SMED30002808

Overview
NameSMED30002808
Smed IDSMED30002808
Length (bp)1533
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30002808 (SMED30002808) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30002808 (SMED30002808) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30002808 (SMED30002808) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30002808 (SMED30002808) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002808

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30002808 dd_Smed_v4_6289_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30002808 dd_Smed_v4_6289_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30002808 dd_Smed_v4_6289_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30002808 dd_Smed_v4_6289_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002808 dd_Smed_v6_6289_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30002808 dd_Smed_v6_6289_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30002808 vs. Planmine SMEST
Match: SMESG000004687.1 (SMESG000004687.1)

HSP 1 Score: 484.182 bits (1245), Expect = 6.653e-158
Identity = 272/373 (72.92%), Postives = 302/373 (80.97%), Query Frame = 3
Query:    3 EDGEYVPNPIQLVEPIEQGPLRYYSKRWRAXXXXXXXXXXXXXXXIARINQQLIQSKQLVNTIKRKLTSSMGENRNQKKENERLRRELAEIKTRVILEDY*KTEAEQMRDSRKSEQRYVIQLEDSCKEAREIKESHQQAQDEIKTLTEQLQEARRKLEKQTAKRINSKRQLKRKQVKEIKLQMKINNQQRIIKENQERLKELPKLTERLIKAQVLIMRFSENKTKEECEIHSTPXXXXXXXGLKLHCI*LNNNVNKYEIN*CIIEIKTNNRKLWIMIIIMMRKCSTENPLEKCERTHPFRREDSTCADYKEICRNPENEECQQITLQCTQCPTKENSDELKQSIGRTQQKIQTLLKNNEEVSKIKSENLEMKR 1121
            EDGE +PNPIQLVEPI+Q PL+YYSKRWRAERKEWQELVEEQ+SEIARIN QLIQSKQL N IKRKLTSSMGENR+QK+ENE+LRRELAEIKTRVILE+Y KTEAE+MRDSRKSEQRYV+QLEDSCKEAR+IKESHQQAQDEIKTLTEQLQEA+RKLEKQT KR+N KRQLKRKQ KE  LQMKI NQQRIIKEN+ERLKELPK+TERLI+AQ+LIMRFSENK KEECE HSTPEKEK                                            +C TENPLEKCE++ PFR+EDSTCADYKEIC NP+NEECQQI LQC QCP KEN DE+KQ+I +TQ  +QTLLKNNEE++ IK+EN E K+
Sbjct:    4 EDGECIPNPIQLVEPIKQDPLKYYSKRWRAERKEWQELVEEQDSEIARINHQLIQSKQLANMIKRKLTSSMGENRDQKRENEQLRRELAEIKTRVILENYWKTEAERMRDSRKSEQRYVLQLEDSCKEARKIKESHQQAQDEIKTLTEQLQEAKRKLEKQTTKRVNYKRQLKRKQTKERNLQMKICNQQRIIKENKERLKELPKITERLIRAQILIMRFSENKIKEECERHSTPEKEK-------------------------------------------EECDTENPLEKCEKSQPFRKEDSTCADYKEICSNPDNEECQQINLQCIQCPMKENKDEIKQNIEKTQIMVQTLLKNNEEIANIKNENRETKK 333          

HSP 2 Score: 77.411 bits (189), Expect = 1.168e-14
Identity = 62/121 (51.24%), Postives = 79/121 (65.29%), Query Frame = 1
Query: 1168 NPENKPLYEILKTIVLIKTSQHIKSQPKYEPNLTILSTEQILALSVTXXXXXXXXXXXXXXXXKRQRQNTPIQKFRGIFNRI*NIRKTNEVSKLSRISINHPGQSKSTQRENQLESETQAV 1530
            NP NKP+ EI K  + I+     +   + EP  T LS E IL +S+T NI+L ICC I+ L   +QRQNTPIQKFR + N+I N  + ++ +KLS ISINHP  S+ST    QLESETQAV
Sbjct:  349 NPNNKPIQEIQKITLSIQKQLGKRVGQENEPRTTTLSIELILPISITSNIILFICCLILGLTKNKQRQNTPIQKFRRMINQIRNTNQISKTAKLSHISINHP--SRST----QLESETQAV 463          
BLAST of SMED30002808 vs. Planmine SMEST
Match: SMESG000053822.1 (SMESG000053822.1)

