Retrovirus-related Pol polyprotein from transposon

Overview
NameRetrovirus-related Pol polyprotein from transposon
Smed IDSMED30002807
Length (bp)833
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Retrovirus-related Pol polyprotein from transposon (SMED30002807) t-SNE clustered cells

Violin plots show distribution of expression levels for Retrovirus-related Pol polyprotein from transposon (SMED30002807) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002807

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30002807 dd_Smed_v4_12993_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30002807 dd_Smed_v4_12993_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002807 dd_Smed_v4_12993_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
enteric muscle cellSMED30002807 dd_Smed_v4_12993_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Zebrafish
Match: BX511082.1 (pep chromosome:GRCz11:9:14291932:14297132:1 gene:ENSDARG00000113678.1 transcript:ENSDART00000183119.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX511082.1)

HSP 1 Score: 93.2041 bits (230), Expect = 8.770e-21
Identity = 49/138 (35.51%), Postives = 76/138 (55.07%), Query Frame = 2
Query:  374 VTERQAFPMPNIEEMLDTLNESRYFSTFDLGNAYYQVELAEKSHNMTAFPTKADQFCFSQMLFGMAAAPATFQKLMSIVLGKLNWKEAIVYLNDILIFSKDLESHKSRLNNVLEKLQVVGLRINPEKCHFLKKEIKFL 787
            +T +  +P+P +    + L  + +F+  DL NAY+ V + E     TAF T    F +  + FG++ APA FQ L++ VL  +  +   VYL+DILIFS  L+ H   +  VL++L   GL +  EKC F  + + FL
Sbjct:  586 ITVKNTYPLPLMSSAFERLQGASFFTKLDLRNAYHLVRIREGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALVNDVLRDMLDQFIYVYLDDILIFSHSLQEHVQHVRRVLQRLLENGLYVKAEKCVFHAQSVPFL 723          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Zebrafish
Match: CR925755.2 (pep chromosome:GRCz11:17:42486740:42492668:-1 gene:ENSDARG00000116402.1 transcript:ENSDART00000183946.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR925755.2)

HSP 1 Score: 92.4337 bits (228), Expect = 1.311e-20
Identity = 48/139 (34.53%), Postives = 77/139 (55.40%), Query Frame = 2
Query:  371 TVTERQAFPMPNIEEMLDTLNESRYFSTFDLGNAYYQVELAEKSHNMTAFPTKADQFCFSQMLFGMAAAPATFQKLMSIVLGKLNWKEAIVYLNDILIFSKDLESHKSRLNNVLEKLQVVGLRINPEKCHFLKKEIKFL 787
            ++T +  +P+P +    + L  + +F+  DL NAY+ V +       TAF T    F +  + FG++ APA FQ L++ VL  +  +   VYL+DILIFS  L+ H   +  VL++L   GL +  EKC F  + ++FL
Sbjct:  558 SITVKNTYPLPLMSSAFERLQGANFFTKLDLRNAYHLVRIRPGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALVNDVLRDMIDQFIYVYLDDILIFSHSLQEHVQHVRRVLQRLLENGLYVKAEKCVFHAQSVQFL 696          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Zebrafish
Match: BX546500.1 (pep chromosome:GRCz11:23:12926092:12931693:-1 gene:ENSDARG00000086495.3 transcript:ENSDART00000122176.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX546500.1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.603e-20
Identity = 48/139 (34.53%), Postives = 77/139 (55.40%), Query Frame = 2
Query:  371 TVTERQAFPMPNIEEMLDTLNESRYFSTFDLGNAYYQVELAEKSHNMTAFPTKADQFCFSQMLFGMAAAPATFQKLMSIVLGKLNWKEAIVYLNDILIFSKDLESHKSRLNNVLEKLQVVGLRINPEKCHFLKKEIKFL 787
            ++T +  +P+P +    + L  + +F+  DL NAY+ V +       TAF T    F +  + FG++ APA FQ L++ VL  +  +   VYL+DILIFS  L+ H   +  VL++L   GL +  EKC F  + ++FL
Sbjct:  559 SITVKNTYPLPLMSSAFERLQGANFFTKLDLRNAYHLVRIRPGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALVNDVLRDMIDQFIYVYLDDILIFSHSLQEHVQHVRRVLQRLLENGLYVKAEKCVFHAQSVQFL 697          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Zebrafish
Match: BX511224.1 (pep chromosome:GRCz11:2:18017000:18022765:1 gene:ENSDARG00000113243.1 transcript:ENSDART00000186877.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX511224.1)

HSP 1 Score: 90.8929 bits (224), Expect = 4.739e-20
Identity = 48/139 (34.53%), Postives = 77/139 (55.40%), Query Frame = 2
Query:  371 TVTERQAFPMPNIEEMLDTLNESRYFSTFDLGNAYYQVELAEKSHNMTAFPTKADQFCFSQMLFGMAAAPATFQKLMSIVLGKLNWKEAIVYLNDILIFSKDLESHKSRLNNVLEKLQVVGLRINPEKCHFLKKEIKFL 787
            ++T +  +P+P +    + L  + +F+  DL NAY+ V +       TAF T    F +  + FG++ APA FQ L++ VL  +  +   VYL+DILIFS  L+ H   +  VL++L   GL +  EKC F  + ++FL
Sbjct:  585 SITVKNTYPLPLMSSAFERLQGANFFTKLDLRNAYHLVCIRPGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALVNDVLRDMIDQFIYVYLDDILIFSHSLQEHIQHVRRVLQRLLENGLYVKAEKCVFHAQSVQFL 723          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Zebrafish
Match: BX890543.1 (pep chromosome:GRCz11:14:42224893:42231293:-1 gene:ENSDARG00000114583.1 transcript:ENSDART00000185486.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX890543.1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.787e-19
Identity = 49/138 (35.51%), Postives = 74/138 (53.62%), Query Frame = 2
Query:  374 VTERQAFPMPNIEEMLDTLNESRYFSTFDLGNAYYQVELAEKSHNMTAFPTKADQFCFSQMLFGMAAAPATFQKLMSIVLGKLNWKEAIVYLNDILIFSKDLESHKSRLNNVLEKLQVVGLRINPEKCHFLKKEIKFL 787
            +T +  +P+P +    + L  ++ F+  DL NAY+ V + E     TAF T    F +  + FG+  APA FQ L++ VL  +  +   VYL+DILIFS  L+ H   +  VL++L    L +  EKC F  + I FL
Sbjct:  575 ITVKNRYPLPLMSSAFELLQGAKVFTKLDLRNAYHLVRIREGDEWKTAFNTPTGHFEYRVLPFGLTNAPAVFQALVNDVLRDMVNRFVFVYLDDILIFSPCLQIHIQHVRQVLQRLLENQLYVKAEKCVFHAQSIPFL 712          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Xenopus
Match: ENSXETT00000006041.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:6:37317867:37322724:1 gene:ENSXETG00000003070.1 transcript:ENSXETT00000006041.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 108.997 bits (271), Expect = 7.232e-31
Identity = 49/132 (37.12%), Postives = 82/132 (62.12%), Query Frame = 2
Query:  392 FPMPNIEEMLDTLNESRYFSTFDLGNAYYQVELAEKSHNMTAFPTKADQFCFSQMLFGMAAAPATFQKLMSIVLGKLNWKEAIVYLNDILIFSKDLESHKSRLNNVLEKLQVVGLRINPEKCHFLKKEIKFL 787
            +  P IE+ L+ L  S++FS  DL + YYQ+ +  +    TAF      F F++M  G+  APATFQ+LM   +G ++  E +VYL+D+++F + LE H+ RL  V ++L+  GL+++PEKC F +  + ++
Sbjct:  394 YTTPRIEDALNCLVGSKWFSVLDLRSGYYQLPMHPEDKEKTAFICPLGFFEFNRMPQGLCGAPATFQRLMERTVGDMHLLEVLVYLDDLIVFGRTLEEHEQRLLKVFDRLEKEGLKLSPEKCQFCQPSVNYV 525          

HSP 2 Score: 44.2838 bits (103), Expect = 7.232e-31
Identity = 32/100 (32.00%), Postives = 52/100 (52.00%), Query Frame = 1
Query:  109 KSEIYNLIEKNIKAFMKNKWDIGKTNILKHKI-MTTEGPILIKPRR-QPA-------HIEE---NGIIRKCNSPWNTPMVCVWNKEKQDIRLYLDFRALN 372
            KS +   + ++   F +N  D+G +   KHKI +  + P   + RR  P        H+EE    GII++  SP+ +P+V V  K+   IR+ +D+R LN
Sbjct:  288 KSRLRKHLNEHSALFSRNDLDMGCSTSTKHKIRLREDKPFRERSRRIAPGDLEDLRKHLEELKAAGIIKESRSPYASPIVVV-RKKNGSIRMCVDYRTLN 386          

HSP 3 Score: 20.7866 bits (42), Expect = 7.232e-31
Identity = 8/16 (50.00%), Postives = 13/16 (81.25%), Query Frame = 3
Query:  786 STDRSKIEAILNFERP 833
            +TD SKIEA+ ++ +P
Sbjct:  535 ATDPSKIEAVSSWPKP 550          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Xenopus
Match: alkbh5 (alkB homolog 5, RNA demethylase [Source:Xenbase;Acc:XB-GENE-987580])

HSP 1 Score: 117.857 bits (294), Expect = 1.762e-29
Identity = 55/138 (39.86%), Postives = 87/138 (63.04%), Query Frame = 2
Query:  374 VTERQAFPMPNIEEMLDTLNESRYFSTFDLGNAYYQVELAEKSHNMTAFPTKADQFCFSQMLFGMAAAPATFQKLMSIVLGKLNWKEAIVYLNDILIFSKDLESHKSRLNNVLEKLQVVGLRINPEKCHFLKKEIKFL 787
            V++  A+PMP ++E+++ L ++RY +T DL   Y+QV L E +   TAF T   Q+ + ++ FG+  APATFQ++M  +L K +   A  YL+D++IFS D ESH  R+  VL+ +   GL  NP+KC    +E ++L
Sbjct:  297 VSKFDAYPMPRVDELIERLGQARYITTLDLTKGYWQVPLTEGAKEKTAFSTPEGQWQYKRLPFGLHGAPATFQRMMDRIL-KPHRGYASAYLDDVVIFSPDWESHLPRVQAVLDSIWKAGLTANPKKCAMGLEEARYL 433          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Xenopus
Match: anxa6 (annexin A6 [Source:Xenbase;Acc:XB-GENE-989741])

HSP 1 Score: 114.005 bits (284), Expect = 6.665e-29
Identity = 56/139 (40.29%), Postives = 85/139 (61.15%), Query Frame = 2
Query:  374 VTERQAFPMPNIEEMLDTLNESRYFSTFDLGNAYYQVELAEKSHNMTAFPTKADQFCFSQMLFGMAAAPATFQKLMSIVL-GKLNWKEAIVYLNDILIFSKDLESHKSRLNNVLEKLQVVGLRINPEKCHFLKKEIKFL 787
            VT   A+PMP ++E+LD L  ++Y +T DL   Y+Q+ LA  +   +AF T    + F+ M FGM  APATFQ+L++ +L G  ++ +A  YL+DI +FS+  E H   L  V  ++Q  GL + PEKCH    E+++L
Sbjct:  399 VTTTDAYPMPRVDELLDRLGNAKYLTTLDLSRGYWQIPLAPSAQEKSAFLTPFGLYQFTVMPFGMRNAPATFQRLVNRLLEGMQDFAQA--YLDDIAVFSQTWEEHLQHLQRVFAQIQDAGLTLKPEKCHLAMAEVQYL 535          

HSP 2 Score: 33.113 bits (74), Expect = 6.665e-29
Identity = 30/110 (27.27%), Postives = 51/110 (46.36%), Query Frame = 1
Query:   94 LKIYRKSEIYNLIEKNIKAFMKNKWDIGKTNILKHKIMT-TEGPILIKPRRQPAH-------------IEEN---GIIRKCNSPWNTPMVCVWNKEKQDIRLYLDFRALN 372
            L + ++ ++  ++      F  N    G+T+  +HK+ T T+ PI     R PA+             I+E    G+I   +SPW +P+V V  K+    R  +D+R LN
Sbjct:  297 LHLSQQDQLRKILRSYSPMFSANP---GRTHWAEHKVDTGTQLPI-----RSPAYRVAEAVRPEMKSQIDEMLAFGVITPSHSPWASPVVLVPKKDG-STRFCVDYRRLN 397          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Xenopus
Match: ENSXETT00000015952.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:8:63280736:63282565:1 gene:ENSXETG00000009808.1 transcript:ENSXETT00000015952.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.145 bits (261), Expect = 7.084e-29
Identity = 48/110 (43.64%), Postives = 73/110 (66.36%), Query Frame = 2
Query:  392 FPMPNIEEMLDTLNESRYFSTFDLGNAYYQVELAEKSHNMTAFPTKADQFCFSQMLFGMAAAPATFQKLMSIVLGKLNWKEAIVYLNDILIFSKDLESHKSRLNNVLEKL 721
            + +P IEE L+ LN S++F+  DL + YYQV +A +    TAF      + F++M  G+  APATFQ+LM  +LG L+ +E +VYL+DI++F   LE H+ RL NV+++L
Sbjct:  492 YTLPRIEETLEALNGSKWFTVMDLRSGYYQVPMASEDQEKTAFICPLGFYQFTRMPQGICGAPATFQRLMEKMLGDLSPRECLVYLDDIIVFGTTLEEHEQRLMNVIDRL 601          

HSP 2 Score: 41.9726 bits (97), Expect = 7.084e-29
Identity = 29/100 (29.00%), Postives = 47/100 (47.00%), Query Frame = 1
Query:  109 KSEIYNLIEKNIKAFMKNKWDIGKTNILKHKI-MTTEGPILIKPRRQPAHIEEN-----------GIIRKCNSPWNTPMVCVWNKEKQDIRLYLDFRALN 372
            K  + N + +  + F  ++ D+G     +H I ++   P   +PRR P    E+           GII    SP+ +P+V V  K+   IRL +D+R LN
Sbjct:  386 KQRLSNGLLERRQVFSTDEMDVGCAKSTQHTIRLSDSTPFRERPRRVPPKDREDLQRTLQEMKRRGIIADSRSPYASPIVIVRKKDG-SIRLCVDYRTLN 484          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Xenopus
Match: ENSXETT00000034712.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:33567219:33572531:-1 gene:ENSXETG00000011772.1 transcript:ENSXETT00000034712.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.3673 bits (246), Expect = 8.583e-23
Identity = 52/138 (37.68%), Postives = 79/138 (57.25%), Query Frame = 2
Query:  374 VTERQAFPMPNIEEMLDTLNESRYFSTFDLGNAYYQVELAEKSHNMTAFPTKADQFCFSQMLFGMAAAPATFQKLMSIVLGKLNWKEAIVYLNDILIFSKDLESHKSRLNNVLEKLQVVGLRINPEKCHFLKKEIKFL 787
            +T +  +P+P I E+ D L  ++ FS  DL  AY  + + E     TAF T+   + +  M FG+  APA FQ+ ++ +   L  K  +VYL+DILIFS+DLE+H+S++   L +L+   L    EKC F   +I FL
Sbjct:  582 ITVKNRYPLPLISELFDQLKGAKIFSKLDLRGAYNLIRIREGDEWKTAFNTRDGHYEYLVMPFGLCNAPAVFQEFVNDIFRDLLGKSVVVYLDDILIFSQDLETHRSQVKEALSRLRENFLFAKLEKCTFEVPKISFL 719          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. UniProt/SwissProt
Match: sp|P04323|POL3_DROME (Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 2.056e-29
Identity = 58/139 (41.73%), Postives = 86/139 (61.87%), Query Frame = 2
Query:  371 TVTERQAFPMPNIEEMLDTLNESRYFSTFDLGNAYYQVELAEKSHNMTAFPTKADQFCFSQMLFGMAAAPATFQKLMSIVLGKLNWKEAIVYLNDILIFSKDLESHKSRLNNVLEKLQVVGLRINPEKCHFLKKEIKFL 787
            TV +R   P+PN++E+L  L    YF+T DL   ++Q+E+  +S + TAF TK   + + +M FG+  APATFQ+ M+ +L  L  K  +VYL+DI++FS  L+ H   L  V EKL    L++  +KC FLK+E  FL
Sbjct:  275 TVGDRH--PIPNMDEILGKLGRCNYFTTIDLAKGFHQIEMDPESVSKTAFSTKHGHYEYLRMPFGLKNAPATFQRCMNDILRPLLNKHCLVYLDDIIVFSTSLDEHLQSLGLVFEKLAKANLKLQLDKCEFLKQETTFL 411          

HSP 2 Score: 37.7354 bits (86), Expect = 2.056e-29
Identity = 27/79 (34.18%), Postives = 35/79 (44.30%), Query Frame = 1
Query:  181 TNILKHKIMTTEGPILIKPRRQPAHIEE-----------NGIIRKCNSPWNTPMVCVWNKE----KQDIRLYLDFRALN 372
            TN  KH I T     L      P   E+            GIIR  NSP+N+P+  V  K+    KQ  R+ +D+R LN
Sbjct:  194 TNQTKHTINTKHNLPLYSKYSYPQAYEQEVESQIQDMLNQGIIRTSNSPYNSPIWVVPKKQDASGKQKFRIVIDYRKLN 272          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. UniProt/SwissProt
Match: sp|P20825|POL2_DROME (Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 3.262e-29
Identity = 58/139 (41.73%), Postives = 90/139 (64.75%), Query Frame = 2
Query:  371 TVTERQAFPMPNIEEMLDTLNESRYFSTFDLGNAYYQVELAEKSHNMTAFPTKADQFCFSQMLFGMAAAPATFQKLMSIVLGKLNWKEAIVYLNDILIFSKDLESHKSRLNNVLEKLQVVGLRINPEKCHFLKKEIKFL 787
            T+ +R  +P+PN++E+L  L + +YF+T DL   ++Q+E+ E+S + TAF TK+  + + +M FG+  APATFQ+ M+ +L  L  K  +VYL+DI+IFS  L  H + +  V  KL    L++  +KC FLKKE  FL
Sbjct:  274 TIPDR--YPIPNMDEILGKLGKCQYFTTIDLAKGFHQIEMDEESISKTAFSTKSGHYEYLRMPFGLRNAPATFQRCMNNILRPLLNKHCLVYLDDIIIFSTSLTEHLNSIQLVFTKLADANLKLQLDKCEFLKKEANFL 410          

HSP 2 Score: 35.039 bits (79), Expect = 3.262e-29
Identity = 30/80 (37.50%), Postives = 39/80 (48.75%), Query Frame = 1
Query:  181 TNILKHKIMTTE-GPILIK--PRRQPAHIE-EN--------GIIRKCNSPWNTPMVCVWNKEKQD----IRLYLDFRALN 372
            TN +KH + TT   PI  K  P  Q   IE EN        G+IR+ NSP+N+P   V  K         R+ +D+R LN
Sbjct:  192 TNTIKHVLNTTHNSPIYSKQYPLAQTHEIEVENQVQEMLNQGLIRESNSPYNSPTWVVPKKPDASGANKYRVVIDYRKLN 271          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. UniProt/SwissProt
Match: sp|Q8I7P9|POL5_DROME (Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 1.364e-25
Identity = 50/139 (35.97%), Postives = 84/139 (60.43%), Query Frame = 2
Query:  371 TVTERQAFPMPNIEEMLDTLNESRYFSTFDLGNAYYQVELAEKSHNMTAFPTKADQFCFSQMLFGMAAAPATFQKLMSIVLGKLNWKEAIVYLNDILIFSKDLESHKSRLNNVLEKLQVVGLRINPEKCHFLKKEIKFL 787
            TVT    +P+P+I   L +L  ++YF+T DL + ++Q+ + E     TAF T   ++ F ++ FG+  APA FQ+++  +L +   K   VY++DI++FS+D ++H   L  VL  L    L++N EK HFL  +++FL
Sbjct:  189 TVTIPDTYPIPDINATLASLGNAKYFTTLDLTSGFHQIHMKESDIPKTAFSTLNGKYEFLRLPFGLKNAPAIFQRMIDDILREHIGKVCYVYIDDIIVFSEDYDTHWKNLRLVLASLSKANLQVNLEKSHFLDTQVEFL 327          

HSP 2 Score: 36.1946 bits (82), Expect = 1.364e-25
Identity = 19/49 (38.78%), Postives = 30/49 (61.22%), Query Frame = 1
Query:  241 RQPAHIEENGIIRKCNSPWNTPMVCVWNKEK----QDIRLYLDFRALNS 375
            RQ   + ++GIIR  NSP+N+P+  V  K K    +  R+ +DF+ LN+
Sbjct:  141 RQIDELLQDGIIRPSNSPYNSPIWIVPKKPKPNGEKQYRMVVDFKRLNT 189          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. UniProt/SwissProt
Match: sp|P10394|POL4_DROME (Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster OX=7227 GN=POL PE=4 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 1.238e-22
Identity = 44/132 (33.33%), Postives = 80/132 (60.61%), Query Frame = 2
Query:  392 FPMPNIEEMLDTLNESRYFSTFDLGNAYYQVELAEKSHNMTAFPTKADQFCFSQMLFGMAAAPATFQKLMSIVLGKLNWKEAIVYLNDILIFSKDLESHKSRLNNVLEKLQVVGLRINPEKCHFLKKEIKFL 787
            FP+P I+++LD L  ++YFS  DL + ++Q+EL E S ++T+F T    + F+++ FG+  AP +FQ++M+I    +   +A +Y++D+++     +     L  V  K +   L+++PEKC F   E+ FL
Sbjct:  388 FPLPRIDDILDQLGRAKYFSCLDLMSGFHQIELDEGSRDITSFSTSNGSYRFTRLPFGLKIAPNSFQRMMTIAFSGIEPSQAFLYMDDLIVIGCSEKHMLKNLTEVFGKCREYNLKLHPEKCSFFMHEVTFL 519          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. UniProt/SwissProt
Match: sp|Q7LHG5|YI31B_YEAST (Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY3B-I PE=1 SV=2)

HSP 1 Score: 93.9745 bits (232), Expect = 2.774e-20
Identity = 48/132 (36.36%), Postives = 78/132 (59.09%), Query Frame = 2
Query:  392 FPMPNIEEMLDTLNESRYFSTFDLGNAYYQVELAEKSHNMTAFPTKADQFCFSQMLFGMAAAPATFQKLMSIVLGKLNWKEAIVYLNDILIFSKDLESHKSRLNNVLEKLQVVGLRINPEKCHFLKKEIKFL 787
            FP+P I+ +L  +  ++ F+T DL + Y+Q+ +  K    TAF T + ++ ++ M FG+  AP+TF + M+     L +    VYL+DILIFS+  E H   L+ VLE+L+   L +  +KC F  +E +FL
Sbjct:  690 FPLPRIDNLLSRIGNAQIFTTLDLHSGYHQIPMEPKDRYKTAFVTPSGKYEYTVMPFGLVNAPSTFARYMADTFRDLRFVN--VYLDDILIFSESPEEHWKHLDTVLERLKNENLIVKKKKCKFASEETEFL 819          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. TrEMBL
Match: A0A1X7T0X0 (Reverse transcriptase domain-containing protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 2.602e-40
Identity = 63/138 (45.65%), Postives = 96/138 (69.57%), Query Frame = 2
Query:  374 VTERQAFPMPNIEEMLDTLNESRYFSTFDLGNAYYQVELAEKSHNMTAFPTKADQFCFSQMLFGMAAAPATFQKLMSIVLGKLNWKEAIVYLNDILIFSKDLESHKSRLNNVLEKLQVVGLRINPEKCHFLKKEIKFL 787
            VT++ A+P+P I+E LDTL  S +F+T DL + Y+QVE+ EK  + TAF T+   F F+ M FG+  APATFQ+LM ++L  L W+  +VY++D++I  KD++SH + +  V  +L+  GL++ P KC F K+E+KFL
Sbjct:  475 VTKKDAYPLPRIDETLDTLAGSVWFTTLDLLSGYWQVEVEEKDRDKTAFCTREGLFHFNVMPFGLCNAPATFQRLMDMLLAGLLWESCLVYIDDVIIMGKDVQSHLANIATVFSRLRDAGLKVKPSKCEFFKREVKFL 612          

HSP 2 Score: 51.6026 bits (122), Expect = 2.602e-40
Identity = 32/104 (30.77%), Postives = 52/104 (50.00%), Query Frame = 1
Query:  109 KSEIYNLIEKNIKAFMKNKWDIGKTNILKHKIMTTEG-PILIKPRRQPAHIEENG-----------IIRKCNSPWNTPMVCVWNKEKQDIRLYLDFRALNSDRK 384
            K + Y+L+    + F  +  D G T++L+H I T    PI   PRR P H ++             II K +SPW++P++ V  K+   +R  +D+R +N   K
Sbjct:  375 KEQFYSLLLSFSEVFPDDDDDFGLTHLLQHSIDTGSAPPIRQPPRRVPKHKQQEAHQLLQSMLDRNIIAKSHSPWSSPIILV-QKKDGSLRFCIDYRKVNEVTK 477          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. TrEMBL
Match: A0A5S6Q2Z4 (Uncharacterized protein OS=Trichuris muris OX=70415 PE=4 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 2.961e-40
Identity = 66/138 (47.83%), Postives = 94/138 (68.12%), Query Frame = 2
Query:  374 VTERQAFPMPNIEEMLDTLNESRYFSTFDLGNAYYQVELAEKSHNMTAFPTKADQFCFSQMLFGMAAAPATFQKLMSIVLGKLNWKEAIVYLNDILIFSKDLESHKSRLNNVLEKLQVVGLRINPEKCHFLKKEIKFL 787
            VT++ A+P+P I+E LD +  S +FST DL + ++QVEL + S   TAF T    + F  + FG+  APATFQ+LM  VL  LNWK  +VYL+D++IF+++ E H  RL  VLE+L+  GL+  P+KC F +KEIK+L
Sbjct:  548 VTKKDAYPLPRIDEALDAMQGSVWFSTLDLMSGFWQVELEDGSQEKTAFTTHEGLYHFKVLPFGLTGAPATFQRLMEQVLSGLNWKCCVVYLDDVIIFARNYEEHLYRLREVLERLRKAGLKARPDKCKFFRKEIKYL 685          

HSP 2 Score: 47.7506 bits (112), Expect = 2.961e-40
Identity = 34/105 (32.38%), Postives = 54/105 (51.43%), Query Frame = 1
Query:  106 RKSEIYNLIEKNIKAFMKNKWDIGKTNILKHKIMT-TEGPILIKPRRQPA-----------HIEENGIIRKCNSPWNTPMVCVWNKEKQDIRLYLDFRALNSDRK 384
            +K    +L+++   AF  +  ++G+T ILKHKI T +  P+   PRR              ++E   +I K  SPW + +V V  K    +RL +D+RALN+  K
Sbjct:  447 QKQRFQDLVDEFQDAFAWSDENLGRTTILKHKIDTGSAKPVRQMPRRLSPLEREEVAQMIRNMERRNLIEKSVSPWASRVVPV-RKRDGTLRLCVDYRALNAVTK 550          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. TrEMBL
Match: A0A0V0RD96 (Retrovirus-related Pol polyprotein from transposon 17.6 (Fragment) OS=Trichinella nelsoni OX=6336 GN=pol PE=4 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 3.032e-40
Identity = 65/138 (47.10%), Postives = 88/138 (63.77%), Query Frame = 2
Query:  374 VTERQAFPMPNIEEMLDTLNESRYFSTFDLGNAYYQVELAEKSHNMTAFPTKADQFCFSQMLFGMAAAPATFQKLMSIVLGKLNWKEAIVYLNDILIFSKDLESHKSRLNNVLEKLQVVGLRINPEKCHFLKKEIKFL 787
            VT   A P+P I++ LD L  +++FST DL + Y+QVE+AE+    TAF T    F F  M FG+  APATFQ+LM   L  L WK  +VYL+DI++F K  E H  RL  VL +LQ VGL+I PEKC  +++ + +L
Sbjct:  568 VTRVDAQPIPRIDDTLDALAGAKWFSTLDLASGYWQVEVAERDREKTAFSTPLGLFQFRVMPFGLCNAPATFQRLMEKALRGLTWKTCLVYLDDIIVFGKTEEEHLERLEGVLSRLQSVGLKIKPEKCQLMRQSVHYL 705          

HSP 2 Score: 52.7582 bits (125), Expect = 3.032e-40
Identity = 34/131 (25.95%), Postives = 63/131 (48.09%), Query Frame = 1
Query:   28 TIDAHFGGEINDSMRLKRTM---EVLKIYRKSEIYNLIEKNIKAFMKNKWDIGKTNILKHKIMTTEG-PILIKPRRQPAHIEE-----------NGIIRKCNSPWNTPMVCVWNKEKQDIRLYLDFRALNS 375
            ++ +  G  ++ S    RT+          K  + +++ K  KA  + + D+G+T+++KH+I T    P+ + PRR P    E            G+I   + PW++P+V V  K+    R  +D+R LN+
Sbjct:  438 SVGSDVGAGVDGSNDWTRTLVDGAECSARSKRALRSILRKCGKAISRGEADLGRTSLVKHRIETGGAQPVKLPPRRLPQAQREVVDRLIREMLHMGVIEPASGPWSSPVVLVRKKDGSP-RFCVDYRRLNA 567          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. TrEMBL
Match: A0A5S6Q6P2 (Uncharacterized protein OS=Trichuris muris OX=70415 PE=4 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 9.273e-40
Identity = 65/138 (47.10%), Postives = 94/138 (68.12%), Query Frame = 2
Query:  374 VTERQAFPMPNIEEMLDTLNESRYFSTFDLGNAYYQVELAEKSHNMTAFPTKADQFCFSQMLFGMAAAPATFQKLMSIVLGKLNWKEAIVYLNDILIFSKDLESHKSRLNNVLEKLQVVGLRINPEKCHFLKKEIKFL 787
            VT++ A+P+P I+E LD +  S +FST DL + ++QVEL + S   TAF T    + F  + FG+  APATFQ+LM  VL  LNWK  +VYL+D++IF+++ + H  RL  VLE+L+  GL+  P+KC F +KEIK+L
Sbjct:  548 VTKKDAYPLPRIDEALDAMQGSVWFSTLDLMSGFWQVELEDGSQEKTAFTTHEGLYHFKVLPFGLTGAPATFQRLMEQVLSGLNWKCCVVYLDDVIIFARNYKEHLYRLREVLERLRKAGLKARPDKCKFFRKEIKYL 685          

HSP 2 Score: 48.1358 bits (113), Expect = 9.273e-40
Identity = 34/105 (32.38%), Postives = 54/105 (51.43%), Query Frame = 1
Query:  106 RKSEIYNLIEKNIKAFMKNKWDIGKTNILKHKIMT-TEGPILIKPRRQPA-----------HIEENGIIRKCNSPWNTPMVCVWNKEKQDIRLYLDFRALNSDRK 384
            +K    +L+++   AF  +  ++G+T ILKHKI T +  P+   PRR              ++E   +I K  SPW + +V V  K    +RL +D+RALN+  K
Sbjct:  447 QKQRFQDLVDEFQDAFAWSDENLGRTTILKHKIDTGSAKPVRQMPRRLSPLEREEVAQMIRNMERRNLIEKSVSPWASRVVPV-RKRDGTLRLCVDYRALNAVTK 550          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. TrEMBL
Match: A0A5S6Q4F0 (Uncharacterized protein OS=Trichuris muris OX=70415 PE=4 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 1.305e-39
Identity = 65/138 (47.10%), Postives = 88/138 (63.77%), Query Frame = 2
Query:  374 VTERQAFPMPNIEEMLDTLNESRYFSTFDLGNAYYQVELAEKSHNMTAFPTKADQFCFSQMLFGMAAAPATFQKLMSIVLGKLNWKEAIVYLNDILIFSKDLESHKSRLNNVLEKLQVVGLRINPEKCHFLKKEIKFL 787
            V+ R A+P+P I+E L+ L  +RYFST DL + Y+QVEL E +   TAF T    F F+ M FG+  APATFQ+LM  VL  L W   +VYL+DI++FS+  E H   L+ VL +LQ  GL+ N  KC    KE+++L
Sbjct:  613 VSRRDAYPIPRIDETLEALAGARYFSTIDLLSGYWQVELTEAAKEKTAFITHDGLFQFNVMPFGLTGAPATFQRLMEHVLAGLKWNTCLVYLDDIIVFSRTAEEHVEHLSQVLNRLQKAGLKANASKCKLFCKEVRYL 750          

HSP 2 Score: 53.5286 bits (127), Expect = 1.305e-39
Identity = 33/105 (31.43%), Postives = 56/105 (53.33%), Query Frame = 1
Query:   94 LKIYRKSEIYNLIEKNIKAFMKNKWDIGKTNILKHKIMTTEGPILIKPRRQPAHIE------------ENGIIRKCNSPWNTPMVCVWNKEKQDIRLYLDFRALN 372
            L   ++ +++ ++ K   AF  +++DIG+T++LKH I+T     +  P R+ A +E            +N II   NSPW   +V V  K+   +RL +D+R LN
Sbjct:  508 LTASQRKKLHGMLSKFRNAFAASEFDIGRTSVLKHDIVTDNIRPVRHPLRRLAPVERKEVSQLIQRLLDNKIIEPSNSPWAAGIVPV-RKKDGSLRLCVDYRKLN 611          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Cavefish
Match: ENSAMXT00000034038.1 (pep primary_assembly:Astyanax_mexicanus-2.0:14:3120146:3124090:1 gene:ENSAMXG00000040885.1 transcript:ENSAMXT00000034038.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 141.739 bits (356), Expect = 1.691e-42
Identity = 60/139 (43.17%), Postives = 96/139 (69.06%), Query Frame = 2
Query:  371 TVTERQAFPMPNIEEMLDTLNESRYFSTFDLGNAYYQVELAEKSHNMTAFPTKADQFCFSQMLFGMAAAPATFQKLMSIVLGKLNWKEAIVYLNDILIFSKDLESHKSRLNNVLEKLQVVGLRINPEKCHFLKKEIKFL 787
            + + R AFP+P +EE L+ L E++YFST DL + Y+QVE+AE   + TAF T    F  ++M FG+  +P+TFQ+LM+   G LN++  ++YL+DI+IFS+  + H  RL  V ++L+  GL++ P+KCH L++E+ +L
Sbjct:  299 SCSTRDAFPLPRVEEALEALGEAKYFSTLDLTSGYWQVEVAEADKHKTAFSTPMGLFEANRMPFGLQNSPSTFQRLMTCCFGDLNFESLLIYLDDIVIFSRTFDEHLERLQMVFDRLRKYGLKLKPQKCHLLRREVLYL 437          

HSP 2 Score: 50.447 bits (119), Expect = 1.691e-42
Identity = 31/99 (31.31%), Postives = 51/99 (51.52%), Query Frame = 1
Query:  115 EIYNLIEKNIKAFMKNKWDIGKTNILKHKI-MTTEGPILIKPRRQP-----------AHIEENGIIRKCNSPWNTPMVCVWNKEKQDIRLYLDFRALNS 375
            ++ + I KN   F K+  D G T ++KH+I +    P  +  R+ P             +EE G+IR   SP+ +P+V V  K+   +R+ +D+R LNS
Sbjct:  202 QMTDKILKNSDVFSKHHLDYGHTTVVKHEIPLVDPRPFRLPYRKIPPSQYQAVRKAITEMEEAGVIRPSKSPYASPIVVV-TKKDGSLRICMDYRKLNS 299          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Cavefish
Match: ENSAMXT00000052546.1 (pep primary_assembly:Astyanax_mexicanus-2.0:2:13031363:13036570:1 gene:ENSAMXG00000033629.1 transcript:ENSAMXT00000052546.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.494 bits (332), Expect = 1.427e-38
Identity = 64/138 (46.38%), Postives = 90/138 (65.22%), Query Frame = 2
Query:  374 VTERQAFPMPNIEEMLDTLNESRYFSTFDLGNAYYQVELAEKSHNMTAFPTKADQFCFSQMLFGMAAAPATFQKLMSIVLGKLNWKEAIVYLNDILIFSKDLESHKSRLNNVLEKLQVVGLRINPEKCHFLKKEIKFL 787
            VT + A+P+P +EE LD L  +++FST DL   Y+QV + +     TA  T    F +S+M FG+  APATFQ+LM +VLG L +   +VYL+DI+IFS+D +SH  RL  V  +L+  GL++ P KC  LK E+KFL
Sbjct:  784 VTCKDAYPLPRVEESLDALGNAQWFSTLDLTAGYFQVAVKDSDREKTAVTTPFGLFQWSRMPFGLCNAPATFQRLMGVVLGDLAFDILLVYLDDIIIFSRDFKSHCERLELVFNRLRHHGLKLKPSKCFLLKPEVKFL 921          

HSP 2 Score: 46.2098 bits (108), Expect = 1.427e-38
Identity = 31/98 (31.63%), Postives = 49/98 (50.00%), Query Frame = 1
Query:  115 EIYNLIEKNIKAFMKNKWDIGKTNILKHKIMTTEG-PILIKPRRQP--------AHIE---ENGIIRKCNSPWNTPMVCVWNKEKQDIRLYLDFRALN 372
            E+ +L+EK+   F K+  D G T  + H I T +  P+  + RR P         H++   + GI+ +  SPW +P V V  K+   +R   D+R LN
Sbjct:  686 ELMDLLEKHKDIFSKSDSDFGYTTAVTHSIPTGDAPPVKQRHRRVPPQVFQEFKKHVQSLVDRGILEESCSPWASPAVIVIKKDGT-VRFCCDYRRLN 782          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Cavefish
Match: ENSAMXT00000045469.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000976.1:426503:430633:1 gene:ENSAMXG00000030479.1 transcript:ENSAMXT00000045469.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.88 bits (333), Expect = 2.074e-38
Identity = 62/137 (45.26%), Postives = 89/137 (64.96%), Query Frame = 2
Query:  377 TERQAFPMPNIEEMLDTLNESRYFSTFDLGNAYYQVELAEKSHNMTAFPTKADQFCFSQMLFGMAAAPATFQKLMSIVLGKLNWKEAIVYLNDILIFSKDLESHKSRLNNVLEKLQVVGLRINPEKCHFLKKEIKFL 787
            T + AFP+P IEE LD L+ S++FST DL + Y QV + EK    TAF T    F F++M FG+  AP+TFQ+LM  + G  ++   ++YL+DI+IFS DL+ H  RL+ VL +LQ   L++  EKCHF +  + +L
Sbjct:  419 TRKDAFPLPRIEESLDALSGSKWFSTLDLASGYNQVPVLEKDKEKTAFCTPFGLFEFNRMPFGLCNAPSTFQRLMERIFGDQSFHTLLLYLDDIVIFSSDLQQHLQRLDMVLSRLQQHNLKLKLEKCHFFQTRVSYL 555          

HSP 2 Score: 45.4394 bits (106), Expect = 2.074e-38
Identity = 29/98 (29.59%), Postives = 54/98 (55.10%), Query Frame = 1
Query:  127 LIEKNIKAFMKNKWDIGKTNILKHKI-MTTEGPILIKPRRQP--------AHIEE---NGIIRKCNSPWNTPMVCVWNKEKQDIRLYLDFRALNSDRK 384
            L+ ++   F ++  D+G T +++H I +    P+  + RR P        AHI+E   + ++R  +SP+ +P+V V  K+   IRL +D+R LN+  +
Sbjct:  324 LLRRHQNLFSEHAGDLGCTTLVQHSIPLLDSVPVRQRYRRLPPSQYDLVKAHIQELVEHQVVRPSSSPYASPIVVV-QKKDGSIRLCVDYRQLNAKTR 420          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Cavefish
Match: ENSAMXT00000042297.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002193.1:21:2557:1 gene:ENSAMXG00000030761.1 transcript:ENSAMXT00000042297.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.88 bits (333), Expect = 1.275e-37
Identity = 60/137 (43.80%), Postives = 95/137 (69.34%), Query Frame = 2
Query:  377 TERQAFPMPNIEEMLDTLNESRYFSTFDLGNAYYQVELAEKSHNMTAFPTKADQFCFSQMLFGMAAAPATFQKLMSIVLGKLNWKEAIVYLNDILIFSKDLESHKSRLNNVLEKLQVVGLRINPEKCHFLKKEIKFL 787
            T + A+ +PNIEE    L+ SR+FS  DL + YYQVE+ E+  + TAF T    + F+++  G+  AP+TFQ++M   +G +N KE +V+L+D+++FS  LE H+SRL  VL KL+  GL+++PEKCHF ++ +++L
Sbjct:  188 TIKDAYALPNIEETFSALHGSRWFSVMDLKSGYYQVEVEEEDKHKTAFVTPMGFWEFNRLPQGVTNAPSTFQRVMEKCMGTMNLKEVLVFLDDLIVFSDTLEEHESRLMRVLTKLKDFGLKLSPEKCHFFRRSVRYL 324          

HSP 2 Score: 42.743 bits (99), Expect = 1.275e-37
Identity = 36/130 (27.69%), Postives = 58/130 (44.62%), Query Frame = 1
Query:   25 CTIDAHFGGEINDSMRLKRTMEVLKIYRKSEIYNLIEKNIKAFMKNKWDIGKTNILKHKIMTTEGPILIKPRRQPAH-------------IEENGIIRKCNSPWNTPMVCVWNKEKQDIRLYLDFRALNS 375
            C++ A  GG+   S  L+ +   L    K  I   +    + F     D G T  + H+I  ++ P   K R +P H             +++  IIR+  S + +P+V V  K+   IRL +D+R LNS
Sbjct:   61 CSLLAPVGGQSMISFDLEESQ--LSAEWKDRITANLNSIPEVFANGDLDYGHTTAVTHRIRLSD-PTPFKQRARPIHPSDYEAVRLHLKELQDANIIRESESSFASPVVVV-KKKSGAIRLCVDYRKLNS 186          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Cavefish
Match: ENSAMXT00000053730.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002271.1:240468:243660:-1 gene:ENSAMXG00000043631.1 transcript:ENSAMXT00000053730.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.88 bits (333), Expect = 1.306e-37
Identity = 60/137 (43.80%), Postives = 95/137 (69.34%), Query Frame = 2
Query:  377 TERQAFPMPNIEEMLDTLNESRYFSTFDLGNAYYQVELAEKSHNMTAFPTKADQFCFSQMLFGMAAAPATFQKLMSIVLGKLNWKEAIVYLNDILIFSKDLESHKSRLNNVLEKLQVVGLRINPEKCHFLKKEIKFL 787
            T + A+ +PNIEE    L+ SR+FS  DL + YYQVE+ E+  + TAF T    + F+++  G+  AP+TFQ++M   +G +N KE +V+L+D+++FS  LE H+SRL  VL KL+  GL+++PEKCHF ++ +++L
Sbjct:  320 TIKDAYALPNIEETFSALHGSRWFSVMDLKSGYYQVEVEEEDKHKTAFVTPMGFWEFNRLPQGVTNAPSTFQRVMEKCMGTMNLKEVLVFLDDLIVFSDTLEEHESRLMRVLTKLKDFGLKLSPEKCHFFRRSVRYL 456          

HSP 2 Score: 42.743 bits (99), Expect = 1.306e-37
Identity = 36/130 (27.69%), Postives = 58/130 (44.62%), Query Frame = 1
Query:   25 CTIDAHFGGEINDSMRLKRTMEVLKIYRKSEIYNLIEKNIKAFMKNKWDIGKTNILKHKIMTTEGPILIKPRRQPAH-------------IEENGIIRKCNSPWNTPMVCVWNKEKQDIRLYLDFRALNS 375
            C++ A  GG+   S  L+ +   L    K  I   +    + F     D G T  + H+I  ++ P   K R +P H             +++  IIR+  S + +P+V V  K+   IRL +D+R LNS
Sbjct:  193 CSLLAPVGGQSMISFDLEESQ--LSAEWKDRITANLNSIPEVFANGDLDYGHTTAVTHRIRLSD-PTPFKQRARPIHPSDYEAVRLHLKELQDANIIRESESSFASPVVVV-KKKSGAIRLCVDYRKLNS 318          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Medaka
Match: ENSORLT00000045600.1 (pep primary_assembly:ASM223467v1:4:26167161:26171153:-1 gene:ENSORLG00000023514.1 transcript:ENSORLT00000045600.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 134.035 bits (336), Expect = 1.521e-40
Identity = 59/137 (43.07%), Postives = 90/137 (65.69%), Query Frame = 2
Query:  377 TERQAFPMPNIEEMLDTLNESRYFSTFDLGNAYYQVELAEKSHNMTAFPTKADQFCFSQMLFGMAAAPATFQKLMSIVLGKLNWKEAIVYLNDILIFSKDLESHKSRLNNVLEKLQVVGLRINPEKCHFLKKEIKFL 787
            T + AFP+P I+E LD L  +++F+T DL + Y QVE+AEK    TAF T    F F++M FG+  AP+TFQ+LM  + G   ++  ++YL+D++IFS  +E H  RL  V  +L+  GL++   KCHF +K++K+L
Sbjct:  403 TRKDAFPLPRIDESLDALAGAQWFTTLDLASGYSQVEVAEKDKAKTAFCTPFGLFEFNRMPFGLCNAPSTFQRLMERLFGDCRFQSVLLYLDDVIIFSSSVEQHLQRLEQVFSRLEAQGLKVKLSKCHFFQKQVKYL 539          

HSP 2 Score: 51.2174 bits (121), Expect = 1.521e-40
Identity = 39/137 (28.47%), Postives = 71/137 (51.82%), Query Frame = 1
Query:    7 NQEKVLCTIDAHFGGEI--NDSMRLKRTMEVLKIYRKSEIYNLIEKNIKAFMKNKWDIGKTNILKHKI-MTTEGPILIKPRRQP--------AHIE---ENGIIRKCNSPWNTPMVCVWNKEKQDIRLYLDFRALNS 375
            N E  + TI   F  E+  + +  +   +E L    K  +  L+ K  + F K+  D+G TN++ H+I +  E P+    RR P        +HI+   ++ +IR+ +SP+ +P+V V  K+   +R+ +D+R LN+
Sbjct:  269 NSESCVATI---FSSEVTPDPTDSILPQLEHLDERDKERVKALLSKYNRVFAKDDLDVGCTNLMTHEIPLLDETPVRQPYRRIPPSQYELAHSHIQQLLQSQVIRESSSPYASPIVLV-QKKDGGLRMCVDYRQLNA 401          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Medaka
Match: ENSORLT00000040501.1 (pep primary_assembly:ASM223467v1:1:1251188:1255180:-1 gene:ENSORLG00000023024.1 transcript:ENSORLT00000040501.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 131.724 bits (330), Expect = 8.351e-40
Identity = 59/137 (43.07%), Postives = 88/137 (64.23%), Query Frame = 2
Query:  377 TERQAFPMPNIEEMLDTLNESRYFSTFDLGNAYYQVELAEKSHNMTAFPTKADQFCFSQMLFGMAAAPATFQKLMSIVLGKLNWKEAIVYLNDILIFSKDLESHKSRLNNVLEKLQVVGLRINPEKCHFLKKEIKFL 787
            T + AFP P I+E LD L  +++F+T DL + Y QVE+AEK    TAF T    F F++M FG+  AP+TFQ+LM  + G   ++  ++YL+D++IFS  +E H  RL  V  +L   GL++   KCHF +K++K+L
Sbjct:  403 TRKDAFPSPRIDESLDALAGAQWFTTLDLASGYSQVEVAEKDKAKTAFCTPFGLFEFNRMPFGLCNAPSTFQRLMERLFGDCRFQSVLLYLDDVIIFSSSVEQHLQRLEQVFSRLDAQGLKVKLSKCHFFQKQVKYL 539          

HSP 2 Score: 51.2174 bits (121), Expect = 8.351e-40
Identity = 39/137 (28.47%), Postives = 71/137 (51.82%), Query Frame = 1
Query:    7 NQEKVLCTIDAHFGGEI--NDSMRLKRTMEVLKIYRKSEIYNLIEKNIKAFMKNKWDIGKTNILKHKI-MTTEGPILIKPRRQP--------AHIE---ENGIIRKCNSPWNTPMVCVWNKEKQDIRLYLDFRALNS 375
            N E  + TI   F  E+  + +  +   +E L    K  +  L+ K  + F K+  D+G TN++ H+I +  E P+    RR P        +HI+   ++ +IR+ +SP+ +P+V V  K+   +R+ +D+R LN+
Sbjct:  269 NSESCVATI---FSSEVTPDPTDSILPQLEHLDERDKERVKALLSKYNRVFAKDDLDVGCTNLMTHEIPLLDETPVRQPYRRIPPSQYELARSHIQQLLQSQVIRESSSPYASPIVLV-QKKDGGLRMCVDYRQLNA 401          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Medaka
Match: ENSORLT00000045141.1 (pep primary_assembly:ASM223467v1:23:22495254:22500491:-1 gene:ENSORLG00000029628.1 transcript:ENSORLT00000045141.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 135.961 bits (341), Expect = 8.563e-39
Identity = 63/138 (45.65%), Postives = 92/138 (66.67%), Query Frame = 2
Query:  374 VTERQAFPMPNIEEMLDTLNESRYFSTFDLGNAYYQVELAEKSHNMTAFPTKADQFCFSQMLFGMAAAPATFQKLMSIVLGKLNWKEAIVYLNDILIFSKDLESHKSRLNNVLEKLQVVGLRINPEKCHFLKKEIKFL 787
            VT + A+P+P +EE LD L ++  FST DL   Y+QV + E+    TA  T    F +++M FG+  APATFQ+LM +VLG L++   +VYL+DIL++S+D ESH  RL  V ++L+  GL++ P KC  L+ E+KFL
Sbjct:  781 VTCKDAYPLPRVEEALDALGDAHLFSTLDLTAGYFQVAMNEEDQGKTAVTTPFGLFEWTRMPFGLCNAPATFQRLMGLVLGDLSFDILLVYLDDILVYSRDFESHCERLGLVFQRLRQHGLKLKPSKCFLLRPEVKFL 918          

HSP 2 Score: 43.5134 bits (101), Expect = 8.563e-39
Identity = 30/98 (30.61%), Postives = 48/98 (48.98%), Query Frame = 1
Query:  115 EIYNLIEKNIKAFMKNKWDIGKTNILKHKIMTTEGP-ILIKPRRQP--------AHIEE---NGIIRKCNSPWNTPMVCVWNKEKQDIRLYLDFRALN 372
            ++ +L+  +   F +N+ D G T  + H I T + P I  + RR P         H+ E    GI+++  SPW +P V V  K+   +R   D+R LN
Sbjct:  683 QLVSLLATHQDVFSQNENDYGYTTSVTHCISTGDAPPIKQRHRRVPPQVFQEFKKHVHELVSQGILKESTSPWASPAVIVIKKDGS-VRFCCDYRRLN 779          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Medaka
Match: ENSORLT00000039099.1 (pep primary_assembly:ASM223467v1:16:31928608:31932747:-1 gene:ENSORLG00000023909.1 transcript:ENSORLT00000039099.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 128.642 bits (322), Expect = 9.675e-38
Identity = 59/137 (43.07%), Postives = 90/137 (65.69%), Query Frame = 2
Query:  377 TERQAFPMPNIEEMLDTLNESRYFSTFDLGNAYYQVELAEKSHNMTAFPTKADQFCFSQMLFGMAAAPATFQKLMSIVLGKLNWKEAIVYLNDILIFSKDLESHKSRLNNVLEKLQVVGLRINPEKCHFLKKEIKFL 787
            T + AFP+P IEE LD L+ +R+FST DL + Y+QV +AE     TAF T    F +++M FG+  AP+TFQ+LM  + G+   +  ++YL+DI++FS  +E H  RL  VLE+LQ+ GL++   KC F + ++ +L
Sbjct:  410 TRKDAFPLPRIEESLDALSGARWFSTLDLASGYHQVAVAEADRPKTAFCTPFGLFEWNRMPFGLCNAPSTFQRLMQRMFGEQQGQSLLLYLDDIIVFSSTIEQHLERLELVLERLQLEGLKVKLAKCAFFQHQVHYL 546          

HSP 2 Score: 45.4394 bits (106), Expect = 9.675e-38
Identity = 29/109 (26.61%), Postives = 59/109 (54.13%), Query Frame = 1
Query:   85 MEVLKIYRKSEIYNLIEKNIKAFMKNKWDIGKTNILKHKI-MTTEGPILIKPRRQPA--------HIE---ENGIIRKCNSPWNTPMVCVWNKEKQDIRLYLDFRALNS 375
            +  L    + ++  L+ K +  F  ++ D+G T+++ H+I +  + P+  + RR P         HI    ++ +IR+ +SP+ +P+V +  K+   +RL +D+R LNS
Sbjct:  301 LSALSAGEQEKVRTLLGKYLTVFSLHEGDLGCTSLITHEIPLVDDAPVRQRYRRIPPSDYVAAKEHINNLLQSQVIRESSSPFASPIVLI-RKKDGGLRLCVDYRQLNS 408          

