQFKTEYTKFTNAWFFIDGAFYSWXXXXXXXXXXXXXXSEIYKARNIHNSMINTNHDENKTLGTSIVRTQLPRRMKESS-SRNRETKQLTVMLLIVSFSFLITT 1176
            A +CS++D  + +    L      M+   DS F    S+ P     +  ++++K PG  +T C  +++LW  +P  +  +GS+GN L+ +VL   +  H+S ++YL   ++ DE++L  GL R+WI+++    LEN S  FCKL Q +G SSS +SVWL V LT ER L++  P + ++    ++ +  I+ L ++    S HFF TV L   N +N    V  N SS  D+GS+       S+K           C F          W  +D   Y ++P  L+   N++IL  +Y A           H +        +R Q P R+K  S   +   +QLT+ML +VSFSFL+TT
Sbjct:    3 ADVCSKIDLNVVKAVERL----RQMMQAEDSTFVPNFSQTP--DDLIKTVIMRKSPGVFLTTCKIYHFLWTFVPPIVFLLGSLGNTLAFLVLRHPATRHVSVFVYLTARSVVDEIVLTVGLLRRWIDYLVGTKLENTSAIFCKLAQFLGTSSSLLSVWLTVLLTAERALVVTFPLQGNRLVTFAKVRRAIIFLSVVCVAISMHFFFTVDLVQRNAENCVLRVEMNGSSPLDEGSHEFLFNITSLKGKSSKSVCDGHCSFPDGMATMRWLWTTVDAIIYCYLPFCLIFSLNIVILHYVYAA-----------HKDQYG-----IRAQ-PERLKSGSLGVDNNIRQLTIMLQVVSFSFLVTT 339          

HSP 2 Score: 62.003 bits (149), Expect = 1.597e-6
Identity = 34/78 (43.59%), Postives = 50/78 (64.10%), Query Frame = 3
Query: 1149 SFFFLSNHNVSFVILKLLIKLKGYPN--GDRKLAQLVLLDGIFEMLMYVNHAINFYLYCATGNKFRQQLIKILF-CRR 1373
            SF FL    VS V++K LI++    +    +  A   L D + E+LMY+NHA+NFYL+CATG +FR +L+ +L  C+R
Sbjct:  332 SFSFLVT-TVSIVVMKTLIQVPAMKSVTSVQTKAAFQLADTVAELLMYINHAMNFYLFCATGKRFRSRLVFLLMKCKR 408          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Match: mlnr (motilin receptor [Source:ZFIN;Acc:ZDB-GENE-130530-1015])

HSP 1 Score: 47.7506 bits (112), Expect = 2.645e-6
Identity = 43/180 (23.89%), Postives = 80/180 (44.44%), Query Frame = 1
Query:  391 IFIVAMGSIGNFLSAVVLCRKSMSHISSYIYLATLAIFDELILLC---GLFRKWIEHVTDWSLENHSISFCKLFQVIGVSSSFISVWLIVTLTVERVLIIKRPFEXXXXXXXXXXXXIIVSLIIISFTTSCHFFETVTLQNLNHKNVNTNFSSDKGSNSIKKCQFKTEYTKFTNAWFFID 921
            + + A G +GN ++  V  R      ++Y+YL+++A+ D LI  C    L+R W      W   +     C+ FQ +  S ++ ++  I  L+VER L I  P  A       R + +I+ L  ++  ++      V++Q    + V       K ++  +K       T  + A+FF+ 
Sbjct:   51 VLLFAFGVLGNSMTIAVFSRTHEMRTTTYLYLSSMAVSDLLIFSCMPFDLYRLW--RYRPWLFGDF---LCRCFQYVSESCTYATILHITALSVERYLAICFPLWAKVAITRRRVRALILGLWALALGSAGPVISIVSVQVEKREPVC------KVTDEARKSGRLEIITWMSTAYFFLP 219          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: ghsrb (growth hormone secretagogue receptor type 1 [Source:NCBI gene;Acc:101167158])