HSP 1 Score: 382.874 bits (982), Expect = 7.791e-118
Identity = 215/234 (91.88%), Postives = 222/234 (94.87%), Query Frame = 3
Query:    3 EDGEYVPNPIQLVEPIEQGPLRYYSKRWRAXXXXXXXXXXXXXXXIARINQQLIQSKQLVNTIKRKLTSSMGENRNQKKENERLRRELAEIKTRVILEDY*KTEAEQMRDSRKSEQRYVIQLEDSCKEAREIKESHQQAQDEIKTLTEQLQEARRKLEKQTAKRINSKRQLKRKQVKEIKLQMKINNQQRIIKENQERLKELPKLTERLIKAQVLIMRFSENKTKEECEIHSTP 704
            EDGEY+P+PIQLVEPIEQ PLRYYSKRWRAERKEWQELVEEQESEIARINQQ IQSKQL N IKRKLTSSMGENRNQK+ENERLRRELAEIKTRVILEDY KTEAE+MRDSRKSEQRYVIQLEDSCKEAREIKESHQQAQDEIKTLTEQLQEARRKLEKQT KR+N KRQLKRKQ KE  LQMKI+NQQRIIKEN+ERLKELPKLTERLIKAQVLIMRFSENKTKEECE H TP
Sbjct: 5562 EDGEYLPSPIQLVEPIEQDPLRYYSKRWRAERKEWQELVEEQESEIARINQQSIQSKQLANMIKRKLTSSMGENRNQKRENERLRRELAEIKTRVILEDYWKTEAERMRDSRKSEQRYVIQLEDSCKEAREIKESHQQAQDEIKTLTEQLQEARRKLEKQTTKRVNYKRQLKRKQAKERNLQMKIHNQQRIIKENKERLKELPKLTERLIKAQVLIMRFSENKTKEECEKHPTP 5795          
BLAST of SMED30002808 vs. Planmine SMEST
Match: SMESG000074160.1 (SMESG000074160.1)

HSP 1 Score: 363.614 bits (932), Expect = 3.278e-111
Identity = 207/227 (91.19%), Postives = 217/227 (95.59%), Query Frame = 3
Query:    3 EDGEYVPNPIQLVEPIEQGPLRYYSKRWRAXXXXXXXXXXXXXXXIARINQQLIQSKQLVNTIKRKLTSSMGENRNQKKENERLRRELAEIKTRVILEDY*KTEAEQMRDSRKSEQRYVIQLEDSCKEAREIKESHQQAQDEIKTLTEQLQEARRKLEKQTAKRINSKRQLKRKQVKEIKLQMKINNQQRIIKENQERLKELPKLTERLIKAQVLIMRFSENKTKEE 683
            EDG+ +P+PIQLVEPIEQ PLRYYSKRWRAERKEWQELVEEQ+SEIARINQQLIQSKQLVN IKRKLTSSMGEN NQK+ENERLRRELAEIKTRVILEDY KTEAE+MRDSRKSEQRYVIQLEDSCKEAREIKE+HQQAQDEIK LTEQLQEARRKLEKQTAKRINSKRQLKRKQ KE  LQMKI NQQR+IKEN+ERLKELPK+TERLIKAQVLIMRFSENKTKEE
Sbjct: 5547 EDGKCIPSPIQLVEPIEQDPLRYYSKRWRAERKEWQELVEEQDSEIARINQQLIQSKQLVNMIKRKLTSSMGENGNQKRENERLRRELAEIKTRVILEDYWKTEAERMRDSRKSEQRYVIQLEDSCKEAREIKENHQQAQDEIKALTEQLQEARRKLEKQTAKRINSKRQLKRKQTKERNLQMKIYNQQRVIKENKERLKELPKITERLIKAQVLIMRFSENKTKEE 5773          

HSP 2 Score: 116.701 bits (291), Expect = 2.543e-43
Identity = 55/73 (75.34%), Postives = 63/73 (86.30%), Query Frame = 3
Query:  903 REDSTCADYKEICRNPENEECQQITLQCTQCPTKENSDELKQSIGRTQQKIQTLLKNNEEVSKIKSENLEMKR 1121
            REDSTCADYKE+C NP NEECQQI LQC QCPTKEN DELKQ+I RTQ  +QTLLKNNEE++ IK+EN E+K+
Sbjct: 5774 REDSTCADYKEMCSNPNNEECQQINLQCMQCPTKENKDELKQNIERTQAMVQTLLKNNEEIANIKNENREIKK 5846          