HSP 3 Score: 22.7126 bits (47), Expect = 9.675e-38
Identity = 9/16 (56.25%), Postives = 12/16 (75.00%), Query Frame = 3
Query:  786 STDRSKIEAILNFERP 833
            STD  K+EA+ N+E P
Sbjct:  556 STDPGKVEAVANWEPP 571          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Medaka
Match: ENSORLT00000029819.1 (pep primary_assembly:ASM223467v1:24:6358775:6362914:-1 gene:ENSORLG00000022361.1 transcript:ENSORLT00000029819.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 128.642 bits (322), Expect = 1.469e-37
Identity = 59/137 (43.07%), Postives = 90/137 (65.69%), Query Frame = 2
Query:  377 TERQAFPMPNIEEMLDTLNESRYFSTFDLGNAYYQVELAEKSHNMTAFPTKADQFCFSQMLFGMAAAPATFQKLMSIVLGKLNWKEAIVYLNDILIFSKDLESHKSRLNNVLEKLQVVGLRINPEKCHFLKKEIKFL 787
            T + AFP+P IEE LD L+ +R+FST DL + Y+QV +AE     TAF T    F +++M FG+  AP+TFQ+LM  + G+   +  ++YL+DI++FS  +E H  RL  VLE+LQ+ GL++   KC F + ++ +L
Sbjct:  410 TRKDAFPLPRIEESLDALSGARWFSTLDLASGYHQVAVAEADRPKTAFCTPFGLFEWNRMPFGLCNAPSTFQRLMQRMFGEQQGQSLLLYLDDIIVFSSTIEQHLERLELVLERLQLEGLKVKLAKCAFFQHQVHYL 546          

HSP 2 Score: 44.669 bits (104), Expect = 1.469e-37
Identity = 29/109 (26.61%), Postives = 59/109 (54.13%), Query Frame = 1
Query:   85 MEVLKIYRKSEIYNLIEKNIKAFMKNKWDIGKTNILKHKI-MTTEGPILIKPRRQPA--------HIE---ENGIIRKCNSPWNTPMVCVWNKEKQDIRLYLDFRALNS 375
            +  L    + ++  L+ K +  F  ++ D+G T+++ H+I +  + P+  + RR P         HI    ++ +IR+ +SP+ +P+V +  K+   +RL +D+R LNS
Sbjct:  301 LSALSAGEQEKVRALLGKYLTVFSLHEGDLGCTSLITHEIPLVDDAPVRQRYRRIPPSDYVAAKEHINNLLQSQVIRESSSPFASPIVLI-RKKDGGLRLCVDYRQLNS 408          

HSP 3 Score: 22.7126 bits (47), Expect = 1.469e-37
Identity = 9/16 (56.25%), Postives = 12/16 (75.00%), Query Frame = 3
Query:  786 STDRSKIEAILNFERP 833
            STD  K+EA+ N+E P
Sbjct:  556 STDPGKVEAVANWEPP 571          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Planmine SMEST
Match: SMESG000029259.1 (SMESG000029259.1)

HSP 1 Score: 174.096 bits (440), Expect = 9.338e-80
Identity = 83/139 (59.71%), Postives = 106/139 (76.26%), Query Frame = 2
Query:  374 VTERQAFPMPNIEEMLDTLNESRYFSTFDLGNAYYQVELAEKSHNMTAFPTKADQFCFSQMLFGMAAAPATFQKLMSIVLGKLNWKEAI-VYLNDILIFSKDLESHKSRLNNVLEKLQVVGLRINPEKCHFLKKEIKFL 787
            +TERQAFPMPN++E+LD L+ SRYFS+ DLGNAYYQV+L ++S   TAF TK  QFCF++M FG+AAAP TFQ+LM+ VL  L WK+ + VYL+DILIF+K  E H +    VL K+   GLR+NPEKC   +KE+KFL
Sbjct: 2790 ITERQAFPMPNVDEILDILHGSRYFSSIDLGNAYYQVKLDKESQEKTAFSTKEGQFCFNRMPFGIAAAPGTFQELMTKVLKDL-WKDGVMVYLDDILIFTKTEEDHYNIFGKVLGKIATAGLRLNPEKCQIFRKEVKFL 2927          

HSP 2 Score: 141.739 bits (356), Expect = 9.338e-80
Identity = 70/135 (51.85%), Postives = 92/135 (68.15%), Query Frame = 1
Query:   22 LCTIDAHFGGEINDSMRLKRTMEVLKIYRKSEIYNLIEKNIKAFMKNKWDIGKTNILKHKIMTTEGPILIKPRRQPAHIEE-----------NGIIRKCNSPWNTPMVCVWNKEKQDIRLYLDFRALN--SDRKA 387
            +C I+A FG  I D  RL+  ++VLK+     +  + + N   FM +KWDIG TN++KHKI+T   PI+IKPRRQP ++E+           NGIIRKCNSPWNTP+VCVW KEK+DIRL LDFR LN  ++R+A
Sbjct: 2661 ICEIEARFGRIITDEERLRHAIDVLKVTGNKRLLEIFQANKNVFMADKWDIGCTNLIKHKIITKGEPIMIKPRRQPINLEDKIEEAIKNLENNGIIRKCNSPWNTPLVCVWKKEKKDIRLCLDFRQLNKITERQA 2795          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Planmine SMEST
Match: SMESG000081257.1 (SMESG000081257.1)

HSP 1 Score: 139.813 bits (351), Expect = 4.448e-52
Identity = 67/139 (48.20%), Postives = 97/139 (69.78%), Query Frame = 2
Query:  371 TVTERQAFPMPNIEEMLDTLNESRYFSTFDLGNAYYQVELAEKSHNMTAFPTKADQFCFSQMLFGMAAAPATFQKLMSIVLGKLNWKEAIVYLNDILIFSKDLESHKSRLNNVLEKLQVVGLRINPEKCHFLKKEIKFL 787
            +VTE+ +FPMP+++ +LD L +S+ F + DLG AYY VEL E S   TAF TK  QFCF+++ FG++ APATFQKLM  +L  L +K  +VYL+DILI+ ++ E+H   L  V  +++  GL++NPEKC F K  + F+
Sbjct:  513 SVTEKFSFPMPDMQLLLDCLGKSKIFYSIDLGQAYYLVELNENSQIKTAFSTKEGQFCFNRLPFGLSTAPATFQKLMHQILEGLVFKGVVVYLDDILIYGENQETHDKLLFEVFTRIRDSGLKVNPEKCAFNKSVLNFI 651          

HSP 2 Score: 83.9593 bits (206), Expect = 4.448e-52
Identity = 50/118 (42.37%), Postives = 70/118 (59.32%), Query Frame = 1
Query:   55 INDSMRLKRTMEVLKIYRKSEIYNLIEKNIKAFMKNKWDIGKTNILKHKIMTTEGPILIKPRRQPAHIE-----------ENGIIRKCNSPWNTPMVCVWNKEKQDIRLYLDFRALNS 375
              DS RLK T+  LK+ + SE+  LI +    FM +++D+G T ++ H++ T+  PIL  PR QP H+E           E G++RKC SPWNTP+V V  K    +R+ LDFR LNS
Sbjct:  397 FTDSDRLKNTLLTLKLDKNSELGTLISQFSNIFMASRFDLGHTKVITHELKTSGPPILQNPRGQPMHLEAKVEELVQNLLEAGVVRKCQSPWNTPLVIV-GKPDGSVRICLDFRLLNS 513          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Planmine SMEST
Match: SMESG000001439.1 (SMESG000001439.1)

HSP 1 Score: 163.31 bits (412), Expect = 2.062e-50
Identity = 77/88 (87.50%), Postives = 84/88 (95.45%), Query Frame = 1
Query:    1 INNQEKVLCTIDAHFGGEINDSMRLKRTMEVLKIYRKSEIYNLIEKNIKAFMKNKWDIGKTNILKHKIMTTEGPILIKPRRQPAHIEE 264
            INNQEKV+CTIDAHFG EINDSM+LK+TMEVLKI RKSE+YNLIEKNIKAFM+NKWDIGKTNILKHKI  TEGPIL+KPRRQPAH+EE
Sbjct:   49 INNQEKVICTIDAHFGDEINDSMKLKKTMEVLKIDRKSEVYNLIEKNIKAFMENKWDIGKTNILKHKITKTEGPILVKPRRQPAHLEE 136          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Planmine SMEST
Match: SMESG000038955.1 (SMESG000038955.1)

HSP 1 Score: 134.035 bits (336), Expect = 2.421e-47
Identity = 66/139 (47.48%), Postives = 95/139 (68.35%), Query Frame = 2
Query:  371 TVTERQAFPMPNIEEMLDTLNESRYFSTFDLGNAYYQVELAEKSHNMTAFPTKADQFCFSQMLFGMAAAPATFQKLMSIVLGKLNWKEAIVYLNDILIFSKDLESHKSRLNNVLEKLQVVGLRINPEKCHFLKKEIKFL 787
            +VTE+ +F  P+++ +LD L  S+ FS+ DLG AYYQVEL E S   TAF TK  QFCF+++ FG++ APATFQKLM  +L  L +K  +VYL++ILI+ ++ E H   L  V  +++  GL++NPEKC F K  + F+
Sbjct:  202 SVTEKFSFYSPDMKLLLDCLGNSKIFSSIDLGQAYYQVELNENSQIKTAFSTKEGQFCFNRLPFGLSTAPATFQKLMHQILEGLVFKGVVVYLDEILIYGENQEIHDKLLFEVFTRIRDSGLKVNPEKCAFNKSVLNFI 340          

HSP 2 Score: 73.559 bits (179), Expect = 2.421e-47
Identity = 48/136 (35.29%), Postives = 71/136 (52.21%), Query Frame = 1
Query:    1 INNQEKVLCTIDAHFGGEINDSMRLKRTMEVLKIYRKSEIYNLIEKNIKAFMKNKWDIGKTNILKHKIMTTEGPILIKPRRQPAHIE-----------ENGIIRKCNSPWNTPMVCVWNKEKQDIRLYLDFRALNS 375
            +NN E +L         +  DS RLK T+  LK+ + S++  LI K    FM +++D+G T ++ H+I           +++P H+E           E G++RK  SPWNTP+V V  K    IR+ LDFR LNS
Sbjct:   85 VNNIESLLVN------KKFTDSDRLKITLSTLKLDKNSKLGTLISKFSNIFMASRFDLGHTKVITHEI-----------KKKPMHLEGKVEELVQNLLEAGVVRKSISPWNTPLVIV-GKLDGSIRMCLDFRLLNS 202          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Planmine SMEST
Match: SMESG000080238.1 (SMESG000080238.1)

HSP 1 Score: 163.31 bits (412), Expect = 7.081e-47
Identity = 73/133 (54.89%), Postives = 104/133 (78.20%), Query Frame = 2
Query:  389 AFPMPNIEEMLDTLNESRYFSTFDLGNAYYQVELAEKSHNMTAFPTKADQFCFSQMLFGMAAAPATFQKLMSIVLGKLNWKEAIVYLNDILIFSKDLESHKSRLNNVLEKLQVVGLRINPEKCHFLKKEIKFL 787
            AFP+PN++EMLD+LN ++YFS  DLGNA YQVEL ++S   TAF T+ DQFCF+ M F +A AP+TFQKLM++++G + W EA VYL++IL+FSK +E HK+R+N +  +++   L+INPEKC F+  E++FL
Sbjct:  157 AFPIPNVDEMLDSLNGAKYFSLTDLGNANYQVELDQESKLKTAFSTRQDQFCFNTMPFRIAVAPSTFQKLMTLIIGDMMWNEAQVYLDNILLFSKSIEEHKNRINKLFLQIRKSELKINPEKCKFVISELRFL 289          
The following BLAST results are available for this feature:
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX511082.18.770e-2135.51pep chromosome:GRCz11:9:14291932:14297132:1 gene:E... [more]
CR925755.21.311e-2034.53pep chromosome:GRCz11:17:42486740:42492668:-1 gene... [more]
BX546500.11.603e-2034.53pep chromosome:GRCz11:23:12926092:12931693:-1 gene... [more]
BX511224.14.739e-2034.53pep chromosome:GRCz11:2:18017000:18022765:1 gene:E... [more]
BX890543.11.787e-1935.51pep chromosome:GRCz11:14:42224893:42231293:-1 gene... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000006041.17.232e-3137.12pep primary_assembly:Xenopus_tropicalis_v9.1:6:373... [more]
alkbh51.762e-2939.86alkB homolog 5, RNA demethylase [Source:Xenbase;Ac... [more]
anxa66.665e-2940.29annexin A6 [Source:Xenbase;Acc:XB-GENE-989741][more]
ENSXETT00000015952.17.084e-2943.64pep primary_assembly:Xenopus_tropicalis_v9.1:8:632... [more]
ENSXETT00000034712.18.583e-2337.68pep primary_assembly:Xenopus_tropicalis_v9.1:9:335... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P04323|POL3_DROME2.056e-2941.73Retrovirus-related Pol polyprotein from transposon... [more]
sp|P20825|POL2_DROME3.262e-2941.73Retrovirus-related Pol polyprotein from transposon... [more]
sp|Q8I7P9|POL5_DROME1.364e-2535.97Retrovirus-related Pol polyprotein from transposon... [more]
sp|P10394|POL4_DROME1.238e-2233.33Retrovirus-related Pol polyprotein from transposon... [more]
sp|Q7LHG5|YI31B_YEAST2.774e-2036.36Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomy... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1X7T0X02.602e-4045.65Reverse transcriptase domain-containing protein OS... [more]
A0A5S6Q2Z42.961e-4047.83Uncharacterized protein OS=Trichuris muris OX=7041... [more]
A0A0V0RD963.032e-4047.10Retrovirus-related Pol polyprotein from transposon... [more]
A0A5S6Q6P29.273e-4047.10Uncharacterized protein OS=Trichuris muris OX=7041... [more]
A0A5S6Q4F01.305e-3947.10Uncharacterized protein OS=Trichuris muris OX=7041... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000034038.11.691e-4243.17pep primary_assembly:Astyanax_mexicanus-2.0:14:312... [more]
ENSAMXT00000052546.11.427e-3846.38pep primary_assembly:Astyanax_mexicanus-2.0:2:1303... [more]
ENSAMXT00000045469.12.074e-3845.26pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000042297.11.275e-3743.80pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000053730.11.306e-3743.80pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000045600.11.521e-4043.07pep primary_assembly:ASM223467v1:4:26167161:261711... [more]
ENSORLT00000040501.18.351e-4043.07pep primary_assembly:ASM223467v1:1:1251188:1255180... [more]
ENSORLT00000045141.18.563e-3945.65pep primary_assembly:ASM223467v1:23:22495254:22500... [more]
ENSORLT00000039099.19.675e-3843.07pep primary_assembly:ASM223467v1:16:31928608:31932... [more]
ENSORLT00000029819.11.469e-3743.07pep primary_assembly:ASM223467v1:24:6358775:636291... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029259.19.338e-8059.71SMESG000029259.1[more]
SMESG000081257.14.448e-5248.20SMESG000081257.1[more]
SMESG000001439.12.062e-5087.50SMESG000001439.1[more]
SMESG000038955.12.421e-4747.48SMESG000038955.1[more]
SMESG000080238.17.081e-4754.89SMESG000080238.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002807 ID=SMED30002807|Name=Retrovirus-related Pol polyprotein from transposon|organism=Schmidtea mediterranea sexual|type=transcript|length=833bp
ATAAATAATCAGGAAAAAGTTCTTTGTACAATAGATGCACATTTTGGTGG
GGAAATAAATGATAGCATGAGACTAAAGAGAACCATGGAAGTTCTAAAAA
TTTATAGGAAATCAGAAATATATAATTTAATTGAAAAGAATATCAAAGCG
TTTATGAAAAATAAATGGGACATTGGAAAAACAAATATTTTAAAGCATAA
AATTATGACAACAGAAGGTCCGATTTTAATAAAACCAAGGAGACAGCCAG
CGCATATAGAAGAAAATGGCATTATTAGAAAATGTAATTCTCCATGGAAC
ACACCAATGGTATGTGTATGGAATAAAGAAAAACAAGATATCAGATTATA
TTTAGATTTTCGGGCGTTAAACAGTGACAGAAAGGCAGGCATTTCCAATG
CCTAATATTGAAGAAATGTTAGATACATTAAATGAATCACGATATTTTAG
CACATTTGACTTAGGAAATGCGTACTATCAGGTAGAGCTAGCAGAAAAGT
CACATAATATGACAGCATTTCCCACAAAAGCAGACCAATTCTGTTTCAGT
CAAATGCTTTTTGGTATGGCGGCAGCCCCGGCAACTTTTCAGAAATTAAT
GAGCATAGTTTTAGGAAAGTTAAATTGGAAGGAAGCAATTGTGTATTTGA
ACGACATTCTCATATTTTCTAAGGATCTTGAAAGTCATAAAAGTCGATTA
AATAATGTACTTGAAAAACTCCAGGTAGTAGGATTAAGAATAAATCCTGA
GAAATGTCACTTTTTAAAAAAGGAAATTAAATTTCTCGACAGATAGAAGT
AAAATAGAAGCAATACTAAACTTTGAAAGACCC
back to top

protein sequence of SMED30002807-orf-1

>SMED30002807-orf-1 ID=SMED30002807-orf-1|Name=SMED30002807-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=135bp
INNQEKVLCTIDAHFGGEINDSMRLKRTMEVLKIYRKSEIYNLIEKNIKA
FMKNKWDIGKTNILKHKIMTTEGPILIKPRRQPAHIEENGIIRKCNSPWN
TPMVCVWNKEKQDIRLYLDFRALNSDRKAGISNA*
back to top

protein sequence of SMED30002807-orf-2

>SMED30002807-orf-2 ID=SMED30002807-orf-2|Name=SMED30002807-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=133bp
MPNIEEMLDTLNESRYFSTFDLGNAYYQVELAEKSHNMTAFPTKADQFCF
SQMLFGMAAAPATFQKLMSIVLGKLNWKEAIVYLNDILIFSKDLESHKSR
LNNVLEKLQVVGLRINPEKCHFLKKEIKFLDR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003104enteric muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000477RT_dom
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0004190aspartic-type endopeptidase activity
GO:0008270zinc ion binding
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.10.10.10coord: 69..133
e-value: 1.4E-11
score: 46.3
NoneNo IPR availableSUPERFAMILYSSF56672DNA/RNA polymerasescoord: 46..125