HSP 1 Score: 51.2174 bits (121), Expect = 1.661e-6
Identity = 39/135 (28.89%), Postives = 66/135 (48.89%), Query Frame = 1
Query:  406 MGSIGNFLSAVVLCRKSMSHISSYIYLATLAIFDELILLC---GLFRKWIEHVTDWSLENHSISFCKLFQVIGVSSSFISVWLIVTLTVERVLIIKRPFEXXXXXXXXXXXXIIVSLIIISFTTSCHFFETVTLQ 801
            +G  GN ++ +V+ R      ++ +YL ++A+ D LI LC    L+R W      W L +   + CKLFQ +  S ++ ++  I  L+VER L I  P  A       R + +I  L  +S  ++   F  V ++
Sbjct:   80 VGVTGNVMTILVVGRYRDMRTTTNLYLCSMAVSDLLIFLCMPLDLYRMW--RYRPWRLGD---ALCKLFQFVSESCTYSTILSITALSVERYLAICFPLRAKALVTKRRVRALICFLWTVSLLSAGPVFVMVGVE 209          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000042142.1 (SMESG000042142.1)

HSP 1 Score: 632.869 bits (1631), Expect = 0.000e+0
Identity = 339/339 (100.00%), Postives = 339/339 (100.00%), Query Frame = 1
Query:  166 MAGLCSELDHPMAETFMHLLSLNDSMLINYDSRFNLTMSELPAYRRRLFNILVKKIPGKLITECIFHNWLWMLIPIFIVAMGSIGNFLSAVVLCRKSMSHISSYIYLATLAIFDELILLCGLFRKWIEHVTDWSLENHSISFCKLFQVIGVSSSFISVWLIVTLTVERVLIIKRPFEXXXXXXXXXXXXIIVSLIIISFTTSCHFFETVTLQNLNHKNVNTNFSSDKGSNSIKKCQFKTEYTKFTNAWFFIDGAFYSWXXXXXXXXXXXXXXSEIYKARNIHNSMINTNHDENKTLGTSIVRTQLPRRMKESSSRNRETKQLTVMLLIVSFSFLITTSP 1182
            MAGLCSELDHPMAETFMHLLSLNDSMLINYDSRFNLTMSELPAYRRRLFNILVKKIPGKLITECIFHNWLWMLIPIFIVAMGSIGNFLSAVVLCRKSMSHISSYIYLATLAIFDELILLCGLFRKWIEHVTDWSLENHSISFCKLFQVIGVSSSFISVWLIVTLTVERVLIIKRPFEASKYAKASRAKYIIVSLIIISFTTSCHFFETVTLQNLNHKNVNTNFSSDKGSNSIKKCQFKTEYTKFTNAWFFIDGAFYSWIPLFLLIINNLIILSEIYKARNIHNSMINTNHDENKTLGTSIVRTQLPRRMKESSSRNRETKQLTVMLLIVSFSFLITTSP
Sbjct:    1 MAGLCSELDHPMAETFMHLLSLNDSMLINYDSRFNLTMSELPAYRRRLFNILVKKIPGKLITECIFHNWLWMLIPIFIVAMGSIGNFLSAVVLCRKSMSHISSYIYLATLAIFDELILLCGLFRKWIEHVTDWSLENHSISFCKLFQVIGVSSSFISVWLIVTLTVERVLIIKRPFEASKYAKASRAKYIIVSLIIISFTTSCHFFETVTLQNLNHKNVNTNFSSDKGSNSIKKCQFKTEYTKFTNAWFFIDGAFYSWIPLFLLIINNLIILSEIYKARNIHNSMINTNHDENKTLGTSIVRTQLPRRMKESSSRNRETKQLTVMLLIVSFSFLITTSP 339          