HSP 3 Score: 78.5666 bits (192), Expect = 2.543e-43
Identity = 65/122 (53.28%), Postives = 82/122 (67.21%), Query Frame = 1
Query: 1168 NPENKPLYEILKTIVLIKTSQHIKSQPKYEPNLTILSTEQILALSVTXXXXXXXXXXXXXXXXKRQRQNTPIQKFRGIFNRI*NIRKTNEVSKLSRISINHPGQSKSTQRENQLESETQAVS 1533
            NP NKP+ EI    + IK  Q    Q K EP+ T LS E IL +S+T N++L+ICC I+ L   +QRQNTPIQK R +FN I N  + ++ S+LS+ISINHP  S+ST    QLESETQAVS
Sbjct: 5862 NPNNKPIQEIA---LSIKRQQG--KQIKNEPSTTSLSIELILPISITSNMILLICCLILGLTKNKQRQNTPIQKLRRMFNPIQNTNQVSKTSRLSQISINHP--SRST----QLESETQAVS 5972          
BLAST of SMED30002808 vs. Planmine SMEST
Match: SMESG000018175.1 (SMESG000018175.1)

HSP 1 Score: 350.903 bits (899), Expect = 1.197e-109
Identity = 202/227 (88.99%), Postives = 213/227 (93.83%), Query Frame = 3
Query:    3 EDGEYVPNPIQLVEPIEQGPLRYYSKRWRAXXXXXXXXXXXXXXXIARINQQLIQSKQLVNTIKRKLTSSMGENRNQKKENERLRRELAEIKTRVILEDY*KTEAEQMRDSRKSEQRYVIQLEDSCKEAREIKESHQQAQDEIKTLTEQLQEARRKLEKQTAKRINSKRQLKRKQVKEIKLQMKINNQQRIIKENQERLKELPKLTERLIKAQVLIMRFSENKTKEE 683
            EDG+ +P+PIQLVEPIEQ PLRYYSKRWRAERKEWQELVEEQESEIARINQQLIQ+KQLVN IKRKLTSSMGENR+QK+ENERLRRELAEIKTRVILED  KTEAE+MRDSRKSEQRYVIQLEDSCKEAREIKESHQQAQDEIK LTEQLQEARRKLEKQ  KR+N KRQLKRKQ KE  LQMKI NQQ +IKEN+ERLKELPK+TERLIKAQVLIMRFSENKTKEE
Sbjct:    4 EDGKCIPSPIQLVEPIEQDPLRYYSKRWRAERKEWQELVEEQESEIARINQQLIQAKQLVNMIKRKLTSSMGENRDQKRENERLRRELAEIKTRVILEDCWKTEAERMRDSRKSEQRYVIQLEDSCKEAREIKESHQQAQDEIKALTEQLQEARRKLEKQRTKRVNYKRQLKRKQTKERNLQMKIYNQQIVIKENKERLKELPKITERLIKAQVLIMRFSENKTKEE 230          

HSP 2 Score: 112.849 bits (281), Expect = 5.466e-26
Identity = 56/95 (58.95%), Postives = 72/95 (75.79%), Query Frame = 3
Query:  903 REDSTCADYKEICRNPENEECQQITLQCTQCPTKENSDELKQSIGRTQQKIQTLLKNNEEVSKIKSENLEMKRNHRNHHQKNPRKDQNQPREQTI 1187
            REDSTCAD+KEIC NP+NEEC+Q+ LQC QCPTKEN DELKQ+I +TQ  +QTLLKNNEE++ IK+EN E+K+      ++  RK +  P  + I
Sbjct:  231 REDSTCADFKEICGNPDNEECRQMNLQCMQCPTKENEDELKQNIEKTQTMVQTLLKNNEEIANIKNENREIKKTLETITRQIQRKAKANPNNKPI 325          
BLAST of SMED30002808 vs. Planmine SMEST
Match: SMESG000023758.1 (SMESG000023758.1)