HSP 2 Score: 143.665 bits (361), Expect = 1.106e-37
Identity = 85/92 (92.39%), Postives = 86/92 (93.48%), Query Frame = 3
Query: 1149 SFFFLSNHNVSFVILKLLIKLKGYPNGDRKLAQLVLLDGIFEMLMYVNHAINFYLYCATGNKFRQQLIKILFCRRXXXXXXXXXXXXGKYHT 1424
            SF FL   +  FVILKLLIKLKGYPNGDRKLAQLVLLDGIFEMLMYVNHAINFYLYCATGNKFRQQLIKILFCRRSSKFSTTTNFKTGKYHT
Sbjct:  330 SFSFLITTS-PFVILKLLIKLKGYPNGDRKLAQLVLLDGIFEMLMYVNHAINFYLYCATGNKFRQQLIKILFCRRSSKFSTTTNFKTGKYHT 420          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000063133.1 (SMESG000063133.1)

HSP 1 Score: 204.142 bits (518), Expect = 7.424e-65
Identity = 135/350 (38.57%), Postives = 198/350 (56.57%), Query Frame = 1
Query:  166 MAGLCSELDHPMAETFMHLLSLNDSMLINYDSRFNLTMSELPAYRRRLFNILVKKIPGKLITECIFHNWLWMLIPIFIVAMGSIGNFLSAVVLCRKSMSHISSYIYLATLAIFDELILLCGLFRKWIEHVTDWSLENHSISFCKLFQVIGVSSSFISVWLIVTLTVERVLIIKRPFEXXXXXXXXXXXXIIVSLIIISFTTSCHFFETVTLQNLNHKNVNT-NFSSDKGSNSIKKCQFKTEYTKFTNAWFFIDGAFYSWXXXXXXXXXXXXXXSEIYKARNIHNSMINTNHDE---------NKTLGTSIVRTQLPRRMKESSSRNRETKQLTVMLLIVSFSFLITTSPL 1185
            M+  C   +H        +LSLNDSML    S  +L   +  A+R+ + N    KIPG+L+ +C   + +W   P  +  +G++GN  +  VL ++ +  +S+Y YLA L  FD+ IL+ GL R+W++    +S EN+ +  C++FQ IGV++S +SVWLIV +TVER+++IK P     Y    + K II+SL II+ T S HFFETVTL     KN  T   +++  ++S   C FKTEY  F   W F+D   YS +PL L+I+ N++I   IY+A      MI+ N  +         NK+  T         R       NRET+QLT+MLL+VS +FLITT+PL
Sbjct:  126 MSFQCDITEHSDLNYIQFILSLNDSMLQGMISYLHLN-EDPDAFRKDIQN----KIPGRLLVQCQIFHLIWKAFPPILFLLGTLGNTTAFCVLVQRKLIRVSTYYYLAVLTCFDQSILIIGLLRRWVDKTFGFSSENNWLVCCQVFQFIGVATSLMSVWLIVVVTVERLIVIKLPLRVHSYVSIKKTKLIILSLFIITMTISSHFFETVTLN--RRKNSKTLQMTTESKNHSFLICDFKTEYATFAKIWTFLDAFLYSCLPLVLMIVMNVVIGHGIYQADRSRGEMISMNSKDLRKTKSINSNKSTRTGNRIYGFTPRQAAPPLPNRETRQLTIMLLVVSCTFLITTTPL 468          

HSP 2 Score: 63.5438 bits (153), Expect = 7.424e-65
Identity = 32/57 (56.14%), Postives = 37/57 (64.91%), Query Frame = 3
Query: 1173 NVSFVILKLLIKLKGYPNGDRK-LAQLVLLDGIFEMLMYVNHAINFYLYCATGNKFR 1340
                V+LK  IKL  Y N     + +L L+D IFEMLMY NHAINF LYCA+G KFR
Sbjct:  465 TTPLVLLKFFIKLNLYRNSSTSYITKLELVDTIFEMLMYTNHAINFLLYCASGKKFR 521          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000053893.1 (SMESG000053893.1)

HSP 1 Score: 193.356 bits (490), Expect = 3.356e-62
Identity = 137/345 (39.71%), Postives = 198/345 (57.39%), Query Frame = 1
Query:  166 MAGLCSELDHPMAETFMHLLSLNDSML---IN--YDSRFNLTMSELPAYRRRLFNILVKKIPGKLITECIFHNWLWMLIPIFIVAMGSIGNFLSAVVLCRKSMSHISSYIYLATLAIFDELILLCGLFRKWIEHVTDWSLENHSISFCKLFQVIGVSSSFISVWLIVTLTVERVLIIKRPFEXXXXXXXXXXXXIIVSLIIISFTTSCHFFETVTLQNLNHKNVNTNFSSDKGSNSIKKCQFKTEYTKFTNAWFFIDGAFYSWXXXXXXXXXXXXXXSEIYKARNIHNSMINTNHDENKTLGTSIVRTQLPRRMKESSSRNRETKQLTVMLLIVSFSFLITTSPL 1185
            M   C   +HP  +  ++LL LNDS L   +N  ++   NL + E+   R +L  +LV+KIPG  +  C+  N LW  +P FI+  G+ GN L+  V+C++ +   SSY+YLA +AI DELILL GL R+W +H+    +E+ +   CK+FQ IGV+ SF SVWLIV +TVER++IIK P + ++    ++ K  IV LI      S HFFETV+L          N +S+  +  + +C FK +Y  F   W   +  FYS IP  LLII N IILS  YKA    ++++   +   +    S  R ++   +   S  N ETKQLTVML+ +S +FL TT+PL
Sbjct:    1 MINFCQITEHPDTQPILYLLKLNDSNLQWQVNTFHNESQNLNIREI---RNKLEQLLVEKIPGSKLLHCVILNNLWTFLPPFILLFGTFGNILAFFVICQRHLLKTSSYVYLAAIAIIDELILLTGLLRRWSDHLVGSRIEDSNKFSCKIFQFIGVTVSFSSVWLIVFMTVERLIIIKLPLKVNRLVSPNKVKVYIVILIFCLSLLSSHFFETVSLN------NQNNSNSNLVTTPLYRCNFKDKYYHFIRYWMMFEALFYSIIPFILLIIFNGIILSLTYKASKTRSTLVKQCYMTRQFQSISHNRQKV---VTNVSQLNHETKQLTVMLVTISVAFLCTTTPL 333          

HSP 2 Score: 65.0846 bits (157), Expect = 3.356e-62
Identity = 31/58 (53.45%), Postives = 42/58 (72.41%), Query Frame = 3
Query: 1185 VILKLLIKLKGYPNGDRKLAQLVLLDGIFEMLMYVNHAINFYLYCATGNKFRQQLIKI 1358
            V  KL++K+    +  R LA   L+D IFE+LMY+NH+INFY+YCA+G +FR QL KI
Sbjct:  334 VTYKLILKVINNTDDVRYLAIRQLMDTIFELLMYINHSINFYIYCASGRRFRTQLWKI 391          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000061235.1 (SMESG000061235.1)

HSP 1 Score: 164.466 bits (415), Expect = 1.257e-53
Identity = 119/306 (38.89%), Postives = 175/306 (57.19%), Query Frame = 1
Query:  268 NLTMSELPAYRRRLFNILVKKIPGKLITECIFHNWLWMLIPIFIVAMGSIGNFLSAVVLCRKSMSHISSYIYLATLAIFDELILLCGLFRKWIEHVTDWSLENHSISFCKLFQVIGVSSSFISVWLIVTLTVERVLIIKRPFEXXXXXXXXXXXXIIVSLIIISFTTSCHFFETVTLQNLNHKNVNTNFSSDKGSNSIKKCQFKTEYTKFTNAWFFIDGAFYSWXXXXXXXXXXXXXXSEIYKARNIHNSMINTNHDENKTLGTSIVRTQLPRRMKESSSRNRETKQLTVMLLIVSFSFLITTSPL 1185
            NL++ E   +R  L   L+K+IPGKL+  C  ++  W +IP  I+ +GSIGN L+ +VLC   +   SSYIYLA + I DE+IL+ GL R++I ++    +EN S+ FC+L Q IGVSSS +SVWLIV +T+ERV+II  P  A +  +   A+ +I S II S   + HFF TV        N  TN           +C  K ++  F   W  +D + YS IP  +LI  N++I+ EI +++N  + ++N   + N+    SI         K+ S+   +T  L+V L+ VSF FLITT+PL
Sbjct:   38 NLSVLE---FRLILKETLMKEIPGKLLYSCRLYHIFWTVIPPIILLIGSIGNVLACIVLCCYLIDKCSSYIYLAVMVIVDEMILVTGLLRRYIGYIFIKHIENESVLFCRLTQFIGVSSSLVSVWLIVVMTIERVIIIYLPLRAKQITQKKIARAVISSTIICSSLVASHFFFTVDTHVTKQFN-KTNLI------HFGECTAKPQFHYFYRVWTILDASLYSLIPFCVLISLNVLIVREILRSKNNRSILMN---NFNQACSKSI---------KKVST---DTHHLSVTLIAVSFIFLITTTPL 318          

HSP 2 Score: 65.4698 bits (158), Expect = 1.257e-53
Identity = 27/38 (71.05%), Postives = 32/38 (84.21%), Query Frame = 3
Query: 1257 LDGIFEMLMYVNHAINFYLYCATGNKFRQQLIKILFCR 1370
            LD IFEMLMY NH+INF LYCATGN+FRQ ++ +L CR
Sbjct:  342 LDVIFEMLMYTNHSINFLLYCATGNRFRQHVLSLLLCR 379          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000020718.1 (SMESG000020718.1)

HSP 1 Score: 156.762 bits (395), Expect = 3.059e-47
Identity = 98/284 (34.51%), Postives = 160/284 (56.34%), Query Frame = 1
Query:  334 PGKLITECIFHNWLWMLIPIFIVAMGSIGNFLSAVVLCRKSMSHISSYIYLATLAIFDELILLCGLFRKWIEHVTDWSLENHSISFCKLFQVIGVSSSFISVWLIVTLTVERVLIIKRPFEXXXXXXXXXXXXIIVSLIIISFTTSCHFFETVTLQNLNHKNVNTNFSSDKGSNSIKKCQFKTEYTKFTNAWFFIDGAFYSWXXXXXXXXXXXXXXSEIYKARNIHNSMINTNHDENKTLGTSIVRTQLPRRMKESSSRNRETKQLTVMLLIVSFSFLITTSPL 1185
            P + ++ C+ HN++  +IP  I+  G+IGN +S +VLC  +   +S++IYL+ LAI D+ +L+ GL ++W++++    +EN + +FC L Q  G S+S +SVWLIV +T+ER ++I  PF+A    + SRA  I +S+  +    +CHF  T+ L N      +T       +N +  C F   Y  F   W  ID   YS++P   +   N+IIL ++ +AR    SM+  N                  R ++S  R+  T+QLT+MLL++S +FLITT+P+
Sbjct:   70 PSEELSLCVLHNYILTIIPAIILFFGTIGNVMSFIVLCNFAGKTVSTFIYLSLLAIVDQFVLIFGLLKRWVDYLLKRKIENRNKTFCILSQYFGTSASVLSVWLIVAVTLERAIVISFPFKAHNLIQKSRAIVISISMASVIMILNCHFIFTLDLTN------STQLFESTDNNFV--CGFSESYRNFKTVWLLIDAIIYSFLPFIFIFALNVIILIKVCQARRTRQSMMTLN------------------RGQKSVYRSESTRQLTIMLLMISGTFLITTTPI 327          

HSP 2 Score: 51.6026 bits (122), Expect = 3.059e-47
Identity = 28/50 (56.00%), Postives = 33/50 (66.00%), Query Frame = 3
Query: 1227 GDRKLAQLVLLDGIFEMLMYVNHAINFYLYCATGNKFRQQLIKILF--CR 1370
            G R        D I E+LM++NHA+NFYLYCA+GNKFR  L K LF  CR
Sbjct:  352 GIRDAVASQFADSIAEILMHLNHALNFYLYCASGNKFRACL-KSLFSKCR 400          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
GHSR3.263e-626.53growth hormone secretagogue receptor [Source:HGNC ... [more]
GHSR3.763e-626.40growth hormone secretagogue receptor [Source:HGNC ... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CNMaR4.271e-1138.10gene:FBgn0053696 transcript:FBtr0091684[more]
CapaR2.781e-931.88gene:FBgn0037100 transcript:FBtr0333458[more]
CapaR3.922e-931.88gene:FBgn0037100 transcript:FBtr0078379[more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ghsra2.330e-628.37growth hormone secretagogue receptor a [Source:ZFI... [more]
ghsrb4.273e-628.28growth hormone secretagogue receptor b [Source:ZFI... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
GHSR3.020e-629.14growth hormone secretagogue receptor [Source:NCBI ... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ghsr4.136e-628.38growth hormone secretagogue receptor [Source:MGI S... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q8ITC7|CAPAR_DROME3.931e-831.88Neuropeptides capa receptor OS=Drosophila melanoga... [more]
sp|Q95254|GHSR_PIG3.058e-730.41Growth hormone secretagogue receptor type 1 OS=Sus... [more]
sp|A5A4K9|GHSR_RABIT5.973e-627.75Growth hormone secretagogue receptor type 1 OS=Ory... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7NJU41.500e-4032.73G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A2T7NJT64.449e-3931.23G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
H2KNW04.402e-3832.22G-protein coupled receptor OS=Clonorchis sinensis ... [more]
A0A4S2KQC34.962e-3832.78G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A1S8WXZ41.278e-3531.677 transmembrane receptor OS=Opisthorchis viverrini... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mlnr2.645e-623.89motilin receptor [Source:ZFIN;Acc:ZDB-GENE-130530-... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ghsrb1.661e-628.89growth hormone secretagogue receptor type 1 [Sourc... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042142.11.106e-37100.00SMESG000042142.1[more]
SMESG000063133.17.424e-6538.57SMESG000063133.1[more]
SMESG000053893.13.356e-6239.71SMESG000053893.1[more]
SMESG000061235.11.257e-5338.89SMESG000061235.1[more]
SMESG000020718.13.059e-4734.51SMESG000020718.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002809 ID=SMED30002809|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1426bp
ACAATTCAATCACACTGAAATTACTTTGTGATTATTTTTTAAAACCGCAT
TGTATCAACTCGTAATGTAATTGGTGGAAATTTCCACCAATAAAAGCTTA
TTCATTGTATTCAAGTAAAACAGCGAAAAGTTAGTTATTTATCAAATCAA
AATTATAATCAATAAATGGCCGGATTATGTAGTGAGCTGGATCATCCTAT
GGCTGAAACATTTATGCATTTGTTATCATTGAATGATTCTATGTTAATCA
ACTATGATAGCAGATTTAATTTGACAATGTCTGAGTTGCCGGCATATAGG
AGACGGCTTTTCAATATTCTAGTGAAGAAAATCCCTGGTAAACTAATAAC
AGAATGTATATTCCACAACTGGCTCTGGATGCTTATCCCTATTTTTATAG
TTGCAATGGGAAGCATTGGGAATTTTTTGTCGGCAGTGGTTCTGTGTAGA
AAATCAATGTCTCATATATCGTCATATATCTATTTGGCGACTTTAGCTAT
TTTTGATGAACTGATTTTACTCTGTGGTCTTTTCAGAAAATGGATCGAGC
ATGTGACAGACTGGTCATTGGAGAATCACTCGATCAGTTTCTGTAAATTA
TTCCAAGTCATTGGTGTTTCGAGTAGTTTTATTTCCGTGTGGCTAATCGT
AACTCTAACTGTCGAACGAGTGTTGATCATTAAAAGACCATTTGAAGCTT
CAAAATATGCAAAAGCTAGCAGAGCCAAATATATAATAGTATCCTTGATA
ATTATCAGCTTTACAACCAGCTGTCATTTCTTTGAAACTGTAACATTACA
AAATTTAAATCATAAAAACGTCAATACAAACTTTTCCTCAGACAAAGGAT
CGAATTCAATCAAAAAATGTCAATTCAAAACGGAATATACAAAATTTACG
AATGCTTGGTTTTTCATAGATGGAGCATTCTACAGTTGGATACCATTATT
TTTGTTAATTATTAATAATCTAATCATACTTTCCGAAATTTACAAAGCCC
GCAATATCCACAATTCAATGATCAACACAAATCACGATGAAAATAAAACC
CTTGGAACCTCTATTGTCAGAACCCAATTACCAAGAAGAATGAAAGAATC
TTCTTCTAGAAATCGAGAAACAAAACAATTGACAGTGATGCTCTTGATAG
TTTCTTTTTCCTTTCTAATCACAACGTCTCCTTTGTCATATTGAAATTAT
TAATCAAACTGAAAGGATATCCAAATGGCGATAGAAAACTTGCACAATTA
GTGTTGTTAGATGGCATCTTTGAAATGCTAATGTACGTCAATCACGCAAT
CAATTTCTATTTGTACTGCGCAACTGGAAACAAATTCCGTCAACAACTAA
TAAAAATTCTATTCTGTCGACGGAGTTCAAAATTCTCAACGACAACAAAC
TTTAAAACAGGAAAATATCACACGAC
back to top

protein sequence of SMED30002809-orf-1

>SMED30002809-orf-1 ID=SMED30002809-orf-1|Name=SMED30002809-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=343bp
MAGLCSELDHPMAETFMHLLSLNDSMLINYDSRFNLTMSELPAYRRRLFN
ILVKKIPGKLITECIFHNWLWMLIPIFIVAMGSIGNFLSAVVLCRKSMSH
ISSYIYLATLAIFDELILLCGLFRKWIEHVTDWSLENHSISFCKLFQVIG
VSSSFISVWLIVTLTVERVLIIKRPFEASKYAKASRAKYIIVSLIIISFT
TSCHFFETVTLQNLNHKNVNTNFSSDKGSNSIKKCQFKTEYTKFTNAWFF
IDGAFYSWIPLFLLIINNLIILSEIYKARNIHNSMINTNHDENKTLGTSI
VRTQLPRRMKESSSRNRETKQLTVMLLIVSFSFLITTSPLSY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 70..94
score: 19.95
coord: 150..172
score: 22.17
coord: 103..124
score: 26.13
coord: 322..343
score: 20.79
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 85..342
e-value: 5.6E-19
score: 68.5
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 59..343
e-value: 2.2E-37
score: 130.7
NoneNo IPR availablePANTHERPTHR46641:SF12CNMAMIDE RECEPTORcoord: 65..342
NoneNo IPR availablePANTHERPTHR46641FAMILY NOT NAMEDcoord: 65..342
NoneNo IPR availableCDDcd149787tmA_FMRFamide_R-likecoord: 69..343
e-value: 1.63974E-28
score: 110.03
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 64..342
NoneNo IPR availableTMHMMTMhelixcoord: 69..91
NoneNo IPR availableTMHMMTMhelixcoord: 254..276
NoneNo IPR availableTMHMMTMhelixcoord: 146..168
NoneNo IPR availableTMHMMTMhelixcoord: 104..126
NoneNo IPR availableTMHMMTMhelixcoord: 189..211
NoneNo IPR availableTMHMMTMhelixcoord: 323..342
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 85..343
score: 24.223