HSP 1 Score: 342.813 bits (878), Expect = 5.574e-104
Identity = 200/229 (87.34%), Postives = 211/229 (92.14%), Query Frame = 3
Query:    3 EDGEYVPNPIQLVEPIEQGPLRYYSKRWRAXXXXXXXXXXXXXXXIARINQQLIQSKQLVNTIKRKLTSSMGENRNQKKENERLRRELAEIKTRVILEDY*KTEAEQMRDSRKSEQRYVIQLEDSCKEAREIKESHQQAQDEIKTLTEQLQEARRKLEKQTAKRINSKRQLKRKQVKEIKLQMKINNQQRIIKENQERLKELPKLTERLIKAQVLIMRFSENKTKEECE 689
            E GE VP+PIQLVEPIEQ PLRYYSKRWRAERKEWQELVEEQESEIARI+QQLIQSKQL N IKRKLTSSM ENRNQK+ENERLRRELAE+KTRVILEDY KTEAE+MR+SRKSEQRYV+QLEDSCKEAREIKE+HQQ QDE K LTEQLQE +RKLEKQT KR+N KRQLKRKQ KE  LQMKI NQQRIIKEN+ERLKELPKLTERLIKAQVLIMRFSENKTKEE E
Sbjct: 5019 EGGECVPSPIQLVEPIEQDPLRYYSKRWRAERKEWQELVEEQESEIARIHQQLIQSKQLGNMIKRKLTSSMEENRNQKRENERLRRELAEMKTRVILEDYWKTEAERMRESRKSEQRYVLQLEDSCKEAREIKENHQQTQDEFKALTEQLQETKRKLEKQTTKRVNYKRQLKRKQTKERNLQMKIYNQQRIIKENKERLKELPKLTERLIKAQVLIMRFSENKTKEERE 5247          

HSP 2 Score: 110.923 bits (276), Expect = 5.966e-43
Identity = 52/77 (67.53%), Postives = 63/77 (81.82%), Query Frame = 3
Query:  903 REDSTCADYKEICRNPENEECQQITLQCTQCPTKENSDELKQSIGRTQQKIQTLLKNNEEVSKIKSENLEMKRNHRN 1133
            REDSTCAD+KEIC NP NEECQQI LQC QCP KEN DELKQ+I +TQ  +QTLLKNNEE++ IK+EN ++++   N
Sbjct: 5246 REDSTCADFKEICSNPNNEECQQINLQCIQCPMKENKDELKQNIEKTQTMVQTLLKNNEEIANIKNENRKIQKTLEN 5322          

HSP 3 Score: 83.5741 bits (205), Expect = 5.966e-43
Identity = 63/122 (51.64%), Postives = 82/122 (67.21%), Query Frame = 1
Query: 1168 NPENKPLYEILKTIVLIKTSQHIKSQPKYEPNLTILSTEQILALSVTXXXXXXXXXXXXXXXXKRQRQNTPIQKFRGIFNRI*NIRKTNEVSKLSRISINHPGQSKSTQRENQLESETQAVS 1533
            NP NKP+ EI + ++ IK  Q    Q K EP+ T LS E IL +S+T N++L+ICC I+ L   +QRQNT IQKFR +F +I  I KTNE ++LS+ISI HP +S       QL+SETQAVS
Sbjct: 5334 NPNNKPIQEIQRIVLSIKKQQG--KQIKNEPSTTSLSIELILPISITSNMILLICCLILGLTKNKQRQNTQIQKFRRMFTQIRKIDKTNETTRLSQISIYHPSRS------TQLKSETQAVS 5447          
The following BLAST results are available for this feature:
BLAST of SMED30002808 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002808 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002808 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002808 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002808 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002808 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002808 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002808 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002808 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002808 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002808 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002808 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002808 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002808 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004687.16.653e-15872.92SMESG000004687.1[more]
SMESG000053822.17.791e-11891.88SMESG000053822.1[more]
SMESG000074160.13.278e-11191.19SMESG000074160.1[more]
SMESG000018175.11.197e-10988.99SMESG000018175.1[more]
SMESG000023758.15.574e-10487.34SMESG000023758.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002808 ID=SMED30002808|Name=SMED30002808|organism=Schmidtea mediterranea sexual|type=transcript|length=1533bp
TAGAAGACGGAGAATACGTACCAAACCCAATTCAATTAGTAGAACCAATA
GAACAAGGCCCACTGAGGTATTATAGTAAAAGATGGAGAGCCGAAAGAAA
AGAATGGCAAGAGTTAGTGGAGGAGCAAGAATCAGAAATCGCCCGGATAA
ATCAACAATTAATACAATCTAAACAGTTAGTCAATACGATAAAACGAAAA
CTAACATCTAGCATGGGAGAGAACAGAAATCAAAAGAAGGAAAATGAACG
ATTGAGGCGAGAATTAGCCGAAATAAAAACCCGTGTAATCCTGGAAGATT
ATTGAAAAACCGAAGCCGAACAAATGAGAGATAGCAGAAAAAGCGAACAA
AGATACGTAATACAACTAGAAGACAGTTGTAAAGAAGCCAGAGAGATAAA
AGAAAGCCATCAACAAGCCCAAGATGAGATTAAAACACTAACAGAACAGC
TCCAGGAAGCGAGACGAAAGCTAGAAAAGCAAACAGCTAAACGAATAAAT
AGTAAACGTCAACTTAAAAGAAAGCAAGTGAAGGAAATAAAGCTTCAGAT
GAAAATAAATAACCAACAAAGAATAATCAAAGAAAACCAAGAGCGACTAA
AAGAACTCCCAAAATTAACCGAGCGATTAATAAAAGCCCAAGTCCTGATA
ATGAGATTTTCAGAAAACAAAACTAAAGAGGAGTGCGAGATACACTCAAC
CCCAGAAAAAGAGAAAGAATAAAAAGGGCTTAAACTTCACTGTATATAAC
TGAACAATAATGTAAATAAATATGAAATTAACTGATGTATAATAGAAATA
AAAACCAATAACCGAAAACTATGGATAATGATAATAATAATGATGAGAAA
ATGCAGTACCGAGAACCCGTTAGAGAAATGCGAGAGAACCCATCCGTTCA
GAAGAGAAGACAGCACCTGCGCAGATTACAAAGAGATTTGCAGAAATCCC
GAAAATGAAGAATGTCAACAGATAACCTTACAATGCACTCAATGTCCCAC
AAAAGAAAACAGCGACGAATTGAAACAAAGTATCGGACGAACCCAACAAA
AGATCCAAACCCTTCTAAAGAACAACGAGGAGGTATCAAAAATAAAAAGC
GAGAACTTGGAGATGAAAAGAAATCATAGAAACCATCATCAGAAAAATCC
AAGAAAAGATCAAAACCAACCCCGAGAACAAACCATTGTACGAAATCCTT
AAAACTATCGTATTAATCAAAACATCACAACATATTAAATCTCAACCTAA
ATATGAACCCAATCTAACAATCCTGTCAACGGAACAAATCCTAGCACTCA
GTGTAACATTGAATATCGTACTCGTAATATGCTGTTCCATCATCTGTCTA
ATGATAAAGCGACAAAGACAAAATACCCCAATTCAGAAATTTAGAGGAAT
ATTCAACCGAATCTGAAACATCAGAAAAACCAACGAAGTATCAAAACTCT
CTCGCATCTCTATCAACCACCCCGGCCAATCAAAATCAACCCAAAGAGAA
AACCAGCTTGAAAGCGAAACCCAAGCCGTCAGT
back to top

protein sequence of SMED30002808-orf-1

>SMED30002808-orf-1 ID=SMED30002808-orf-1|Name=SMED30002808-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=125bp
MIIIMMRKCSTENPLEKCERTHPFRREDSTCADYKEICRNPENEECQQIT
LQCTQCPTKENSDELKQSIGRTQQKIQTLLKNNEEVSKIKSENLEMKRNH
RNHHQKNPRKDQNQPREQTIVRNP*
back to top

protein sequence of SMED30002808-orf-2

>SMED30002808-orf-2 ID=SMED30002808-orf-2|Name=SMED30002808-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=133bp
MRDSRKSEQRYVIQLEDSCKEAREIKESHQQAQDEIKTLTEQLQEARRKL
EKQTAKRINSKRQLKRKQVKEIKLQMKINNQQRIIKENQERLKELPKLTE
RLIKAQVLIMRFSENKTKEECEIHSTPEKEKE*
back to top

protein sequence of SMED30002808-orf-3

>SMED30002808-orf-3 ID=SMED30002808-orf-3|Name=SMED30002808-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=101bp
EDGEYVPNPIQLVEPIEQGPLRYYSKRWRAERKEWQELVEEQESEIARIN
QQLIQSKQLVNTIKRKLTSSMGENRNQKKENERLRRELAEIKTRVILEDY
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000484secretory system
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell