RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing

Overview
NameRAB11 binding and LisH domain, coiled-coil and HEAT repeat containing
Smed IDSMED30002798
Length (bp)3935
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing (SMED30002798) t-SNE clustered cells

Violin plots show distribution of expression levels for RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing (SMED30002798) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing (SMED30002798) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing (SMED30002798) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Human
Match: RELCH (RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing [Source:HGNC Symbol;Acc:HGNC:29289])

HSP 1 Score: 250.751 bits (639), Expect = 6.743e-68
Identity = 208/712 (29.21%), Postives = 334/712 (46.91%), Query Frame = 2
Query:   47 NQMTENITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTS-------------------HIELPSS-----RIKASPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIRSKRHIMDENVFLVDSKPNNKCEEIQT-DPMDQELIQNYISCNSDLKSSIDLLTEQLESSNYKFQKTDIQLKDQTQVIIQLKKELNDTRSK-----LICAQRDLMFESTKKKVANTGNQST---SGDTDFKSETVSNISDAINE------NPNSETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTVRNPTIN--FVKSLQLVKDDDLNHSNNLVTLVDNLDQFVSLISDILPNLFDVMQDKNNNNLTTLLVQCTCLHPDSKIREKLLRFLINLHPDPSALERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEILISMRSFNTTMINVQYG----SLCLHLNVIQFLIP 2047
             +    ++ID I+  L+ + Y LTALEL  EL+E G E   LR+YF+NP NFE  +                        PS+     ++  + SIST+DS+DFA+YSDDG ++ DE++ VLEFELRK  E ++ LR  LT  +  +         +P     N        EP+   E RALNFL+NE+LLK+ +KLT+++FS+E  DQD + WDDVGLNIPK P L    R   +       LVD     + +E++   P+   L     +  +   +   +L ++LE            L +Q   I +LK E++  +++      +C       +    K +    Q     S D    ++   +ISD  +       +PNS  FP+++ E    P+ +     V   FD+ +   +P  +   +   ++  D  L +   +  + D+    + ++   LP++   +       L  L++   CLHP+ K R++LL  L NL   P   +R MIL      + ++GP RVEAEL+ Q WE +  K      +R+L+A  CG + P  P  +RSSL+LS+ QQML E+    V   ++ S+   + Y++D DK     +++   L       E+ +S  ++V          LPA A W  +   L N   H IL  +      +   ++G     L ++L+ +Q LIP
Sbjct:   86 GETPARLSIDAIAAQLLRDQYLLTALELHTELLESGRELPRLRDYFSNPGNFERQSGTPPGMGAPGVPGAAGVGGAGGREPSTASGGGQLNRAGSISTLDSLDFARYSDDGNRETDEKVAVLEFELRKAKETIQALRANLTKAAEHE---------VPLQERKNYKSSPEIQEPIKPLEKRALNFLVNEFLLKNNYKLTSITFSDENDDQDFELWDDVGLNIPKPPDLLQLYRDFGNHQVTGKDLVDVASGVEEDELEALTPIISNLPP---TLETPQPAENSMLVQKLEDKISLLNSEKWSLMEQ---IRRLKSEMDFLKNEHFAIPAVCDSVQPPLDQLPHKDSEDSGQHPDVNSSDKGKNTDIHLSISDEADSTIPKENSPNS--FPRRERE-GMPPSSLSSKKTVH--FDKPNRKLSPAFHQALLSFCRMSADSRLGY--EVSRIADSEKSVMLMLGRCLPHIVPNVLLAKREELIPLILCTACLHPEPKERDQLLHILFNLIKRPDDEQRQMILTGCVAFARHVGPTRVEAELLPQCWEQINHK---YPERRLLVAESCGALAPYLPKEIRSSLVLSMLQQMLMEDKADLVREAVIKSLGIIMGYIDDPDKYHQGFELLLSALGDPS---ERVVSATHQV---------FLPAYAAWTTE---LGNLQSHLILTLLNKIEKLLREGEHGLDEHKLHMYLSALQSLIP 757          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Human
Match: RELCH (RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing [Source:HGNC Symbol;Acc:HGNC:29289])

HSP 1 Score: 250.366 bits (638), Expect = 3.909e-67
Identity = 208/712 (29.21%), Postives = 334/712 (46.91%), Query Frame = 2
Query:   47 NQMTENITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTS-------------------HIELPSS-----RIKASPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIRSKRHIMDENVFLVDSKPNNKCEEIQT-DPMDQELIQNYISCNSDLKSSIDLLTEQLESSNYKFQKTDIQLKDQTQVIIQLKKELNDTRSK-----LICAQRDLMFESTKKKVANTGNQST---SGDTDFKSETVSNISDAINE------NPNSETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTVRNPTIN--FVKSLQLVKDDDLNHSNNLVTLVDNLDQFVSLISDILPNLFDVMQDKNNNNLTTLLVQCTCLHPDSKIREKLLRFLINLHPDPSALERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEILISMRSFNTTMINVQYG----SLCLHLNVIQFLIP 2047
             +    ++ID I+  L+ + Y LTALEL  EL+E G E   LR+YF+NP NFE  +                        PS+     ++  + SIST+DS+DFA+YSDDG ++ DE++ VLEFELRK  E ++ LR  LT  +  +         +P     N        EP+   E RALNFL+NE+LLK+ +KLT+++FS+E  DQD + WDDVGLNIPK P L    R   +       LVD     + +E++   P+   L     +  +   +   +L ++LE            L +Q   I +LK E++  +++      +C       +    K +    Q     S D    ++   +ISD  +       +PNS  FP+++ E    P+ +     V   FD+ +   +P  +   +   ++  D  L +   +  + D+    + ++   LP++   +       L  L++   CLHP+ K R++LL  L NL   P   +R MIL      + ++GP RVEAEL+ Q WE +  K      +R+L+A  CG + P  P  +RSSL+LS+ QQML E+    V   ++ S+   + Y++D DK     +++   L       E+ +S  ++V          LPA A W  +   L N   H IL  +      +   ++G     L ++L+ +Q LIP
Sbjct:   86 GETPARLSIDAIAAQLLRDQYLLTALELHTELLESGRELPRLRDYFSNPGNFERQSGTPPGMGAPGVPGAAGVGGAGGREPSTASGGGQLNRAGSISTLDSLDFARYSDDGNRETDEKVAVLEFELRKAKETIQALRANLTKAAEHE---------VPLQERKNYKSSPEIQEPIKPLEKRALNFLVNEFLLKNNYKLTSITFSDENDDQDFELWDDVGLNIPKPPDLLQLYRDFGNHQVTGKDLVDVASGVEEDELEALTPIISNLPP---TLETPQPAENSMLVQKLEDKISLLNSEKWSLMEQ---IRRLKSEMDFLKNEHFAIPAVCDSVQPPLDQLPHKDSEDSGQHPDVNSSDKGKNTDIHLSISDEADSTIPKENSPNS--FPRRERE-GMPPSSLSSKKTVH--FDKPNRKLSPAFHQALLSFCRMSADSRLGY--EVSRIADSEKSVMLMLGRCLPHIVPNVLLAKREELIPLILCTACLHPEPKERDQLLHILFNLIKRPDDEQRQMILTGCVAFARHVGPTRVEAELLPQCWEQINHK---YPERRLLVAESCGALAPYLPKEIRSSLVLSMLQQMLMEDKADLVREAVIKSLGIIMGYIDDPDKYHQGFELLLSALGDPS---ERVVSATHQV---------FLPAYAAWTTE---LGNLQSHLILTLLNKIEKLLREGEHGLDEHKLHMYLSALQSLIP 757          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Human
Match: RELCH (RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing [Source:HGNC Symbol;Acc:HGNC:29289])

HSP 1 Score: 250.366 bits (638), Expect = 4.014e-67
Identity = 208/712 (29.21%), Postives = 334/712 (46.91%), Query Frame = 2
Query:   47 NQMTENITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTS-------------------HIELPSS-----RIKASPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIRSKRHIMDENVFLVDSKPNNKCEEIQT-DPMDQELIQNYISCNSDLKSSIDLLTEQLESSNYKFQKTDIQLKDQTQVIIQLKKELNDTRSK-----LICAQRDLMFESTKKKVANTGNQST---SGDTDFKSETVSNISDAINE------NPNSETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTVRNPTIN--FVKSLQLVKDDDLNHSNNLVTLVDNLDQFVSLISDILPNLFDVMQDKNNNNLTTLLVQCTCLHPDSKIREKLLRFLINLHPDPSALERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEILISMRSFNTTMINVQYG----SLCLHLNVIQFLIP 2047
             +    ++ID I+  L+ + Y LTALEL  EL+E G E   LR+YF+NP NFE  +                        PS+     ++  + SIST+DS+DFA+YSDDG ++ DE++ VLEFELRK  E ++ LR  LT  +  +         +P     N        EP+   E RALNFL+NE+LLK+ +KLT+++FS+E  DQD + WDDVGLNIPK P L    R   +       LVD     + +E++   P+   L     +  +   +   +L ++LE            L +Q   I +LK E++  +++      +C       +    K +    Q     S D    ++   +ISD  +       +PNS  FP+++ E    P+ +     V   FD+ +   +P  +   +   ++  D  L +   +  + D+    + ++   LP++   +       L  L++   CLHP+ K R++LL  L NL   P   +R MIL      + ++GP RVEAEL+ Q WE +  K      +R+L+A  CG + P  P  +RSSL+LS+ QQML E+    V   ++ S+   + Y++D DK     +++   L       E+ +S  ++V          LPA A W  +   L N   H IL  +      +   ++G     L ++L+ +Q LIP
Sbjct:   86 GETPARLSIDAIAAQLLRDQYLLTALELHTELLESGRELPRLRDYFSNPGNFERQSGTPPGMGAPGVPGAAGVGGAGGREPSTASGGGQLNRAGSISTLDSLDFARYSDDGNRETDEKVAVLEFELRKAKETIQALRANLTKAAEHE---------VPLQERKNYKSSPEIQEPIKPLEKRALNFLVNEFLLKNNYKLTSITFSDENDDQDFELWDDVGLNIPKPPDLLQLYRDFGNHQVTGKDLVDVASGVEEDELEALTPIISNLPP---TLETPQPAENSMLVQKLEDKISLLNSEKWSLMEQ---IRRLKSEMDFLKNEHFAIPAVCDSVQPPLDQLPHKDSEDSGQHPDVNSSDKGKNTDIHLSISDEADSTIPKENSPNS--FPRRERE-GMPPSSLSSKKTVH--FDKPNRKLSPAFHQALLSFCRMSADSRLGY--EVSRIADSEKSVMLMLGRCLPHIVPNVLLAKREELIPLILCTACLHPEPKERDQLLHILFNLIKRPDDEQRQMILTGCVAFARHVGPTRVEAELLPQCWEQINHK---YPERRLLVAESCGALAPYLPKEIRSSLVLSMLQQMLMEDKADLVREAVIKSLGIIMGYIDDPDKYHQGFELLLSALGDPS---ERVVSATHQV---------FLPAYAAWTTE---LGNLQSHLILTLLNKIEKLLREGEHGLDEHKLHMYLSALQSLIP 757          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Human
Match: RELCH (RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing [Source:HGNC Symbol;Acc:HGNC:29289])

HSP 1 Score: 250.366 bits (638), Expect = 4.846e-67
Identity = 208/712 (29.21%), Postives = 334/712 (46.91%), Query Frame = 2
Query:   47 NQMTENITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTS-------------------HIELPSS-----RIKASPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIRSKRHIMDENVFLVDSKPNNKCEEIQT-DPMDQELIQNYISCNSDLKSSIDLLTEQLESSNYKFQKTDIQLKDQTQVIIQLKKELNDTRSK-----LICAQRDLMFESTKKKVANTGNQST---SGDTDFKSETVSNISDAINE------NPNSETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTVRNPTIN--FVKSLQLVKDDDLNHSNNLVTLVDNLDQFVSLISDILPNLFDVMQDKNNNNLTTLLVQCTCLHPDSKIREKLLRFLINLHPDPSALERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEILISMRSFNTTMINVQYG----SLCLHLNVIQFLIP 2047
             +    ++ID I+  L+ + Y LTALEL  EL+E G E   LR+YF+NP NFE  +                        PS+     ++  + SIST+DS+DFA+YSDDG ++ DE++ VLEFELRK  E ++ LR  LT  +  +         +P     N        EP+   E RALNFL+NE+LLK+ +KLT+++FS+E  DQD + WDDVGLNIPK P L    R   +       LVD     + +E++   P+   L     +  +   +   +L ++LE            L +Q   I +LK E++  +++      +C       +    K +    Q     S D    ++   +ISD  +       +PNS  FP+++ E    P+ +     V   FD+ +   +P  +   +   ++  D  L +   +  + D+    + ++   LP++   +       L  L++   CLHP+ K R++LL  L NL   P   +R MIL      + ++GP RVEAEL+ Q WE +  K      +R+L+A  CG + P  P  +RSSL+LS+ QQML E+    V   ++ S+   + Y++D DK     +++   L       E+ +S  ++V          LPA A W  +   L N   H IL  +      +   ++G     L ++L+ +Q LIP
Sbjct:   86 GETPARLSIDAIAAQLLRDQYLLTALELHTELLESGRELPRLRDYFSNPGNFERQSGTPPGMGAPGVPGAAGVGGAGGREPSTASGGGQLNRAGSISTLDSLDFARYSDDGNRETDEKVAVLEFELRKAKETIQALRANLTKAAEHE---------VPLQERKNYKSSPEIQEPIKPLEKRALNFLVNEFLLKNNYKLTSITFSDENDDQDFELWDDVGLNIPKPPDLLQLYRDFGNHQVTGKDLVDVASGVEEDELEALTPIISNLPP---TLETPQPAENSMLVQKLEDKISLLNSEKWSLMEQ---IRRLKSEMDFLKNEHFAIPAVCDSVQPPLDQLPHKDSEDSGQHPDVNSSDKGKNTDIHLSISDEADSTIPKENSPNS--FPRRERE-GMPPSSLSSKKTVH--FDKPNRKLSPAFHQALLSFCRMSADSRLGY--EVSRIADSEKSVMLMLGRCLPHIVPNVLLAKREELIPLILCTACLHPEPKERDQLLHILFNLIKRPDDEQRQMILTGCVAFARHVGPTRVEAELLPQCWEQINHK---YPERRLLVAESCGALAPYLPKEIRSSLVLSMLQQMLMEDKADLVREAVIKSLGIIMGYIDDPDKYHQGFELLLSALGDPS---ERVVSATHQV---------FLPAYAAWTTE---LGNLQSHLILTLLNKIEKLLREGEHGLDEHKLHMYLSALQSLIP 757          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Zebrafish
Match: relch (RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing [Source:NCBI gene;Acc:393817])

HSP 1 Score: 172.555 bits (436), Expect = 5.502e-43
Identity = 95/211 (45.02%), Postives = 128/211 (60.66%), Query Frame = 2
Query:   62 NITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTSHIEL-------PSSRIKASPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIR 673
             +++D I+  L+ + Y LTALEL  EL+E G E   LR+YF+NP NFE  +            P   +  + SIST+DS+DFA+YSDDG +++DER+ VLEFELRK  E ++ LR  LT  +  +              NY    +T   EP+   E RALNFL+NEYLLK+ +KLT+++FS+E  DQD + WDDVGLNIPK P L    R
Sbjct:   82 RVSLDAIAAQLLRDQYILTALELHTELLEAGRELPRLRDYFSNPGNFERQSGTPPACKEQGVGPGGPLNRAGSISTLDSLDFARYSDDGNRESDERVAVLEFELRKAKETIQALRANLTQAAECEIASQ-------ERKNYKSSPET--QEPIRPLEKRALNFLVNEYLLKNEYKLTSITFSDENDDQDFELWDDVGLNIPKPPDLLQLYR 283          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Zebrafish
Match: relch (RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing [Source:NCBI gene;Acc:393817])

HSP 1 Score: 172.555 bits (436), Expect = 5.530e-43
Identity = 95/211 (45.02%), Postives = 128/211 (60.66%), Query Frame = 2
Query:   62 NITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTSHIEL-------PSSRIKASPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIR 673
             +++D I+  L+ + Y LTALEL  EL+E G E   LR+YF+NP NFE  +            P   +  + SIST+DS+DFA+YSDDG +++DER+ VLEFELRK  E ++ LR  LT  +  +              NY    +T   EP+   E RALNFL+NEYLLK+ +KLT+++FS+E  DQD + WDDVGLNIPK P L    R
Sbjct:   82 RVSLDAIAAQLLRDQYILTALELHTELLEAGRELPRLRDYFSNPGNFERQSGTPPACKEQGVGPGGPLNRAGSISTLDSLDFARYSDDGNRESDERVAVLEFELRKAKETIQALRANLTQAAECEIASQ-------ERKNYKSSPET--QEPIRPLEKRALNFLVNEYLLKNEYKLTSITFSDENDDQDFELWDDVGLNIPKPPDLLQLYR 283          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Zebrafish
Match: relch (RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing [Source:NCBI gene;Acc:393817])

HSP 1 Score: 172.555 bits (436), Expect = 6.151e-43
Identity = 95/211 (45.02%), Postives = 128/211 (60.66%), Query Frame = 2
Query:   62 NITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTSHIEL-------PSSRIKASPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIR 673
             +++D I+  L+ + Y LTALEL  EL+E G E   LR+YF+NP NFE  +            P   +  + SIST+DS+DFA+YSDDG +++DER+ VLEFELRK  E ++ LR  LT  +  +              NY    +T   EP+   E RALNFL+NEYLLK+ +KLT+++FS+E  DQD + WDDVGLNIPK P L    R
Sbjct:   82 RVSLDAIAAQLLRDQYILTALELHTELLEAGRELPRLRDYFSNPGNFERQSGTPPACKEQGVGPGGPLNRAGSISTLDSLDFARYSDDGNRESDERVAVLEFELRKAKETIQALRANLTQAAECEIASQ-------ERKNYKSSPET--QEPIRPLEKRALNFLVNEYLLKNEYKLTSITFSDENDDQDFELWDDVGLNIPKPPDLLQLYR 283          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Zebrafish
Match: relch (RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing [Source:NCBI gene;Acc:393817])

HSP 1 Score: 142.51 bits (358), Expect = 1.082e-33
Identity = 83/211 (39.34%), Postives = 115/211 (54.50%), Query Frame = 2
Query:   62 NITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTSHIEL-------PSSRIKASPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIR 673
             +++D I+  L+ + Y LTALEL  EL+E G E   LR+YF+NP NFE  +            P   +  + SIST+DS+DFA+YSDDG +++DER+   E   +++                                NY    +T   EP+   E RALNFL+NEYLLK+ +KLT+++FS+E  DQD + WDDVGLNIPK P L    R
Sbjct:   82 RVSLDAIAAQLLRDQYILTALELHTELLEAGRELPRLRDYFSNPGNFERQSGTPPACKEQGVGPGGPLNRAGSISTLDSLDFARYSDDGNRESDERVAECEIASQERK-------------------------------NYKSSPET--QEPIRPLEKRALNFLVNEYLLKNEYKLTSITFSDENDDQDFELWDDVGLNIPKPPDLLQLYR 259          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Zebrafish
Match: relch (RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing [Source:NCBI gene;Acc:393817])

HSP 1 Score: 134.035 bits (336), Expect = 4.083e-31
Identity = 70/139 (50.36%), Postives = 91/139 (65.47%), Query Frame = 2
Query:  257 SISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIR 673
            SIST+DS+DFA+YSDDG +++DER+ VLEFELRK  E ++ LR  LT  +  +              NY    +T   EP+   E RALNFL+NEYLLK+ +KLT+++FS+E  DQD + WDDVGLNIPK P L    R
Sbjct:   45 SISTLDSLDFARYSDDGNRESDERVAVLEFELRKAKETIQALRANLTQAAECEIASQ-------ERKNYKSSPET--QEPIRPLEKRALNFLVNEYLLKNEYKLTSITFSDENDDQDFELWDDVGLNIPKPPDLLQLYR 174          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Xenopus
Match: mrpl28 (mitochondrial ribosomal protein L28 [Source:Xenbase;Acc:XB-GENE-946462])

HSP 1 Score: 251.136 bits (640), Expect = 2.255e-67
Identity = 202/694 (29.11%), Postives = 329/694 (47.41%), Query Frame = 2
Query:   62 NITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTSH--------IELPSSRIKASPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIRS-------KRHIMDENVFLV--DSKPNNKCEEIQTD-------PMDQELIQNYISCNSDLKSSIDLLTEQLESSNYKFQKTDIQLKDQTQVIIQLKKELNDTRSKLICAQRD--LMFESTKKKVANTGNQSTSGDTDFKSETVSNISDAINENPNSETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTVRNPTIN--FVKSLQLVKDDDLNHSNNLVTLVDNLDQFVSLISDILPNLFDVMQDKNNNNLTTLLVQCTCLHPDSKIREKLLRFLINLHPDPSALERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEILISMRSFNTTMINVQYG----SLCLHLNVIQFLIP 2047
             + +D ++  L+ +   LTALEL  EL+E G E   LR+YF+NP NFE  T+               ++  + SIST+DS+DFA+YSDDG ++ DER+ VLEFELRK  E ++ LR  LTL +          + +P     N        EP+   E RALNFL+NEYLLK+  KLT+++FS+E  DQD + WDDVGLN PK P L    R+        + + D  V ++  D +P    ++I  D        + +EL    I CN++  +    L EQ+   N + Q   +Q ++    +       +D        + D  +  + T       G +        + E V  +S+ I  +P      +K    +  P+    +      FD+ +   +P  +   +   ++  D  L   + +  + D+ +  + ++   LP++   +       L  L++   CLHP+SK R++LL  L NL   P   +R MIL      + ++GP RVEAEL+ Q WE +  K      +R+L+A  CG + P  P  +RSSL+L++ QQML E+    V   ++ S+   + Y++D DK     +++   L       E+ +S  ++V          LPA A W ++   L + LI  +L  +      +   ++G     L ++L+ +Q LIP
Sbjct:  110 RVPLDAVAAQLLRDQLLLTALELHTELLESGRELPRLRDYFSNPGNFERATAAPPGFGGNTTASTGGQLNRAGSISTLDSLDFARYSDDGNRETDERVAVLEFELRKAKETIQALRVNLTLAAE---------NEVPLQERKNYKSSPEIQEPIKPLEKRALNFLVNEYLLKNNNKLTSITFSDENDDQDFELWDDVGLNTPKPPDLLQLYRNLSNHQTVSKDVADIAVGVIEGDLEPIQAVKQIAPDSHISQQAAIIKELEDKIILCNNEKAA----LLEQI--GNLERQIESLQKENSASGVCSAAPPTSDRLQSQTSEESDHYIDIQITDSDAKCEGTEERLPFQQSECEPVCQVSEDIPPSPELAKI-RKTTLLSAPPSKAGVH------FDKPNRKLSPAFHQALLSFCRMSADSRLG--SEVSQIADSENGVMKMLGRCLPHIVPNVLLAKREELIPLILCTACLHPESKERDQLLHILFNLIKRPDDEQRQMILTGCVAFARHVGPTRVEAELLPQCWEQINHK---YPERRLLVAESCGDLAPYLPKEIRSSLVLAMLQQMLMEDKADMVREAVIKSLGIIMGYIDDPDKYSQGFELLLTALGDPS---ERVVSATHQV---------FLPAYAAWTMELGNLQSHLIPTLLSKIEKL---LKEGEHGLDEHKLHMYLSALQSLIP 761          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Xenopus
Match: mrpl28 (mitochondrial ribosomal protein L28 [Source:Xenbase;Acc:XB-GENE-946462])

HSP 1 Score: 251.136 bits (640), Expect = 2.380e-67
Identity = 202/694 (29.11%), Postives = 329/694 (47.41%), Query Frame = 2
Query:   62 NITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTSH--------IELPSSRIKASPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIRS-------KRHIMDENVFLV--DSKPNNKCEEIQTD-------PMDQELIQNYISCNSDLKSSIDLLTEQLESSNYKFQKTDIQLKDQTQVIIQLKKELNDTRSKLICAQRD--LMFESTKKKVANTGNQSTSGDTDFKSETVSNISDAINENPNSETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTVRNPTIN--FVKSLQLVKDDDLNHSNNLVTLVDNLDQFVSLISDILPNLFDVMQDKNNNNLTTLLVQCTCLHPDSKIREKLLRFLINLHPDPSALERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEILISMRSFNTTMINVQYG----SLCLHLNVIQFLIP 2047
             + +D ++  L+ +   LTALEL  EL+E G E   LR+YF+NP NFE  T+               ++  + SIST+DS+DFA+YSDDG ++ DER+ VLEFELRK  E ++ LR  LTL +          + +P     N        EP+   E RALNFL+NEYLLK+  KLT+++FS+E  DQD + WDDVGLN PK P L    R+        + + D  V ++  D +P    ++I  D        + +EL    I CN++  +    L EQ+   N + Q   +Q ++    +       +D        + D  +  + T       G +        + E V  +S+ I  +P      +K    +  P+    +      FD+ +   +P  +   +   ++  D  L   + +  + D+ +  + ++   LP++   +       L  L++   CLHP+SK R++LL  L NL   P   +R MIL      + ++GP RVEAEL+ Q WE +  K      +R+L+A  CG + P  P  +RSSL+L++ QQML E+    V   ++ S+   + Y++D DK     +++   L       E+ +S  ++V          LPA A W ++   L + LI  +L  +      +   ++G     L ++L+ +Q LIP
Sbjct:  110 RVPLDAVAAQLLRDQLLLTALELHTELLESGRELPRLRDYFSNPGNFERATAAPPGFGGNTTASTGGQLNRAGSISTLDSLDFARYSDDGNRETDERVAVLEFELRKAKETIQALRVNLTLAAE---------NEVPLQERKNYKSSPEIQEPIKPLEKRALNFLVNEYLLKNNNKLTSITFSDENDDQDFELWDDVGLNTPKPPDLLQLYRNLSNHQTVSKDVADIAVGVIEGDLEPIQAVKQIAPDSHISQQAAIIKELEDKIILCNNEKAA----LLEQI--GNLERQIESLQKENSASGVCSAAPPTSDRLQSQTSEESDHYIDIQITDSDAKCEGTEERLPFQQSECEPVCQVSEDIPPSPELAKI-RKTTLLSAPPSKAGVH------FDKPNRKLSPAFHQALLSFCRMSADSRLG--SEVSQIADSENGVMKMLGRCLPHIVPNVLLAKREELIPLILCTACLHPESKERDQLLHILFNLIKRPDDEQRQMILTGCVAFARHVGPTRVEAELLPQCWEQINHK---YPERRLLVAESCGDLAPYLPKEIRSSLVLAMLQQMLMEDKADMVREAVIKSLGIIMGYIDDPDKYSQGFELLLTALGDPS---ERVVSATHQV---------FLPAYAAWTMELGNLQSHLIPTLLSKIEKL---LKEGEHGLDEHKLHMYLSALQSLIP 761          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Xenopus
Match: mrpl28 (mitochondrial ribosomal protein L28 [Source:Xenbase;Acc:XB-GENE-946462])

HSP 1 Score: 250.366 bits (638), Expect = 2.906e-67
Identity = 202/694 (29.11%), Postives = 329/694 (47.41%), Query Frame = 2
Query:   62 NITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTSH--------IELPSSRIKASPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIRS-------KRHIMDENVFLV--DSKPNNKCEEIQTD-------PMDQELIQNYISCNSDLKSSIDLLTEQLESSNYKFQKTDIQLKDQTQVIIQLKKELNDTRSKLICAQRD--LMFESTKKKVANTGNQSTSGDTDFKSETVSNISDAINENPNSETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTVRNPTIN--FVKSLQLVKDDDLNHSNNLVTLVDNLDQFVSLISDILPNLFDVMQDKNNNNLTTLLVQCTCLHPDSKIREKLLRFLINLHPDPSALERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEILISMRSFNTTMINVQYG----SLCLHLNVIQFLIP 2047
             + +D ++  L+ +   LTALEL  EL+E G E   LR+YF+NP NFE  T+               ++  + SIST+DS+DFA+YSDDG ++ DER+ VLEFELRK  E ++ LR  LTL +          + +P     N        EP+   E RALNFL+NEYLLK+  KLT+++FS+E  DQD + WDDVGLN PK P L    R+        + + D  V ++  D +P    ++I  D        + +EL    I CN++  +    L EQ+   N + Q   +Q ++    +       +D        + D  +  + T       G +        + E V  +S+ I  +P      +K    +  P+    +      FD+ +   +P  +   +   ++  D  L   + +  + D+ +  + ++   LP++   +       L  L++   CLHP+SK R++LL  L NL   P   +R MIL      + ++GP RVEAEL+ Q WE +  K      +R+L+A  CG + P  P  +RSSL+L++ QQML E+    V   ++ S+   + Y++D DK     +++   L       E+ +S  ++V          LPA A W ++   L + LI  +L  +      +   ++G     L ++L+ +Q LIP
Sbjct:  110 RVPLDAVAAQLLRDQLLLTALELHTELLESGRELPRLRDYFSNPGNFERATAAPPGFGGNTTASTGGQLNRAGSISTLDSLDFARYSDDGNRETDERVAVLEFELRKAKETIQALRVNLTLAAE---------NEVPLQERKNYKSSPEIQEPIKPLEKRALNFLVNEYLLKNNNKLTSITFSDENDDQDFELWDDVGLNTPKPPDLLQLYRNLSNHQTVSKDVADIAVGVIEGDLEPIQAVKQIAPDSHISQQAAIIKELEDKIILCNNEKAA----LLEQI--GNLERQIESLQKENSASGVCSAAPPTSDRLQSQTSEESDHYIDIQITDSDAKCEGTEERLPFQQSECEPVCQVSEDIPPSPELAKI-RKTTLLSAPPSKAGVH------FDKPNRKLSPAFHQALLSFCRMSADSRLG--SEVSQIADSENGVMKMLGRCLPHIVPNVLLAKREELIPLILCTACLHPESKERDQLLHILFNLIKRPDDEQRQMILTGCVAFARHVGPTRVEAELLPQCWEQINHK---YPERRLLVAESCGDLAPYLPKEIRSSLVLAMLQQMLMEDKADMVREAVIKSLGIIMGYIDDPDKYSQGFELLLTALGDPS---ERVVSATHQV---------FLPAYAAWTMELGNLQSHLIPTLLSKIEKL---LKEGEHGLDEHKLHMYLSALQSLIP 761          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Xenopus
Match: mrpl28 (mitochondrial ribosomal protein L28 [Source:Xenbase;Acc:XB-GENE-946462])

HSP 1 Score: 248.054 bits (632), Expect = 3.417e-67
Identity = 202/686 (29.45%), Postives = 327/686 (47.67%), Query Frame = 2
Query:   62 NITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTSH--------IELPSSRIKASPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIRS-------KRHIMDENVFLV--DSKPNNKCEEIQTDP-MDQELIQNYISCNSDLKSSIDLLTEQLESSNYKFQKTDIQLKDQTQVIIQLKKELNDTRSKLICAQRDLMFESTKKKVANTGNQSTSGDTDFKSETVSNISDAINENPNSETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTVRNPTIN--FVKSLQLVKDDDLNHSNNLVTLVDNLDQFVSLISDILPNLFDVMQDKNNNNLTTLLVQCTCLHPDSKIREKLLRFLINLHPDPSALERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEILISMRSFNTTMINVQYG----SLCLHLNVIQFLIP 2047
             + +D ++  L+ +   LTALEL  EL+E G E   LR+YF+NP NFE  T+               ++  + SIST+DS+DFA+YSDDG ++ DER+ VLEFELRK  E ++ LR  LTL +          + +P     N        EP+   E RALNFL+NEYLLK+  KLT+++FS+E  DQD + WDDVGLN PK P L    R+        + + D  V ++  D +P    ++I  D  + Q+       C++   +S  L ++  E S++     DIQ+ D                        D   E T++++     QS       + E V  +S+ I  +P      +K    +  P+    +      FD+ +   +P  +   +   ++  D  L   + +  + D+ +  + ++   LP++   +       L  L++   CLHP+SK R++LL  L NL   P   +R MIL      + ++GP RVEAEL+ Q WE +  K      +R+L+A  CG + P  P  +RSSL+L++ QQML E+    V   ++ S+   + Y++D DK     +++   L       E+ +S  ++V          LPA A W ++   L + LI  +L  +      +   ++G     L ++L+ +Q LIP
Sbjct:  110 RVPLDAVAAQLLRDQLLLTALELHTELLESGRELPRLRDYFSNPGNFERATAAPPGFGGNTTASTGGQLNRAGSISTLDSLDFARYSDDGNRETDERVAVLEFELRKAKETIQALRVNLTLAAE---------NEVPLQERKNYKSSPEIQEPIKPLEKRALNFLVNEYLLKNNNKLTSITFSDENDDQDFELWDDVGLNTPKPPDLLQLYRNLSNHQTVSKDVADIAVGVIEGDLEPIQAVKQIAPDSHISQKENSASGVCSAAPPTSDRLQSQTSEESDHYI---DIQITDS-----------------------DAKCEGTEERLPF--QQS-------ECEPVCQVSEDIPPSPELAKI-RKTTLLSAPPSKAGVH------FDKPNRKLSPAFHQALLSFCRMSADSRLG--SEVSQIADSENGVMKMLGRCLPHIVPNVLLAKREELIPLILCTACLHPESKERDQLLHILFNLIKRPDDEQRQMILTGCVAFARHVGPTRVEAELLPQCWEQINHK---YPERRLLVAESCGDLAPYLPKEIRSSLVLAMLQQMLMEDKADMVREAVIKSLGIIMGYIDDPDKYSQGFELLLTALGDPS---ERVVSATHQV---------FLPAYAAWTMELGNLQSHLIPTLLSKIEKL---LKEGEHGLDEHKLHMYLSALQSLIP 724          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Xenopus
Match: mrpl28 (mitochondrial ribosomal protein L28 [Source:Xenbase;Acc:XB-GENE-946462])

HSP 1 Score: 248.44 bits (633), Expect = 1.177e-66
Identity = 200/686 (29.15%), Postives = 326/686 (47.52%), Query Frame = 2
Query:   62 NITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTSH--------IELPSSRIKASPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIRS-------KRHIMDENVFLV--DSKPNNKCEEIQTDP-MDQELIQNYISCNSDLKSSIDLLTEQLESSNYKFQKTDIQLKDQTQVIIQLKKELNDTRSKLICAQRDLMFESTKKKVANTGNQSTSGDTDFKSETVSNISDAINENPNSETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTVRNPTIN--FVKSLQLVKDDDLNHSNNLVTLVDNLDQFVSLISDILPNLFDVMQDKNNNNLTTLLVQCTCLHPDSKIREKLLRFLINLHPDPSALERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEILISMRSFNTTMINVQYG----SLCLHLNVIQFLIP 2047
             + +D ++  L+ +   LTALEL  EL+E G E   LR+YF+NP NFE  T+               ++  + SIST+DS+DFA+YSDDG ++ DER+ VLEFELRK  E ++ LR  LTL +          + +P     N        EP+   E RALNFL+NEYLLK+  KLT+++FS+E  DQD + WDDVGLN PK P L    R+        + + D  V ++  D +P    ++I  D  + Q+       C++   +S  L ++  E S++     DIQ+ D                        D   E T++++    ++          E V  +S+ I  +P      +K    +  P+    +      FD+ +   +P  +   +   ++  D  L   + +  + D+ +  + ++   LP++   +       L  L++   CLHP+SK R++LL  L NL   P   +R MIL      + ++GP RVEAEL+ Q WE +  K      +R+L+A  CG + P  P  +RSSL+L++ QQML E+    V   ++ S+   + Y++D DK     +++   L       E+ +S  ++V          LPA A W ++   L + LI  +L  +      +   ++G     L ++L+ +Q LIP
Sbjct:  110 RVPLDAVAAQLLRDQLLLTALELHTELLESGRELPRLRDYFSNPGNFERATAAPPGFGGNTTASTGGQLNRAGSISTLDSLDFARYSDDGNRETDERVAVLEFELRKAKETIQALRVNLTLAAE---------NEVPLQERKNYKSSPEIQEPIKPLEKRALNFLVNEYLLKNNNKLTSITFSDENDDQDFELWDDVGLNTPKPPDLLQLYRNLSNHQTVSKDVADIAVGVIEGDLEPIQAVKQIAPDSHISQKENSASGVCSAAPPTSDRLQSQTSEESDHYI---DIQITDS-----------------------DAKCEGTEERLPFQQSE---------CEPVCQVSEDIPPSPELAKI-RKTTLLSAPPSKAGVH------FDKPNRKLSPAFHQALLSFCRMSADSRLG--SEVSQIADSENGVMKMLGRCLPHIVPNVLLAKREELIPLILCTACLHPESKERDQLLHILFNLIKRPDDEQRQMILTGCVAFARHVGPTRVEAELLPQCWEQINHK---YPERRLLVAESCGDLAPYLPKEIRSSLVLAMLQQMLMEDKADMVREAVIKSLGIIMGYIDDPDKYSQGFELLLTALGDPS---ERVVSATHQV---------FLPAYAAWTMELGNLQSHLIPTLLSKIEKL---LKEGEHGLDEHKLHMYLSALQSLIP 724          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Mouse
Match: Relch (RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing [Source:MGI Symbol;Acc:MGI:1922832])

HSP 1 Score: 256.914 bits (655), Expect = 1.909e-69
Identity = 211/706 (29.89%), Postives = 335/706 (47.45%), Query Frame = 2
Query:   47 NQMTENITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTS------HIELPSSRIKA------------------SPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIRSKRHIMDENVFLVDSKPNNKCEEIQTDPMDQELIQNYISCNSDLKSSIDLLTEQLESSNYKFQKTDIQLKDQTQVIIQ----LKKELNDTRSKLICAQRDLMFESTKKKVANTGNQSTSGDTDFKSETVS-NISDA----INENPNSETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTVRNPTIN--FVKSLQLVKDDDLNHSNNLVTLVDNLDQFVSLISDILPNLFDVMQDKNNNNLTTLLVQCTCLHPDSKIREKLLRFLINLHPDPSALERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEILISMRSFNTTMINVQYG----SLCLHLNVIQFLIP 2047
             +    ++ID I+  L+ + Y LTALEL  EL+E G E   LR+YF+NP NFE  +          +P + I                    + SIST+DS+DFA+YSDDG ++ DER+ VLEFELRK  E ++ LR  LT  +  +         +P     N        EP+   E RALNFL+NE+LLK+ +KLT+++FS+E  DQD + WDDVGLNIPK P L    R   +       LVD    +  +E + + +   L     + ++ L     LL ++LE            L +Q + +      LK E   T +     Q  L++ S K    N  + + +     K++ V   I DA    I +  +S +FP+K+ E    P+ V +   +   FD+ +   +P  +   +   ++  D  L   + +  + D+    + ++   LP++   +       L  L++   CLHP+ K R++LL  L NL   P   +R MIL      + ++GP RVEAEL+ Q WE +  K      +R+L+A  CG + P  P  +RSSL+LS+ QQML E+    V   ++ S+   + Y++D DK     +++   L       E+ +S  ++V          LPA A W  +   L + LI  +L  +      +   ++G     L ++L+ +Q LIP
Sbjct:   86 GETPARLSIDAIAAQLLRDQYLLTALELHTELLESGRELPRLRDYFSNPGNFERQSGTPPGMGAPGIPGASIVGGAGGREPSTTSGGGQLNRAGSISTLDSLDFARYSDDGNRETDERVAVLEFELRKAKETIQALRANLTKAAEHE---------VPLQERKNYKSSPEIQEPIKPLEKRALNFLVNEFLLKNNYKLTSITFSDENDDQDFELWDDVGLNIPKPPDLLQLYRDFGNHQVTGKDLVDVA--SGVDEDELEALTPILGNVPPTLDTPLPIENTLLVQKLEDKISLLNNEKWSLMEQIRRLESEMDILKAEHFATPAVGDSVQPSLVWSSQKDSEDNRQSPAVNSSDQEKTKDVHLEIPDAADSFIPKENSSGSFPRKERE-ELPPSSVSNKTTLH--FDQPNRKLSPAFHQALLSFCRMSADSRLG--SEVSRIADSEKSVMLMLGRCLPHIVPNVLLAKREELIPLILCTACLHPEPKERDQLLHILFNLIKRPDDEQRQMILTGCVAFARHVGPTRVEAELLPQCWEQINHK---YPERRLLVAESCGALAPYLPKEIRSSLVLSMLQQMLMEDKADLVREAVIKSLGIIMGYIDDPDKYQQGFELLLSALGDPS---ERVVSATHQV---------FLPAYAAWTTELGNLQSHLIPTLLNKIEKL---LREGEHGLDEHKLHMYLSALQSLIP 757          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Mouse
Match: Relch (RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing [Source:MGI Symbol;Acc:MGI:1922832])

HSP 1 Score: 256.914 bits (655), Expect = 1.943e-69
Identity = 211/706 (29.89%), Postives = 335/706 (47.45%), Query Frame = 2
Query:   47 NQMTENITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTS------HIELPSSRIKA------------------SPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIRSKRHIMDENVFLVDSKPNNKCEEIQTDPMDQELIQNYISCNSDLKSSIDLLTEQLESSNYKFQKTDIQLKDQTQVIIQ----LKKELNDTRSKLICAQRDLMFESTKKKVANTGNQSTSGDTDFKSETVS-NISDA----INENPNSETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTVRNPTIN--FVKSLQLVKDDDLNHSNNLVTLVDNLDQFVSLISDILPNLFDVMQDKNNNNLTTLLVQCTCLHPDSKIREKLLRFLINLHPDPSALERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEILISMRSFNTTMINVQYG----SLCLHLNVIQFLIP 2047
             +    ++ID I+  L+ + Y LTALEL  EL+E G E   LR+YF+NP NFE  +          +P + I                    + SIST+DS+DFA+YSDDG ++ DER+ VLEFELRK  E ++ LR  LT  +  +         +P     N        EP+   E RALNFL+NE+LLK+ +KLT+++FS+E  DQD + WDDVGLNIPK P L    R   +       LVD    +  +E + + +   L     + ++ L     LL ++LE            L +Q + +      LK E   T +     Q  L++ S K    N  + + +     K++ V   I DA    I +  +S +FP+K+ E    P+ V +   +   FD+ +   +P  +   +   ++  D  L   + +  + D+    + ++   LP++   +       L  L++   CLHP+ K R++LL  L NL   P   +R MIL      + ++GP RVEAEL+ Q WE +  K      +R+L+A  CG + P  P  +RSSL+LS+ QQML E+    V   ++ S+   + Y++D DK     +++   L       E+ +S  ++V          LPA A W  +   L + LI  +L  +      +   ++G     L ++L+ +Q LIP
Sbjct:   86 GETPARLSIDAIAAQLLRDQYLLTALELHTELLESGRELPRLRDYFSNPGNFERQSGTPPGMGAPGIPGASIVGGAGGREPSTTSGGGQLNRAGSISTLDSLDFARYSDDGNRETDERVAVLEFELRKAKETIQALRANLTKAAEHE---------VPLQERKNYKSSPEIQEPIKPLEKRALNFLVNEFLLKNNYKLTSITFSDENDDQDFELWDDVGLNIPKPPDLLQLYRDFGNHQVTGKDLVDVA--SGVDEDELEALTPILGNVPPTLDTPLPIENTLLVQKLEDKISLLNNEKWSLMEQIRRLESEMDILKAEHFATPAVGDSVQPSLVWSSQKDSEDNRQSPAVNSSDQEKTKDVHLEIPDAADSFIPKENSSGSFPRKERE-ELPPSSVSNKTTLH--FDQPNRKLSPAFHQALLSFCRMSADSRLG--SEVSRIADSEKSVMLMLGRCLPHIVPNVLLAKREELIPLILCTACLHPEPKERDQLLHILFNLIKRPDDEQRQMILTGCVAFARHVGPTRVEAELLPQCWEQINHK---YPERRLLVAESCGALAPYLPKEIRSSLVLSMLQQMLMEDKADLVREAVIKSLGIIMGYIDDPDKYQQGFELLLSALGDPS---ERVVSATHQV---------FLPAYAAWTTELGNLQSHLIPTLLNKIEKL---LREGEHGLDEHKLHMYLSALQSLIP 757          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Mouse
Match: Relch (RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing [Source:MGI Symbol;Acc:MGI:1922832])

HSP 1 Score: 228.409 bits (581), Expect = 2.582e-60
Identity = 200/706 (28.33%), Postives = 323/706 (45.75%), Query Frame = 2
Query:   47 NQMTENITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTS------HIELPSSRIKA------------------SPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIRSKRHIMDENVFLVDSKPNNKCEEIQTDPMDQELIQNYISCNSDLKSSIDLLTEQLESSNYKFQKTDIQLKDQTQVIIQ----LKKELNDTRSKLICAQRDLMFESTKKKVANTGNQSTSGDTDFKSETVS-NISDA----INENPNSETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTVRNPTIN--FVKSLQLVKDDDLNHSNNLVTLVDNLDQFVSLISDILPNLFDVMQDKNNNNLTTLLVQCTCLHPDSKIREKLLRFLINLHPDPSALERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEILISMRSFNTTMINVQYG----SLCLHLNVIQFLIP 2047
             +    ++ID I+  L+ + Y LTALEL  EL+E G E   LR+YF+NP NFE  +          +P + I                    + SIST+DS+DFA+YSDDG ++ DER+   E  L+++                                NY    +    EP+   E RALNFL+NE+LLK+ +KLT+++FS+E  DQD + WDDVGLNIPK P L    R   +       LVD    +  +E + + +   L     + ++ L     LL ++LE            L +Q + +      LK E   T +     Q  L++ S K    N  + + +     K++ V   I DA    I +  +S +FP+K+ E    P+ V +   +   FD+ +   +P  +   +   ++  D  L   + +  + D+    + ++   LP++   +       L  L++   CLHP+ K R++LL  L NL   P   +R MIL      + ++GP RVEAEL+ Q WE +  K      +R+L+A  CG + P  P  +RSSL+LS+ QQML E+    V   ++ S+   + Y++D DK     +++   L       E+ +S  ++V          LPA A W  +   L + LI  +L  +      +   ++G     L ++L+ +Q LIP
Sbjct:   86 GETPARLSIDAIAAQLLRDQYLLTALELHTELLESGRELPRLRDYFSNPGNFERQSGTPPGMGAPGIPGASIVGGAGGREPSTTSGGGQLNRAGSISTLDSLDFARYSDDGNRETDERVAEHEVPLQERK-------------------------------NYKSSPEI--QEPIKPLEKRALNFLVNEFLLKNNYKLTSITFSDENDDQDFELWDDVGLNIPKPPDLLQLYRDFGNHQVTGKDLVDVA--SGVDEDELEALTPILGNVPPTLDTPLPIENTLLVQKLEDKISLLNNEKWSLMEQIRRLESEMDILKAEHFATPAVGDSVQPSLVWSSQKDSEDNRQSPAVNSSDQEKTKDVHLEIPDAADSFIPKENSSGSFPRKERE-ELPPSSVSNKTTLH--FDQPNRKLSPAFHQALLSFCRMSADSRLG--SEVSRIADSEKSVMLMLGRCLPHIVPNVLLAKREELIPLILCTACLHPEPKERDQLLHILFNLIKRPDDEQRQMILTGCVAFARHVGPTRVEAELLPQCWEQINHK---YPERRLLVAESCGALAPYLPKEIRSSLVLSMLQQMLMEDKADLVREAVIKSLGIIMGYIDDPDKYQQGFELLLSALGDPS---ERVVSATHQV---------FLPAYAAWTTELGNLQSHLIPTLLNKIEKL---LREGEHGLDEHKLHMYLSALQSLIP 733          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Mouse
Match: Relch (RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing [Source:MGI Symbol;Acc:MGI:1922832])

HSP 1 Score: 161.77 bits (408), Expect = 7.110e-43
Identity = 95/233 (40.77%), Postives = 129/233 (55.36%), Query Frame = 2
Query:   47 NQMTENITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTS------HIELPSSRIKA------------------SPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIR 673
             +    ++ID I+  L+ + Y LTALEL  EL+E G E   LR+YF+NP NFE  +          +P + I                    + SIST+DS+DFA+YSDDG ++ DER+ VLEFELRK  E ++ LR  LT  +  +         +P     N        EP+   E RALNFL+NE+LLK+ +KLT+++FS+E  DQD + WDDVGLNIPK P L    R
Sbjct:   86 GETPARLSIDAIAAQLLRDQYLLTALELHTELLESGRELPRLRDYFSNPGNFERQSGTPPGMGAPGIPGASIVGGAGGREPSTTSGGGQLNRAGSISTLDSLDFARYSDDGNRETDERVAVLEFELRKAKETIQALRANLTKAAEHE---------VPLQERKNYKSSPEIQEPIKPLEKRALNFLVNEFLLKNNYKLTSITFSDENDDQDFELWDDVGLNIPKPPDLLQLYR 309          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Mouse
Match: Relch (RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing [Source:MGI Symbol;Acc:MGI:1922832])

HSP 1 Score: 57.7658 bits (138), Expect = 7.821e-10
Identity = 30/63 (47.62%), Postives = 39/63 (61.90%), Query Frame = 2
Query: 1370 LVQCT-CLHPDSKIREKLLRFLINLHPDPSALERLMILKQIRILSGYLGPFRVEAELITQIWE 1555
            L+ CT CLHP+ K R++LL  L NL   P   +R MIL      + ++GP RVEAEL+ Q WE
Sbjct:    8 LILCTACLHPEPKERDQLLHILFNLIKRPDDEQRQMILTGCVAFARHVGPTRVEAELLPQCWE 70          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. UniProt/SwissProt
Match: sp|Q148V7|RELCH_MOUSE (RAB11-binding protein RELCH OS=Mus musculus OX=10090 GN=Relch PE=1 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 1.312e-68
Identity = 211/706 (29.89%), Postives = 335/706 (47.45%), Query Frame = 2
Query:   47 NQMTENITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTS------HIELPSSRIKA------------------SPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIRSKRHIMDENVFLVDSKPNNKCEEIQTDPMDQELIQNYISCNSDLKSSIDLLTEQLESSNYKFQKTDIQLKDQTQVIIQ----LKKELNDTRSKLICAQRDLMFESTKKKVANTGNQSTSGDTDFKSETVS-NISDA----INENPNSETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTVRNPTIN--FVKSLQLVKDDDLNHSNNLVTLVDNLDQFVSLISDILPNLFDVMQDKNNNNLTTLLVQCTCLHPDSKIREKLLRFLINLHPDPSALERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEILISMRSFNTTMINVQYG----SLCLHLNVIQFLIP 2047
             +    ++ID I+  L+ + Y LTALEL  EL+E G E   LR+YF+NP NFE  +          +P + I                    + SIST+DS+DFA+YSDDG ++ DER+ VLEFELRK  E ++ LR  LT  +  +         +P     N        EP+   E RALNFL+NE+LLK+ +KLT+++FS+E  DQD + WDDVGLNIPK P L    R   +       LVD    +  +E + + +   L     + ++ L     LL ++LE            L +Q + +      LK E   T +     Q  L++ S K    N  + + +     K++ V   I DA    I +  +S +FP+K+ E    P+ V +   +   FD+ +   +P  +   +   ++  D  L   + +  + D+    + ++   LP++   +       L  L++   CLHP+ K R++LL  L NL   P   +R MIL      + ++GP RVEAEL+ Q WE +  K      +R+L+A  CG + P  P  +RSSL+LS+ QQML E+    V   ++ S+   + Y++D DK     +++   L       E+ +S  ++V          LPA A W  +   L + LI  +L  +      +   ++G     L ++L+ +Q LIP
Sbjct:   86 GETPARLSIDAIAAQLLRDQYLLTALELHTELLESGRELPRLRDYFSNPGNFERQSGTPPGMGAPGIPGASIVGGAGGREPSTTSGGGQLNRAGSISTLDSLDFARYSDDGNRETDERVAVLEFELRKAKETIQALRANLTKAAEHE---------VPLQERKNYKSSPEIQEPIKPLEKRALNFLVNEFLLKNNYKLTSITFSDENDDQDFELWDDVGLNIPKPPDLLQLYRDFGNHQVTGKDLVDVA--SGVDEDELEALTPILGNVPPTLDTPLPIENTLLVQKLEDKISLLNNEKWSLMEQIRRLESEMDILKAEHFATPAVGDSVQPSLVWSSQKDSEDNRQSPAVNSSDQEKTKDVHLEIPDAADSFIPKENSSGSFPRKERE-ELPPSSVSNKTTLH--FDQPNRKLSPAFHQALLSFCRMSADSRLG--SEVSRIADSEKSVMLMLGRCLPHIVPNVLLAKREELIPLILCTACLHPEPKERDQLLHILFNLIKRPDDEQRQMILTGCVAFARHVGPTRVEAELLPQCWEQINHK---YPERRLLVAESCGALAPYLPKEIRSSLVLSMLQQMLMEDKADLVREAVIKSLGIIMGYIDDPDKYQQGFELLLSALGDPS---ERVVSATHQV---------FLPAYAAWTTELGNLQSHLIPTLLNKIEKL---LREGEHGLDEHKLHMYLSALQSLIP 757          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. UniProt/SwissProt
Match: sp|Q9P260|RELCH_HUMAN (RAB11-binding protein RELCH OS=Homo sapiens OX=9606 GN=RELCH PE=1 SV=2)

HSP 1 Score: 250.366 bits (638), Expect = 1.877e-66
Identity = 208/712 (29.21%), Postives = 334/712 (46.91%), Query Frame = 2
Query:   47 NQMTENITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTS-------------------HIELPSS-----RIKASPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIRSKRHIMDENVFLVDSKPNNKCEEIQT-DPMDQELIQNYISCNSDLKSSIDLLTEQLESSNYKFQKTDIQLKDQTQVIIQLKKELNDTRSK-----LICAQRDLMFESTKKKVANTGNQST---SGDTDFKSETVSNISDAINE------NPNSETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTVRNPTIN--FVKSLQLVKDDDLNHSNNLVTLVDNLDQFVSLISDILPNLFDVMQDKNNNNLTTLLVQCTCLHPDSKIREKLLRFLINLHPDPSALERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEILISMRSFNTTMINVQYG----SLCLHLNVIQFLIP 2047
             +    ++ID I+  L+ + Y LTALEL  EL+E G E   LR+YF+NP NFE  +                        PS+     ++  + SIST+DS+DFA+YSDDG ++ DE++ VLEFELRK  E ++ LR  LT  +  +         +P     N        EP+   E RALNFL+NE+LLK+ +KLT+++FS+E  DQD + WDDVGLNIPK P L    R   +       LVD     + +E++   P+   L     +  +   +   +L ++LE            L +Q   I +LK E++  +++      +C       +    K +    Q     S D    ++   +ISD  +       +PNS  FP+++ E    P+ +     V   FD+ +   +P  +   +   ++  D  L +   +  + D+    + ++   LP++   +       L  L++   CLHP+ K R++LL  L NL   P   +R MIL      + ++GP RVEAEL+ Q WE +  K      +R+L+A  CG + P  P  +RSSL+LS+ QQML E+    V   ++ S+   + Y++D DK     +++   L       E+ +S  ++V          LPA A W  +   L N   H IL  +      +   ++G     L ++L+ +Q LIP
Sbjct:   86 GETPARLSIDAIAAQLLRDQYLLTALELHTELLESGRELPRLRDYFSNPGNFERQSGTPPGMGAPGVPGAAGVGGAGGREPSTASGGGQLNRAGSISTLDSLDFARYSDDGNRETDEKVAVLEFELRKAKETIQALRANLTKAAEHE---------VPLQERKNYKSSPEIQEPIKPLEKRALNFLVNEFLLKNNYKLTSITFSDENDDQDFELWDDVGLNIPKPPDLLQLYRDFGNHQVTGKDLVDVASGVEEDELEALTPIISNLPP---TLETPQPAENSMLVQKLEDKISLLNSEKWSLMEQ---IRRLKSEMDFLKNEHFAIPAVCDSVQPPLDQLPHKDSEDSGQHPDVNSSDKGKNTDIHLSISDEADSTIPKENSPNS--FPRRERE-GMPPSSLSSKKTVH--FDKPNRKLSPAFHQALLSFCRMSADSRLGY--EVSRIADSEKSVMLMLGRCLPHIVPNVLLAKREELIPLILCTACLHPEPKERDQLLHILFNLIKRPDDEQRQMILTGCVAFARHVGPTRVEAELLPQCWEQINHK---YPERRLLVAESCGALAPYLPKEIRSSLVLSMLQQMLMEDKADLVREAVIKSLGIIMGYIDDPDKYHQGFELLLSALGDPS---ERVVSATHQV---------FLPAYAAWTTE---LGNLQSHLILTLLNKIEKLLREGEHGLDEHKLHMYLSALQSLIP 757          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. UniProt/SwissProt
Match: sp|Q08BT5|RELCH_XENTR (RAB11-binding protein RELCH homolog OS=Xenopus tropicalis OX=8364 GN=relch PE=2 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 5.285e-57
Identity = 190/694 (27.38%), Postives = 316/694 (45.53%), Query Frame = 2
Query:   62 NITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTSH--------IELPSSRIKASPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIRS-------KRHIMDENVFLV--DSKPNNKCEEIQTD-------PMDQELIQNYISCNSDLKSSIDLLTEQLESSNYKFQKTDIQLKDQTQVIIQLKKELNDTRSKLICAQRD--LMFESTKKKVANTGNQSTSGDTDFKSETVSNISDAINENPNSETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTVRNPTIN--FVKSLQLVKDDDLNHSNNLVTLVDNLDQFVSLISDILPNLFDVMQDKNNNNLTTLLVQCTCLHPDSKIREKLLRFLINLHPDPSALERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEILISMRSFNTTMINVQYG----SLCLHLNVIQFLIP 2047
             + +D ++  L+ +   LTALEL  EL+E G E   LR+YF+NP NFE  T+               ++  + SIST+DS+DFA+YSDDG ++ DER+   E  L+++                                NY    +    EP+   E RALNFL+NEYLLK+  KLT+++FS+E  DQD + WDDVGLN PK P L    R+        + + D  V ++  D +P    ++I  D        + +EL    I CN++  +    L EQ+   N + Q   +Q ++    +       +D        + D  +  + T       G +        + E V  +S+ I  +P      +K    +  P+    +      FD+ +   +P  +   +   ++  D  L   + +  + D+ +  + ++   LP++   +       L  L++   CLHP+SK R++LL  L NL   P   +R MIL      + ++GP RVEAEL+ Q WE +  K      +R+L+A  CG + P  P  +RSSL+L++ QQML E+    V   ++ S+   + Y++D DK     +++   L       E+ +S  ++V          LPA A W ++   L + LI  +L  +      +   ++G     L ++L+ +Q LIP
Sbjct:  110 RVPLDAVAAQLLRDQLLLTALELHTELLESGRELPRLRDYFSNPGNFERATAAPPGFGGNTTASTGGQLNRAGSISTLDSLDFARYSDDGNRETDERVAENEVPLQERK-------------------------------NYKSSPEI--QEPIKPLEKRALNFLVNEYLLKNNNKLTSITFSDENDDQDFELWDDVGLNTPKPPDLLQLYRNLSNHQTVSKDVADIAVGVIEGDLEPIQAVKQIAPDSHISQQAAIIKELEDKIILCNNEKAA----LLEQI--GNLERQIESLQKENSASGVCSAAPPTSDRLQSQTSEESDHYIDIQITDSDAKCEGTEERLPFQQSECEPVCQVSEDIPPSPELAKI-RKTTLLSAPPSKAGVH------FDKPNRKLSPAFHQALLSFCRMSADSRLG--SEVSQIADSENGVMKMLGRCLPHIVPNVLLAKREELIPLILCTACLHPESKERDQLLHILFNLIKRPDDEQRQMILTGCVAFARHVGPTRVEAELLPQCWEQINHK---YPERRLLVAESCGDLAPYLPKEIRSSLVLAMLQQMLMEDKADMVREAVIKSLGIIMGYIDDPDKYSQGFELLLTALGDPS---ERVVSATHQV---------FLPAYAAWTMELGNLQSHLIPTLLSKIEKL---LKEGEHGLDEHKLHMYLSALQSLIP 737          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. UniProt/SwissProt
Match: sp|Q6P6Y1|RELCH_DANRE (RAB11-binding protein RELCH homolog OS=Danio rerio OX=7955 GN=relch PE=2 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 3.897e-42
Identity = 95/211 (45.02%), Postives = 128/211 (60.66%), Query Frame = 2
Query:   62 NITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTSHIEL-------PSSRIKASPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIR 673
             +++D I+  L+ + Y LTALEL  EL+E G E   LR+YF+NP NFE  +            P   +  + SIST+DS+DFA+YSDDG +++DER+ VLEFELRK  E ++ LR  LT  +  +              NY    +T   EP+   E RALNFL+NEYLLK+ +KLT+++FS+E  DQD + WDDVGLNIPK P L    R
Sbjct:   82 RVSLDAIAAQLLRDQYILTALELHTELLEAGRELPRLRDYFSNPGNFERQSGTPPACKEQGVGPGGPLNRAGSISTLDSLDFARYSDDGNRESDERVAVLEFELRKAKETIQALRANLTQAAECEIASQ-------ERKNYKSSPET--QEPIRPLEKRALNFLVNEYLLKNEYKLTSITFSDENDDQDFELWDDVGLNIPKPPDLLQLYR 283          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. TrEMBL
Match: A0A4D5RUA0 (Protein phosphatase 2a regulatory subunit a (Fragment) OS=Ixodes scapularis OX=6945 PE=4 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 1.560e-76
Identity = 310/1153 (26.89%), Postives = 508/1153 (44.06%), Query Frame = 2
Query:   62 NITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTSHIELPSSRIKASP------SISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIR----------SKRHIMDENVFLVDSKPNNKCEEIQTDPMDQELIQNYISC-----------NSDLKSSID-LLTEQLESSNYKFQKTDIQLKDQTQVIIQLKKELNDTRSKLICAQRDLMFESTKKKVANTGNQSTSGDTDFKSETVSNISDAINENPNSETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTVRNPTINFVKSLQLVKDD-----DLNHSNNLVTLVDNLDQFVSLISDILPNLFDVMQDKNNNNLTTLLVQCTCLHPDSKIREKLLRFLINLHPDPSALERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLI---------HEILISMRSFNTTMINVQYGSLCLHLNVIQFL---IPFIDVWIKLSTPQVFNEIVDDKDSDFIANSDNSKILE--LYRTDVIVNREKYIKSQKSFLHYTSINIPMSSITDLDESTIDSKEMIQGWF-IWPQLKWLQTELVNTLVDFLFNIRSKTDKVDLTNPQTMSDIAKNQFTANPLKSKETCLKIGAIMFELGCRFSVPVINNVFIPCFSHLLYESSSKGVD-----CNLKSEIISTGIVSGYCALLASLIQLDHSHAASENLKRFLTNISFLVAAESLSYDGVRLAIDVXXXXXXXXXXXXEIIISSLQPCIGCPNVSVRLFVCLMIQELVVQWATLP-TIEDNNFGSVINSLKNLIDSPHEVVKVMCVGPLVSLLQVKSATPVIRKQIYDCLSELMNESVNFKSESLEKTHSSTPCTEVLITALIQMINVVGPTSPESFRDESILPWLFGITEINNGTSDTARRSGIAMILYSTFSTLS 3358
            ++TID I+  L+ +N+ LTALEL  EL+E G E   LR+YF+NP NFE   SH    SS    SP      S+ T DS+DFA+YSDDG +Q DER+ VLEFELRK  E +K LR  LT+          V +  PN+ +   ++ T S +PL  HE RA+NFL+NEYLLK  +KLT+++FS+E  DQD + WDDVGLNIPK P      R          S      +   L +  P+ + +E++    ++E+++  +             N+ L S +D  L  Q E S       +I  +  ++++     E +   S L+ A +  + +   ++  N   + +  D+ F  + +      +      +  P K  E+                   ++T R  +  F+++L  V        D+  + ++  +    D+ V ++S  LP++   +       L  LL+    LHPD++ R+ LL  L NL   P   +R +IL  +  ++  LG  RVEAEL+ Q WE +  K      +R+L+A  CG + P   S +RSSL+LS+ QQML+EE +  V      S+A  + Y++D DK    + +         +LL   +  + +    +V +  LLP+VA W ++   L   L+         H   + MRS +  M ++        +N+++ L   +PF+ V +  S P V    + D  S     +D  +  E  L     IV  +    S+ + L           +T  DE       + Q WF  WP   W    L++  + FL NI + T     +  + +S++ +N                       GC F+    ++   P FS LL  + +  V       N  + I + G+++ +C           S      L  FL ++ F+V+   +S   ++  +      LG      E ++++L   +   +  VR     + + LV   AT+P T+  N    V  +L  L   P   V+V  V P  ++L + +   ++ K      + L +             H    C +V     IQM   +GP +   FRDE ILP L  +   NN  +  + R+ +A +L   ++ LS
Sbjct:   39 DVTIDRIASKLLKDNFILTALELHAELLESGRELPRLRDYFSNPGNFEK-HSH----SSAFDVSPVLPRTSSVQTFDSLDFARYSDDGEKQLDERVAVLEFELRKARETIKNLRANLTV----------VTESDPNTPDNGSEHTTVSEDPLRPHERRAVNFLVNEYLLKQDYKLTSITFSDENEDQDFEDWDDVGLNIPKPPDFLQLYRNYNKHARQWCSTTECAAQTEALDEPSPSAREQELKAVAFEKEVLETQVEQLKLQLEKANQENAALTSELDKALNSQAELSFKPVLPFEIMAETLSEMV-----EPSVPDSPLLTASKSPLRKRLPEERGNLPEEGSPIDSTFHKDDLDVAVFGVE-----QVTPAKLRESR-----------------PITTARKMSPAFLEALVSVGHPQSQLADMRLAWDVTHVAATGDEVVLMLSRCLPHIVPNVLLAKREELVPLLLAAINLHPDARERDALLNLLFNLTKRPDDDQRRVILAGLLSVAQCLGHARVEAELLPQCWEQISHK---YPERRLLVAESCGYLAPQVASEIRSSLLLSMLQQMLKEEKEELVRQAAARSLAVLLAYVDDPDKFLQAVDL---------ALL---VVADEQPEMAEVAQSVLLPSVACWALEKGQLETALLTTLMKLLEDHVRALDMRSADGVM-SLSQAEEQHSVNLVKALGAALPFLLVHVLESGPYVARLNLHDSISPCSLPADRLRPSENPLLEPATIVGDD----SRTALL-----------VTAFDE------HIGQEWFKTWPAFDW----LLSKFIPFLTNIATSTKPHSRSTVRALSELVRN------------------FCQLFGCTFT----HSKVKPAFSALLPLTDASSVASREALTNATAPIYACGVLTAFC-----------SETDRRELVGFLKSLLFVVSLCDVSLASIQSTL----LELGCDRNHQETLLAALWEGVVHASPLVRANAARLFELLV---ATVPDTLLKNR---VAPALVTLASDPEISVRVGTVRPFGTILALSTQKELLDKAFLQLQTFLED-----------PQHRDNHCMQV---EFIQMFASLGPNTEPRFRDEFILPHLAVLAIRNNQNASDSLRAEVAELLLEAYTALS 1051          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. TrEMBL
Match: A0A5K3EI07 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 288.886 bits (738), Expect = 5.191e-76
Identity = 307/1086 (28.27%), Postives = 491/1086 (45.21%), Query Frame = 2
Query:   56 TENITIDD--ISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTSHIELPSSRIK---ASPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWI-PNSSNYNDDYDTFSAEPLMAH-ENRALNFLINEYLLKHGFKLTAVSFSEE---ITDQDLDTWDDVGLNIPKLPHLESFIRSKRHIMDENV------FLVDSKPNNKCEEIQTDPMDQELIQNYISCNSDLKSSIDLLTEQLESS---------NYKFQKTDIQLKDQTQVIIQ------------LKKELNDTRSKLICAQRD---LMFESTKKKVANTG-NQSTSGDTDFKSETVSNISDAIN--ENPNSETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTV--------RNPTINFVK-SLQLVKDDDLNH-SNNLVTLVDNLDQFVSLISDILPNLFDVMQDKNNNNLTTLLVQCTCLHPDSKIREKLLRFLINL---HPDPSALE-----RLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYL---WKSES-------LLEKKISTENEVNGEDVVKFQ----LLPAVAQWCIDADVLHNFLIHEILISMRSF------------------NTTMINVQYGSLCLH--LNVIQFLIPFI--DVWIKLSTPQVFN-EIVDDKDSDFIANSDNSKIL---------------ELYRTDVIVNREKYIKSQKSFLHYTSINIPMSSITDLDESTIDSKEMIQGWF------IWPQLKWLQTELVNTLVDFLFNIRSKTDKVDLTN------------PQTMSDIAKNQFTAN---PLK----------SKETCLKIGAIMFELGCRFSVPVINNVFIPCFSHLLYESSSKGVDCNLKSEIISTGIVSGYCALLASLIQLDHSHAASENLKRFLTNISFLVAAESLSYDGVRLAIDVXXXXXXXXXXXXEIIISSLQPCIGCPNVSVR 2881
            T+N T+ +   S +LI   Y LTALE  +E +ERGI+   L  +F+NP+NFE    HI+LP   +    +  S+ST+DS D    S+D     +E+ KVLEFELRKKNEE+K LRE LT  +    N +  +D I P  S    DY    A   M++ E RAL+FLINEYLL  G+KLTAV FSEE   +  QDLD WDDVGL   + P L S +++        +       LV               +D+E +Q         ++   +L E LESS         NY   K ++++  Q    ++            L +E    R++++C +RD   L+  + KK   N+  N + + +T    E   ++  A    EN  S+  P   +     P   + ++ +  +  EV  +        R     FV+ + +L+    ++        L D LD+ +  + D++  +   + D+  +    LL+Q  CLHPD+ +R++LLR L NL    P+P + E       +IL Q R L+  LGP R+E+EL+ QIW  L E+P  +S  R LL + CGV+ P  PS LRSSL+LSI  Q +EEE D +V A  L S+A+ +  +ED DK+P +     R L   W   +       L+ +++ T   +     V       LLP VA+WC++ D L   L+   L  ++S                    +  + +Q+ +  L   + V+  L+PF+   V   L+  + +     DD D   + N+D  +                  L+    I+ R++Y +  KSF H     + + S+  + +  +   + +   F       WP +  ++  L+  + + L  +   ++ +D               PQ    + + QF  N   P +           KE C  +  I    G   +  V   ++ P  S L+  S     + +LK+  + +G+ +GYC LLAS      S +    +K  + N  FL + +S S  GVR AI  L      A +  E+++ +L+ C  C + +VR
Sbjct:    9 TDNYTLPENSFSEYLIKEKYFLTALEFHYEQLERGIKCDLLEEFFSNPDNFE----HIDLPQPGLAPNFSCVSVSTLDSPDLQTVSEDQ-NSLEEQFKVLEFELRKKNEEIKSLRELLTSATLGAPNVTESLDSITPTPS----DYRLSKAVSQMSNIEARALHFLINEYLLSSGYKLTAVQFSEECEALEQQDLDDWDDVGLTCDRPPSLPSLLKASWLPQSSGLPSRPMLKLVPQLRAKGASLSNHQAIDEEAVQT--------EAVASVLREDLESSRTAISILQCNYDATKAELEVSRQHVADLRGKVTRLESENLSLSQESTYWRNQILCLKRDFPDLVGTAVKKTNRNSALNGTANRNTIDSHEATLDLGSAGKAVENGQSQGIPPSPSPLPSPPPPPQPDHPLPEVVVEVPKLSINEPMFRRQSHPEFVRCASELLPPAVIDEFPFEAFRLADTLDELIVTVGDLIQGILKHLPDEMKSLALPLLIQAICLHPDAAVRDQLLRALFNLFTESPEPGSKEVEVKRTDVILPQCRDLATCLGPQRIESELLPQIWSQLNERP--SSCLRKLLNSACGVIAPATPSRLRSSLLLSILLQSIEEEKDEQVKAVALRSLAAVVVLMEDRDKLPQLATTFERSLRETWGDATTTLPYPQLVYERVPTVLPIAASLTVAEASCNWLLPTVAEWCLEVDSLKPLLLDPWLEKLKSLCFENEMSKSKSNCNGSSEKSIRLKLQFSTSELFRIMTVLNRLVPFLFASVLQSLAFIKPYRTSFEDDCDDLVLENTDAHEEAVNEAGERDFPIDHWEYLFVPQCILGRKRYEELVKSFEH-----VLVGSMKSVSDGAVGEGDDVASAFNGACEGEWPAMDDVRQHLLLPIAEMLRAMNPHSNSIDEGTEAHEYLEQDPILPQEFLSLMQTQFDDNFWLPWRLRPASCTLTLCKELCFYVSLIGKAFG---TAAVQKYLYEPFHSQLMERSVQGYFEFDLKA--LPSGVFAGYCCLLAS----TKSKSELNKVKMLIANAIFLHSRDSCSLHGVRAAIMALCYTEDAAGVCREVLLPALRSCASCADPAVR 1061          

HSP 2 Score: 63.929 bits (154), Expect = 3.146e-6
Identity = 29/65 (44.62%), Postives = 41/65 (63.08%), Query Frame = 2
Query: 3173 EVLITALIQMINVVGPTSPESFRDESILPWLFGITEINNGTSDTARRSGIAMILYSTFSTLSYCI 3367
            E L++ L+Q+ N + PT  E FRD  ILPWL+ +TEINN   D  +R+ +   L   FST S+C+
Sbjct: 1234 ETLVSGLLQVANRLLPTCSEDFRDTKILPWLYRLTEINNMIPDMEQRTRLGQRLTLVFSTASFCL 1298          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. TrEMBL
Match: A0A4S2M279 (LisH domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003236 PE=4 SV=1)

HSP 1 Score: 287.345 bits (734), Expect = 1.124e-75
Identity = 287/1049 (27.36%), Postives = 472/1049 (45.00%), Query Frame = 2
Query:   65 ITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTSHIELPS-SRIKASPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEP--LMAHENRALNFLINEYLLKHGFKLTAVSFSEE---ITDQDLDTWDDVGLNIPKLPH----LESFIRSKRHIMDENVFLVDSKPNNKCEEIQTDPMDQELIQNYISCNSDLKSSIDLLTEQLESSNYKFQKTDIQLKDQTQVIIQLKKELNDTRSKLICAQRDLMFESTKKKVANTGNQSTSGDTDFKSETVSNISDAINENPNSETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTVRNPTINFVKSLQLVKDDDLNHSNNLVTLVDNLDQFVSLISDILPNLFDVMQDKNNNNLTTLLVQCTCLHPDSKIREKLLRFLI---------------NLH--------PDPSAL------------ERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESL--------------LEKKISTENEVNGEDVVKFQ-LLPAVAQWCIDADVLHNFLIHEILISMRSF------NTTMINVQYGSLCLHLNVIQFLIPFIDVWIKLST--PQVFNEIVDDKDSDFIA-------NSDN---SKILE--------LYRTDVIVNREKYIKSQKSFLHYTSINIPMSSITDLDESTIDSKEMIQGWFIWPQLKWLQTELVNTLVDFLFNIRSKTDKVD---LTNPQTMSDIAKNQFT---ANPLKSK-------ETCLKIGAIMFELGCRFSVPVINNVFIPCFSHLLYESSSKGVDCNLKSEIISTGIVSGYCALLASLIQLDHSHAASENLKRFLTNISFLVAAESLSYDGVRLAIDVXXXXXXXXXXXXEIIISSLQPCIGCPNVSVRLFVCLMIQELV 2914
            I+ +D++ +L+     L+ALE  FE ++RG     L  +F++   FE  TS ++  +   I    SIST+DSID  + SDDG    +E++KVLE+ELRKKNEE++ LR ELT ++  +     +   + N    N+ Y+  S +P  +  +E RAL  LIN+YLL + +++TAV FSEE   +  QD+++W+ VG+N+PK P     L S+  +       +  LV     +    ++ +P D EL +  +S    L+  + LL    ES N              Q++IQ +    + R++LIC +R+   E  +K++           TD  ++ V N     + N + +      ++T+               F    T   P +  V +         N  +    L  +LD FV L+S+ L + F +M D        LL Q  CLHPDS +R++LLR L                ++H        P  +A              R +IL   R L+ YLGP R+E+EL+ Q+W  L E+P P+  +R+L+ + CGV+CP  P++L+SSL+LSI +  L+EE +  V A  + S+A  +  + D DK+P +IQ + R L+   SL              ++    T N      V   + LLPAVAQWC++ D LH  LI   L  + S+      + + IN +   +   L ++ +L+PF+  WI ++   P   ++   D    +         NSD+    K LE        +    +I+ ++ Y   Q  F    + +    S    D S    K+       W    WL   L+  L D L  I  + +KV      +   +      Q+    A+P  +          CL +   +   G    +  I  +      + L   S  G +     + + TG+++GYC LL+S+     + A +  ++  +TN  FL   E    D +RL I  L   +     L+E+I+ +L+PCIGC +  VR     ++  ++
Sbjct:   29 ISAEDVADYLLKEKLHLSALEYYFEWLDRGRRISTLHRFFSDASCFEQFTSSLKDEAIYGIDHCHSISTLDSIDMGRISDDG-NSLEEKLKVLEYELRKKNEELQNLRNELTHITIGRAVSEKLT--LNNLDPDNNFYEPPSTQPQDIRPYEFRALAVLINDYLLHNNYRITAVQFSEESESVGLQDVESWEQVGVNLPKPPSLLCLLRSYWSTTPTDAISSPHLVLDSVTDLVGGMRKNPFDNEL-EELVS----LQQQVVLL----ESKN-------------AQLVIQAQ----NWRNQLICLERE-HAEVVQKRLGFVRQ------TDTNTKVVEN--GFSDSNSSDDKSSNVASQTDLAMVHPLCPRSTSTEFKRHMTEILPRLGVVSA---------NSDDVAFRLTTSLDDFVVLVSERLESSFPLMADDGKTICLPLLTQAICLHPDSIVRDRLLRLLFNLFSSPPTSSTLSTDSVHIPHSFSSGPHKTATPNGDDLLVDSHQHRTLILSACRRLALYLGPTRLESELLPQLWSQLNERPPPSVAQRLLIVSACGVICPSIPAHLQSSLMLSILESNLDEERNELVRAANVRSLACLVGLMSDYDKLPQLIQRLTRLLFYDRSLAVGSHRVPGNTAHPVDLSCVTTNAEQPTFVTSVEWLLPAVAQWCLELDSLHTTLIDPWLDQLDSYILSTHSDPSSINPEV--VTHTLTILDYLVPFLHAWILITVVEPTRPDQTYWDAAISWSVSHSLDENNSDDISLCKFLEGSPQPPDSIVNVQLILGQQVYQALQPKFEQALACHCSDKSTHRRDSSPTTPKKQ------WTAKSWLYNILLPKLNDILSRIPRQPNKVTGSVYNHTDLLETFVSQQYGEHFAHPWGTSTQSNSDLTVCLAVCRFLVTFGADLGMDGIQKLLAIPMQNALMNRSELG-NFEYDQQALQTGLLAGYCCLLSSV----KAKALTHKVRMLITNAIFLHTREFYPLDPIRLTIWALCLTVDLEYALTELILPALRPCIGCADSMVRRAAATLLHSVI 1017          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. TrEMBL
Match: A0A131YBH7 (Protein phosphatase 2a regulatory subunit a OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 285.419 bits (729), Expect = 1.370e-75
Identity = 314/1149 (27.33%), Postives = 511/1149 (44.47%), Query Frame = 2
Query:   62 NITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTSHIELPSSRIKASP------SISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIR----------SKRHIMDENVFLVDSKPNNKCEEIQTDPMDQELIQNYISCNSDLKSSIDLLTEQLESSNYKFQKTDIQLKDQTQVIIQLKKELNDTRSKL---ICAQRDLMFESTKKKVANTGNQS---TSGDTDFKSETVSNISDAINEN-PNSETFPQKDNE-TNFEPTDVEDNNVVKNIFDEVSTVRNPTINFVKSLQLVKDD-----DLNHSNNLVTLVDNLDQFVSLISDILPNLFDVMQDKNNNNLTTLLVQCTCLHPDSKIREKLLRFLINLHPDPSALERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLI---------HEILISMRSFNTTMINVQYGSLCLHLNVIQFL---IPFIDVWIKLSTPQVFNEIVDDKDSDFIANSDNSKILE--LYRTDVIVNREKYIKSQKSFLHYTSINIPMSSITDLDESTIDSKEMIQGWF-IWPQLKWLQTELVNTLVDFLFNIRSKTDKVDLTNPQTMSDIAKNQFTANPLKSKETCLKIGAIMFELGCRFSVPVINNVFIPCFSHLLYESSSKGVD-----CNLKSEIISTGIVSGYCALLASLIQLDHSHAASENLKRFLTNISFLVAAESLSYDGVRLAIDVXXXXXXXXXXXXEIIISSLQPCIGCPNVSVRLFVCLMIQELVVQWATLP-TIEDNNFGSVINSLKNLIDSPHEVVKVMCVGPLVSLLQVKSATPVIRKQIYDCLSELMNESVNFKSESLEKTHSSTPCTEVLITALIQMINVVGPTSPESFRDESILPWLFGITEINNGTSDTARRSGIAMILYSTFSTLS 3358
            ++TID I+  L+ +N+ LTALEL  EL+E G E   LR+YF+NP NFE   SH    SS    SP      S+ T DS+DFA+YSDDG +Q DER+ VLEFELRK  E +K LR  LT+          V +  PN+ +   ++ T S +PL  HE RA+NFL+NEYLLK  +KLT+++FS+E  DQD + WDDVGLNIPK P      R          S      +   L +  P+ + +E++    ++E+          L++ ++ L  QLE +N          ++   +  +L K LN ++++L        ++M E+  + V  +   S   T   +  +        D   E  P   TF + D +   F   +V    + ++    ++T R  +  F+++L  V        D+  + ++  +    D+ V ++S  LP++   +       L  LL+    LHPD++ R+ LL  L NL   P   +R +IL  +  ++  LG  RVEAEL+ Q WE +  K      +R+L+A  CG + P   S +RSSL+LS+ QQML+EE +  V      S+A  + Y++D DK    + +         +LL   +  + +    +V +  LLP+VA W ++   L   L+         H   + MRS +  M ++        +N+++ L   +PF+ V +  S P V    + D  S     +D  +  E  L     IV  +    S+ + L           +T  DE       + Q WF  WP   WL    ++  + FL NI + T     +  + +S++ +N            C   G               ++   P FS LL  + +  V       N  + I + G+++ +C           S      L  FL ++ F+V+   +S   ++  +      LG      E ++++L   +   +  VR     + + LV   AT+P T+  N    V  +L  L   P   V+V  V P  ++L + +   ++ K      + L +             H    C +V     IQM   +GP +   FRDE ILP L  +   NN  +  + R+ +A +L   ++ LS
Sbjct:   39 DVTIDRIASKLLKDNFILTALELHAELLESGRELPRLRDYFSNPGNFEK-HSH----SSAFDVSPVLPRTSSVQTFDSLDFARYSDDGEKQLDERVAVLEFELRKARETIKNLRANLTV----------VTESDPNTPDNGSEHATVSEDPLRPHERRAVNFLVNEYLLKQDYKLTSITFSDENEDQDFEDWDDVGLNIPKPPDFLQLYRNYNKHARQWCSTTECAAQTEALDEPSPSAREQELKAVAFEKEV----------LETQLEQLKLQLEKAN----------QENAVLTSELDKALN-SQAELSFKPVLPFEIMAETLSEMVEPSVPDSPVLTVSKSPLRKRVPEERGDLPEEGSPIDSTFHKDDLDIAGFGVEEVSPTKLRES--QSITTARKMSPAFLEALVSVGHPRSQLADMRLAWDVTHVAATGDEVVLMLSRCLPHIVPNVLLAKREELVPLLLAAINLHPDARERDALLNLLFNLTKRPDDDQRRVILAGLLSVAQCLGHARVEAELLPQCWEQISHK---YPERRLLVAESCGYLAPQVASEIRSSLLLSMLQQMLKEEKEELVRQAAARSLAVLLAYVDDPDKFSQAVDL---------ALL---VVADEQPEMAEVAQSVLLPSVACWALEKGQLETALLTTLMKLLEDHVRALDMRSADGVM-SLSQAEEQHSVNLVKALGAALPFLFVHVLESGPYVARLKLHDSISPCSLPADRVRPSENPLLEPATIVGDD----SRTALL-----------VTAFDE------HIGQEWFKTWPAFDWL----LSKFIPFLTNIATSTKPHSRSTVRALSELLRN-----------FCQLFGRTF-----------THSKVKPAFSALLPLTDASSVASREALTNAIAPIYACGVLTAFC-----------SETDRRELVGFLKSLLFVVSLCDVSLASIQSTL----LELGCDRNHQEALLATLWEGVVHASPLVRANAARLFELLV---ATVPDTLLKNR---VAPALVTLASDPEISVRVGTVRPFGTILALSTQKELLDKAFLQLQTFLED-----------PQHRDNHCMQV---EFIQMFASLGPNTEPRFRDEFILPHLAVLAIRNNQNASDSLRAEVAELLLEAYTALS 1051          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. TrEMBL
Match: V5HYB6 (Protein phosphatase 2a regulatory subunit a OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 284.263 bits (726), Expect = 2.613e-75
Identity = 314/1149 (27.33%), Postives = 511/1149 (44.47%), Query Frame = 2
Query:   62 NITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTSHIELPSSRIKASP------SISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIR----------SKRHIMDENVFLVDSKPNNKCEEIQTDPMDQELIQNYISCNSDLKSSIDLLTEQLESSNYKFQKTDIQLKDQTQVIIQLKKELNDTRSKL---ICAQRDLMFESTKKKVANTGNQS---TSGDTDFKSETVSNISDAINEN-PNSETFPQKDNE-TNFEPTDVEDNNVVKNIFDEVSTVRNPTINFVKSLQLVKDD-----DLNHSNNLVTLVDNLDQFVSLISDILPNLFDVMQDKNNNNLTTLLVQCTCLHPDSKIREKLLRFLINLHPDPSALERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLI---------HEILISMRSFNTTMINVQYGSLCLHLNVIQFL---IPFIDVWIKLSTPQVFNEIVDDKDSDFIANSDNSKILE--LYRTDVIVNREKYIKSQKSFLHYTSINIPMSSITDLDESTIDSKEMIQGWF-IWPQLKWLQTELVNTLVDFLFNIRSKTDKVDLTNPQTMSDIAKNQFTANPLKSKETCLKIGAIMFELGCRFSVPVINNVFIPCFSHLLYESSSKGVD-----CNLKSEIISTGIVSGYCALLASLIQLDHSHAASENLKRFLTNISFLVAAESLSYDGVRLAIDVXXXXXXXXXXXXEIIISSLQPCIGCPNVSVRLFVCLMIQELVVQWATLP-TIEDNNFGSVINSLKNLIDSPHEVVKVMCVGPLVSLLQVKSATPVIRKQIYDCLSELMNESVNFKSESLEKTHSSTPCTEVLITALIQMINVVGPTSPESFRDESILPWLFGITEINNGTSDTARRSGIAMILYSTFSTLS 3358
            ++TID I+  L+ +N+ LTALEL  EL+E G E   LR+YF+NP NFE   SH    SS    SP      S+ T DS+DFA+YSDDG +Q DER+ VLEFELRK  E +K LR  LT+          V +  PN+ +   ++ T S +PL  HE RA+NFL+NEYLLK  +KLT+++FS+E  DQD + WDDVGLNIPK P      R          S      +   L +  P+ + +E++    ++E+          L++ ++ L  QLE +N          ++   +  +L K LN ++++L        ++M E+  + V  +   S   T   +  +        D   E  P   TF + D +   F   +V    + ++    ++T R  +  F+++L  V        D+  + ++  +    D+ V ++S  LP++   +       L  LL+    LHPD++ R+ LL  L NL   P   +R +IL  +  ++  LG  RVEAEL+ Q WE +  K      +R+L+A  CG + P   S +RSSL+LS+ QQML+EE +  V      S+A  + Y++D DK    + +         +LL   +  + +    +V +  LLP+VA W ++   L   L+         H   + MRS +  M ++        +N+++ L   +PF+ V +  S P V    + D  S     +D  +  E  L     IV  +    S+ + L           +T  DE       + Q WF  WP   WL    ++  + FL NI + T     +  + +S++ +N            C   G               ++   P FS LL  + +  V       N  + I + G+++ +C           S      L  FL ++ F+V+   +S   ++  +      LG      E ++++L   +   +  VR     + + LV   AT+P T+  N    V  +L  L   P   V+V  V P  ++L + +   ++ K      + L +             H    C +V     IQM   +GP +   FRDE ILP L  +   NN  +  + R+ +A +L   ++ LS
Sbjct:   39 DVTIDRIASKLLKDNFILTALELHAELLESGRELPRLRDYFSNPGNFEK-HSH----SSAFDVSPVLPRTSSVQTFDSLDFARYSDDGEKQLDERVAVLEFELRKARETIKNLRANLTV----------VTESDPNTPDNGSEHATVSEDPLRPHERRAVNFLVNEYLLKQDYKLTSITFSDENEDQDFEDWDDVGLNIPKPPDFLQLYRNYNKHARQWCSTTECAAQTEALDEPSPSAREQELKAVAFEKEV----------LETQLEQLKLQLEKAN----------QENAVLTSELDKALN-SQAELSFKPVLPFEIMAETLSEMVEPSVPDSPVLTVSKSPLRKRVPEERGDLPEEGSPIDSTFHKDDLDIAGFGVEEVSPTKLRES--QSITTARKMSPAFLEALVSVGHPRSQLADMRLAWDVTHVAATGDEVVLMLSRCLPHIVPNVLLAKREELVPLLLAAINLHPDARERDALLNLLFNLTKRPDDDQRRVILAGLLSVAQCLGHARVEAELLPQCWEQISHK---YPERRLLVAESCGYLAPQVASEIRSSLLLSMLQQMLKEEKEELVRQAAARSLAVLLAYVDDPDKFSQAVDL---------ALL---VVADEQPEMAEVAQSVLLPSVACWALEKGQLETALLTTLMKLLEDHVRALDMRSADGVM-SLSQAEEQHSVNLVKALGAALPFLFVHVLESGPYVARLKLHDSISPCSLPADRVRPSENPLLEPATIVGDD----SRTALL-----------VTAFDE------HIGQEWFKTWPAFDWL----LSKFIPFLTNIATSTKPHSRSTVRALSELLRN-----------FCQLFGRTF-----------THSKVKPAFSALLPLTDASSVASREALTNAIAPIYACGVLTAFC-----------SETDRRELVGFLKSLLFVVSLCDVSLASIQSTL----LELGCDRNHQEALLATLWEGVVHASPLVRANAARLFELLV---ATVPDTLLKNR---VAPALVTLASDPEISVRVGTVRPFGTILALSTQKELLDKAFLQLQTFLED-----------PQHRDNHCMQV---EFIQMFASLGPNTEPRFRDEFILPHLAVLAIRNNQNASDSLRAEVAELLLEAYTALS 1051          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Cavefish
Match: relch (RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing [Source:NCBI gene;Acc:393817])

HSP 1 Score: 259.225 bits (661), Expect = 5.284e-71
Identity = 201/656 (30.64%), Postives = 317/656 (48.32%), Query Frame = 2
Query:   62 NITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTSHIEL-------PSSRIKASPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIR---SKRHIMDENVFLVDSKPNNKCEEIQTDPMDQELIQNYISCN-----SDLKSSIDLLTEQLESSNYKFQKTDIQLKD-QTQVIIQLKK--ELNDTRSKLICAQRDL----MFESTKKKVANTGNQSTSGDTDFKSETVSNISDAINENPNSETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTVRNPTIN--FVKSLQLVKDDDLNHSNNLVTLVDNLDQFVSLISDILPNLFDVMQDKNNNNLTTLLVQCTCLHPDSKIREKLLRFLINLHPDPSALERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEIL 1957
             +++D I+  L+ + Y LTALEL  EL+E G E   LR+YF+NP NFE  +            P   +  + SIST+DS+DF +YSDDG +++DER+ VLEFELRK  E ++ LR  LT  +  +         IP+    N        EP+   E RALNFL+NEYLLK+ +KL++++FS+E  DQD + WDDVGLNIPK P L    R   S  H         D+       ++  D + QE +Q   +        +L+  I LL  + +S   + +K   +++D Q  V   LK   E  DT++ L C +R L      +       ++  +  S  T   + + +  +D   EN +  T P     + F+         VK  FD+ +   +P  +   +   ++  D  L   + +  + D+ +  + ++   LP++   +       L  L++   CLHP+ K R++LL  L NL   P   +R MIL      + ++GP RVE EL+ Q WE +  K      +R+L+A  CG + P     +RSSL+LS+ QQML E+    V   ++ S+   + Y++D DK     ++M   L     L E+ +   ++V          +PA A W ++   L   LI  +L
Sbjct:   85 RVSVDAIAAQLLRDQYILTALELHTELLEAGRELPRLRDYFSNPGNFERQSGTPPAGKEPGLGPGGALNRAGSISTLDSLDFTRYSDDGNRESDERVAVLEFELRKAKETIQALRTNLTQAAECE---------IPSQERKNYKSSPEIQEPIRPLEKRALNFLVNEYLLKNEYKLSSITFSDENDDQDFELWDDVGLNIPKPPDLLQLYRNCGSSSHPSHRET--ADAAVGVDASDLPGDYIAQEAVQKTETIQQKEVVQELEYQISLLNSEKQSLAEQIRKLQSEIQDLQRNVSSPLKASVECGDTKTGLQC-ERSLDNGQYLDIRGVTETDSATEPNSNTTTSTNTSTATATDHTAENSSPSTQPH----SKFKSPRQHSKGPVK--FDQPNRQLSPAFHQALLSFCRMSADSRLG--SEVSRIADSEESVMLMLGRCLPHIVPNVLLAKREELIPLILCTACLHPEPKERDQLLHILFNLIKRPDDEQRQMILMGCVAFARHVGPTRVEVELLPQCWEQINHK---YPERRLLVAESCGALAPYLTKEIRSSLVLSMLQQMLAEDKADMVREAVVKSLGIIMGYIDDPDKYSQGFELM---LLSLGDLSERVVVATHQV---------FIPAFAAWTVELGNLQAQLIPSLL 705          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Cavefish
Match: relch (RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing [Source:NCBI gene;Acc:393817])

HSP 1 Score: 257.299 bits (656), Expect = 2.772e-70
Identity = 205/664 (30.87%), Postives = 322/664 (48.49%), Query Frame = 2
Query:   62 NITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTSHIEL-------PSSRIKASPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIR---SKRHIMDENVFLVDSKPNNKCEEIQTDPMDQELIQNYISCN-----SDLKSSIDLLTEQLESSNYKFQKTDIQLKD-QTQVIIQLKK--ELNDTRSKLICAQRDL----MFESTKKKVANTGNQSTSGDTDFKSETVSNISDAINENPNSETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTVRNPTIN--FVKSLQLVKDDDLNHSNNLVTLVDNLDQFVSLISDILPNLF-DVMQDKNNNNLTTL------LVQCT-CLHPDSKIREKLLRFLINLHPDPSALERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEIL 1957
             +++D I+  L+ + Y LTALEL  EL+E G E   LR+YF+NP NFE  +            P   +  + SIST+DS+DF +YSDDG +++DER+ VLEFELRK  E ++ LR  LT  +  +         IP+    N        EP+   E RALNFL+NEYLLK+ +KL++++FS+E  DQD + WDDVGLNIPK P L    R   S  H         D+       ++  D + QE +Q   +        +L+  I LL  + +S   + +K   +++D Q  V   LK   E  DT++ L C +R L      +       ++  +  S  T   + + +  +D   EN +  T P     + F+         VK  FD+ +   +P  +   +   ++  D  L   + +  + D+ +  + ++   LP++  +V+  K    +  L      L+ CT CLHP+ K R++LL  L NL   P   +R MIL      + ++GP RVE EL+ Q WE +  K      +R+L+A  CG + P     +RSSL+LS+ QQML E+    V   ++ S+   + Y++D DK     ++M   L     L E+ +   ++V          +PA A W ++   L   LI  +L
Sbjct:   85 RVSVDAIAAQLLRDQYILTALELHTELLEAGRELPRLRDYFSNPGNFERQSGTPPAGKEPGLGPGGALNRAGSISTLDSLDFTRYSDDGNRESDERVAVLEFELRKAKETIQALRTNLTQAAECE---------IPSQERKNYKSSPEIQEPIRPLEKRALNFLVNEYLLKNEYKLSSITFSDENDDQDFELWDDVGLNIPKPPDLLQLYRNCGSSSHPSHRET--ADAAVGVDASDLPGDYIAQEAVQKTETIQQKEVVQELEYQISLLNSEKQSLAEQIRKLQSEIQDLQRNVSSPLKASVECGDTKTGLQC-ERSLDNGQYLDIRGVTETDSATEPNSNTTTSTNTSTATATDHTAENSSPSTQPH----SKFKSPRQHSKGPVK--FDQPNRQLSPAFHQALLSFCRMSADSRLG--SEVSRIADSEESVMLMLGRCLPHIVPNVLLAKRERMVVHLCQELIPLILCTACLHPEPKERDQLLHILFNLIKRPDDEQRQMILMGCVAFARHVGPTRVEVELLPQCWEQINHK---YPERRLLVAESCGALAPYLTKEIRSSLVLSMLQQMLAEDKADMVREAVVKSLGIIMGYIDDPDKYSQGFELM---LLSLGDLSERVVVATHQV---------FIPAFAAWTVELGNLQAQLIPSLL 713          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Cavefish
Match: relch (RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing [Source:NCBI gene;Acc:393817])

HSP 1 Score: 225.713 bits (574), Expect = 3.908e-60
Identity = 193/664 (29.07%), Postives = 306/664 (46.08%), Query Frame = 2
Query:   62 NITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTSHIEL-------PSSRIKASPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIR---SKRHIMDENVFLVDSKPNNKCEEIQTDPMDQELIQNYISCN-----SDLKSSIDLLTEQLESSNYKFQKTDIQLKD-QTQVIIQLKK--ELNDTRSKLICAQRDL----MFESTKKKVANTGNQSTSGDTDFKSETVSNISDAINENPNSETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTVRNPTIN--FVKSLQLVKDDDLNHSNNLVTLVDNLDQFVSLISDILPNLF-DVMQDKNNNNLTTL------LVQCT-CLHPDSKIREKLLRFLINLHPDPSALERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEIL 1957
             +++D I+  L+ + Y LTALEL  EL+E G E   LR+YF+NP NFE  +            P   +  + SIST+DS+DF +YSDDG +++DER+   E                                 IP+    N        EP+   E RALNFL+NEYLLK+ +KL++++FS+E  DQD + WDDVGLNIPK P L    R   S  H         D+       ++  D + QE +Q   +        +L+  I LL  + +S   + +K   +++D Q  V   LK   E  DT++ L C +R L      +       ++  +  S  T   + + +  +D   EN +  T P     + F+         VK  FD+ +   +P  +   +   ++  D  L   + +  + D+ +  + ++   LP++  +V+  K    +  L      L+ CT CLHP+ K R++LL  L NL   P   +R MIL      + ++GP RVE EL+ Q WE +  K      +R+L+A  CG + P     +RSSL+LS+ QQML E+    V   ++ S+   + Y++D DK     ++M   L     L E+ +   ++V          +PA A W ++   L   LI  +L
Sbjct:   85 RVSVDAIAAQLLRDQYILTALELHTELLEAGRELPRLRDYFSNPGNFERQSGTPPAGKEPGLGPGGALNRAGSISTLDSLDFTRYSDDGNRESDERVAECE---------------------------------IPSQERKNYKSSPEIQEPIRPLEKRALNFLVNEYLLKNEYKLSSITFSDENDDQDFELWDDVGLNIPKPPDLLQLYRNCGSSSHPSHRET--ADAAVGVDASDLPGDYIAQEAVQKTETIQQKEVVQELEYQISLLNSEKQSLAEQIRKLQSEIQDLQRNVSSPLKASVECGDTKTGLQC-ERSLDNGQYLDIRGVTETDSATEPNSNTTTSTNTSTATATDHTAENSSPSTQPH----SKFKSPRQHSKGPVK--FDQPNRQLSPAFHQALLSFCRMSADSRLG--SEVSRIADSEESVMLMLGRCLPHIVPNVLLAKRERMVVHLCQELIPLILCTACLHPEPKERDQLLHILFNLIKRPDDEQRQMILMGCVAFARHVGPTRVEVELLPQCWEQINHK---YPERRLLVAESCGALAPYLTKEIRSSLVLSMLQQMLAEDKADMVREAVVKSLGIIMGYIDDPDKYSQGFELM---LLSLGDLSERVVVATHQV---------FIPAFAAWTVELGNLQAQLIPSLL 689          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000188.1 (pep scaffold:Pmarinus_7.0:GL476590:153062:177616:1 gene:ENSPMAG00000000164.1 transcript:ENSPMAT00000000188.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 216.468 bits (550), Expect = 1.130e-57
Identity = 197/765 (25.75%), Postives = 337/765 (44.05%), Query Frame = 2
Query:  257 SISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIR--SKRHIMDENVFLVDSKPN---NKCEEIQTDPMDQELIQNYISCNSDLKSSIDLLTEQLESSNYKFQKTDIQLKDQTQVIIQLKKE---LNDTRSKLICAQRDLMFESTKKKVANTGNQSTSGDTDFKSETVSNISDAINENPNSETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTVRNPTI----NFVKSLQ--LVKDDDLNHSNNLVTLVDNLDQFVSLISDILPNLFDVMQDKNNNNLTTLLVQCTCLHPDSKIREKLLRFLINLHPDPSALERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLW-KSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEILISMRSFNTTMIN----VQYGSLCLHLNVIQFLIPFIDVWIKLSTPQVFNEIVDDKDSDFIANSDNSKILELYRTDVIVNREKYIKSQKSFLHYTSINIPMSSITDLDESTIDSKEMIQGWFIWPQLKWLQTELVNTLVDFLFNIRSKTDKVDLTNPQTMSDIA----------KNQFTANPLK 2464
            S++T+DS+DFA+YSDDG +  DER+ VLEFELRK  E ++ LR +LT  +   T         P     N++      +P+   E RALNFL+NE+LLK+ FKLT+++FS+E  +QD++ WDDVGLNIPK P L +  R    R ++  +   V   P+   N       DP    L        +++   ++ L E+L   N        QL ++  +II++ +    ++     L     + +F+S      N+  ++ + +   + ET  +       N  S          N    DV+D+ + +   D+   +  P       F+++L    +   +      +  + D+    +S++   LP++   +       L  +++   CLHP+SK R++LL  L NL   P   +R  IL      + ++GP R E+EL+ Q WE +  K      +R L+A  CGV+ P  P  +RSSL+LS+ QQML E+    V    + S+   I Y++D DK      ++   L   SE +L     T              LPA   W  +   +   L + +L       T ++     +    L  +++ +Q L+PF+ +++  ++P  F E  +           N+  +E+ R      R   +               +SS+  L E  +D          W  ++W+Q  ++  LV+          K+ +T+P  + D+A            QFT+  +K
Sbjct:    5 SLTTLDSLDFARYSDDGNRDVDERVAVLEFELRKARETIQALRTDLTQAAETNT---------PTQEKNNEEQIPACEDPMRPLEKRALNFLVNEFLLKNEFKLTSITFSDENGEQDIEVWDDVGLNIPKPPDLLTLYRDYGSRIVLPSDTLDVGVGPDLVENPDPNPADDPSSLTLGDLPDGSLAEVVKELNQLVERLRHENESLTAQIRQL-ERVLIIIRICRYAALIDSINMTLHHIYYEGLFDSVPDHETNSSEKNANPNVTLQGETTRS-------NVGSSPPSSSSPPDNLTLRDVDDHVISEQDMDDQVQLEKPKRKLPETFMRTLMQCCMTTSNSRLGCEVAKIADSEKSVISVLGRCLPHIVPNVLLAKREELIPVILCTACLHPESKQRDELLNILFNLIKRPDEQQRKTILVGCVAFARHVGPARAESELLPQCWEQISHK---YPERRELVAEACGVLAPYLPMAIRSSLVLSMLQQMLHEDKTETVREASVRSLGVVISYIDDPDKYFQAFDLLLMALRDTSERVLAATHQT-------------FLPAFGMWACELGRVQTHLANSLL---SKVETAVLEENSILDENKLHQYISALQSLVPFLFLFVLQTSP--FAEEAE--------ACTNAPQIEVGRFPSTACRLAEVTVAAGGPER------ISSLLVLYERRLDGLADDPDTQAWESMRWIQHNMLPRLVEV-------ACKIPVTSPSAVHDLATFVSTLCRTFGRQFTSGKVK 710          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002860.1 (pep scaffold:Pmarinus_7.0:GL476846:138808:150066:1 gene:ENSPMAG00000002604.1 transcript:ENSPMAT00000002860.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 6.389e-6
Identity = 21/66 (31.82%), Postives = 34/66 (51.52%), Query Frame = 2
Query: 3173 EVLITALIQMINVVGPTSPESFRDESILPWLFGITEINNGTSDTARRSGIAMILYSTFSTLSYCIL 3370
              L T ++     VGP +   FRDE ++P L  +   NN   +  +R G+A+ L+  +S LS C +
Sbjct:  283 HALHTEIVHSFGRVGPNAEPKFRDEFVIPHLHKLAAANNHQHNEGKRMGMALQLFEAYSALSCCFI 348          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Nematostella
Match: EDO33912 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQW5])

HSP 1 Score: 99.7525 bits (247), Expect = 2.284e-21
Identity = 97/377 (25.73%), Postives = 178/377 (47.21%), Query Frame = 2
Query: 1268 LVDNLDQFVSLISDILPNLF-DVMQDKNNNNLTTLLVQCTCLH-PDSKIREKLLRFLINLHPDPSALERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEILISMRSFNTTM-INVQYGSLCLHLNVIQFLIP-FIDVWIKLSTPQVFNEIVDDKDSDFIAN-SDNSKILELYRTDVIVNREKYIKSQKSFLHYTSINIPMSSITDLDESTIDSKEMIQGWFIWPQLKWLQTELVNTLVDFLFNIRS 2383
            L +  D  V +++  LP++  +V+ +K    +  ++  CT +H P +K R+ LL  L NL   P   +R MI+      +  + P RVEAEL+ Q WE +  K      +R+L+A  CGV+ P  P  +RSSL+ S+ +QML ++ + +V   +  S+   + Y+E++DK     +++         ++    +T++ V     V   LLPA+A W +D + L + L   +L   +S N ++ +N       L L+V++  +  +I V+  L  P +F  ++    S    + +  +  L L+    +V+ ++++ +  S L    + I    +  L     D       +  W  L WLQ E +  L D    + S
Sbjct:  134 LCETSDDLVLILARCLPHIVPNVLLNKREELIPVII--CTAIHHPHAKDRDNLLHMLFNLIKRPDEEQRQMIMNGCAAFAQVVEPTRVEAELLPQWWEQITHK---YHERRLLVAEACGVLSPYLPDTIRSSLVWSMLRQMLMDDRNEEVREAVTKSLGLVLAYMENSDKYDQAHELL---------MITLNDATDHVVRAAQHV---LLPALADWSMDLNKLESHLAPSLL---QSINKSLDVNAS-----LTLDVVRSRVARYIKVFTSL-VPALFAYVLRSAKSPLPRDPTVTTNTLLLF---FVVDEDRFLPA-PSPLQQMDVIIGSDQLLALLVRRFDKYVTSDRFASWESLSWLQYECIPKLCDIAGRVHS 480          

HSP 2 Score: 60.8474 bits (146), Expect = 2.760e-9
Identity = 31/57 (54.39%), Postives = 37/57 (64.91%), Query Frame = 2
Query:  542 YLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIRSKRHIMDENVFLV 712
            YLL + ++LT+V+FSEE T+QD D WDDVGLNIPK P L    R   H     V LV
Sbjct:    1 YLLINNYRLTSVTFSEENTNQDFDDWDDVGLNIPKPPDLLHLYRDYGHHTVPEVVLV 57          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Medaka
Match: relch (RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing [Source:NCBI gene;Acc:101163777])

HSP 1 Score: 264.618 bits (675), Expect = 4.084e-72
Identity = 206/686 (30.03%), Postives = 329/686 (47.96%), Query Frame = 2
Query:   62 NITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFEN------VTSHIELPSSRIKASPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIR-------SKRHIMDENVFLVDSKPNNKCEEIQTDPMDQELIQNYISCNSDLKSSIDLLTEQLESSNYKFQ-----KTDIQLKDQTQVIIQLKKELNDTRSKLICAQRDLMFESTKKKVANTGNQSTSGDTDFKSETVSNISDAINENPNSETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTVRNPTIN--FVKSLQLVKDDDLNHSNNLVTLVDNLDQFVSLISDILPNLFDVMQDKNNNNLTTLLVQCTCLHPDSKIREKLLRFLINLHPDPSALERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEILISMRSFNTTMINVQYG----SLCLHLNVIQFLIP 2047
             +++D I+  L+ + + LTALE   EL+E G E   LR+YF+NP NFE           +  P   +  + SIST+DS+DFA+YSDDG +++DER+ VLEFELRK  E ++ LR  LT     +  +S V+    +    N        EP+   E RALNFL+NEYLLK+G+KL++++FS+E  DQD + WDDVGLNIPK P L    R       S+R+++D +V  VD+                EL+ N ++  S  K  +    +       ++Q          L DQ + +    + L  T S    A  DL  +++    +++   ++S D+     + +     ++E  N    P K   +      ++  N     FD+ +   +P      +   ++  D  L     +  + D+ +  + ++   LP++   +       L  L++   CLHP+ K R++LL  L NL   P   +R MIL      + ++GP RVEAEL+ Q WE +  K      +R+L+A  CG + P  P  +RSSL+LS+ QQML E+    V   ++ S+   + Y++D DK P   ++M         LL     +E  VN    V    +PA + W  +   LH  LI  +L  +      +   ++G     L + L+ +Q LIP
Sbjct:   85 RVSVDLIAAQLLRDQFILTALEFHTELLEAGRELPRLRDYFSNPGNFERQGGTPPAKDQVLGPGGPLNRAGSISTLDSLDFARYSDDGNRESDERVAVLEFELRKAKETIQALRANLT-----QAAESDVL----SQERKNLKSCPEIQEPIRQLEKRALNFLVNEYLLKNGYKLSSITFSDENDDQDFELWDDVGLNIPKPPGLLHLYRNCGNVPPSQRNMVDVSV-AVDAS---------------ELLGNCVASESSKKPGLSQQQQTEVVQELEYQLGLLSSEKQSLADQIKKLQSEIQTLKRTVSSPPPATLDLSSQNSSHPSSSSNIITSSTDSPSVDNSQTLEGRGVSEAGNGGDPPSKQKASQ-----LQSCNKTHVHFDQPNRKLSPAFQQALLSFCRMCSDSRLG--AEVSRIADSEESVMLMLGRCLPHIVPNVLLAKREELIPLILCTACLHPEPKERDQLLHILFNLIKRPDDEQRQMILTGCVAFARHVGPTRVEAELLPQCWEQINHK---YPERRLLVAESCGALAPYLPKEIRSSLVLSMLQQMLAEDKADMVREAVVKSLGIIMGYIDDADKYPQGFELM---------LLSLGDPSERVVNAVHQV---FIPAFSAWSTELGNLHVALIPSLLTRIEKL---LPQGEHGLDEHKLHIFLSALQSLIP 720          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Medaka
Match: relch (RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing [Source:NCBI gene;Acc:101163777])

HSP 1 Score: 261.536 bits (667), Expect = 4.548e-71
Identity = 210/694 (30.26%), Postives = 334/694 (48.13%), Query Frame = 2
Query:   62 NITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFEN------VTSHIELPSSRIKASPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIR-------SKRHIMDENVFLVDSKPNNKCEEIQTDPMDQELIQNYISCNSDLKSSIDLLTEQLESSNYKFQ-----KTDIQLKDQTQVIIQLKKELNDTRSKLICAQRDLMFESTKKKVANTGNQSTSGDTDFKSETVSNISDAINENPNSETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTVRNPTIN--FVKSLQLVKDDDLNHSNNLVTLVDNLDQFVSLISDILPNLF-DVMQDKNNNNLTTL------LVQCT-CLHPDSKIREKLLRFLINLHPDPSALERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEILISMRSFNTTMINVQYG----SLCLHLNVIQFLIP 2047
             +++D I+  L+ + + LTALE   EL+E G E   LR+YF+NP NFE           +  P   +  + SIST+DS+DFA+YSDDG +++DER+ VLEFELRK  E ++ LR  LT     +  +S V+    +    N        EP+   E RALNFL+NEYLLK+G+KL++++FS+E  DQD + WDDVGLNIPK P L    R       S+R+++D +V  VD+                EL+ N ++  S  K  +    +       ++Q          L DQ + +    + L  T S    A  DL  +++    +++   ++S D+     + +     ++E  N    P K   +      ++  N     FD+ +   +P      +   ++  D  L     +  + D+ +  + ++   LP++  +V+  K    +  L      L+ CT CLHP+ K R++LL  L NL   P   +R MIL      + ++GP RVEAEL+ Q WE +  K      +R+L+A  CG + P  P  +RSSL+LS+ QQML E+    V   ++ S+   + Y++D DK P   ++M         LL     +E  VN    V    +PA + W  +   LH  LI  +L  +      +   ++G     L + L+ +Q LIP
Sbjct:   85 RVSVDLIAAQLLRDQFILTALEFHTELLEAGRELPRLRDYFSNPGNFERQGGTPPAKDQVLGPGGPLNRAGSISTLDSLDFARYSDDGNRESDERVAVLEFELRKAKETIQALRANLT-----QAAESDVL----SQERKNLKSCPEIQEPIRQLEKRALNFLVNEYLLKNGYKLSSITFSDENDDQDFELWDDVGLNIPKPPGLLHLYRNCGNVPPSQRNMVDVSV-AVDAS---------------ELLGNCVASESSKKPGLSQQQQTEVVQELEYQLGLLSSEKQSLADQIKKLQSEIQTLKRTVSSPPPATLDLSSQNSSHPSSSSNIITSSTDSPSVDNSQTLEGRGVSEAGNGGDPPSKQKASQ-----LQSCNKTHVHFDQPNRKLSPAFQQALLSFCRMCSDSRLG--AEVSRIADSEESVMLMLGRCLPHIVPNVLLAKRERMVAHLCQELIPLILCTACLHPEPKERDQLLHILFNLIKRPDDEQRQMILTGCVAFARHVGPTRVEAELLPQCWEQINHK---YPERRLLVAESCGALAPYLPKEIRSSLVLSMLQQMLAEDKADMVREAVVKSLGIIMGYIDDADKYPQGFELM---------LLSLGDPSERVVNAVHQV---FIPAFSAWSTELGNLHVALIPSLLTRIEKL---LPQGEHGLDEHKLHIFLSALQSLIP 728          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Medaka
Match: relch (RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing [Source:NCBI gene;Acc:101163777])

HSP 1 Score: 232.646 bits (592), Expect = 8.194e-62
Identity = 198/694 (28.53%), Postives = 320/694 (46.11%), Query Frame = 2
Query:   62 NITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFEN------VTSHIELPSSRIKASPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIR-------SKRHIMDENVFLVDSKPNNKCEEIQTDPMDQELIQNYISCNSDLKSSIDLLTEQLESSNYKFQ-----KTDIQLKDQTQVIIQLKKELNDTRSKLICAQRDLMFESTKKKVANTGNQSTSGDTDFKSETVSNISDAINENPNSETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTVRNPTIN--FVKSLQLVKDDDLNHSNNLVTLVDNLDQFVSLISDILPNLF-DVMQDKNNNNLTTL------LVQCT-CLHPDSKIREKLLRFLINLHPDPSALERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEILISMRSFNTTMINVQYG----SLCLHLNVIQFLIP 2047
             +++D I+  L+ + + LTALE   EL+E G E   LR+YF+NP NFE           +  P   +  + SIST+DS+DFA+YSDDG +++DER+                   E  ++S  + N  S  +                 EP+   E RALNFL+NEYLLK+G+KL++++FS+E  DQD + WDDVGLNIPK P L    R       S+R+++D +V  VD+                EL+ N ++  S  K  +    +       ++Q          L DQ + +    + L  T S    A  DL  +++    +++   ++S D+     + +     ++E  N    P K   +      ++  N     FD+ +   +P      +   ++  D  L     +  + D+ +  + ++   LP++  +V+  K    +  L      L+ CT CLHP+ K R++LL  L NL   P   +R MIL      + ++GP RVEAEL+ Q WE +  K      +R+L+A  CG + P  P  +RSSL+LS+ QQML E+    V   ++ S+   + Y++D DK P   ++M         LL     +E  VN    V    +PA + W  +   LH  LI  +L  +      +   ++G     L + L+ +Q LIP
Sbjct:   85 RVSVDLIAAQLLRDQFILTALEFHTELLEAGRELPRLRDYFSNPGNFERQGGTPPAKDQVLGPGGPLNRAGSISTLDSLDFARYSDDGNRESDERVA------------------ESDVLSQERKNLKSCPEI---------------QEPIRQLEKRALNFLVNEYLLKNGYKLSSITFSDENDDQDFELWDDVGLNIPKPPGLLHLYRNCGNVPPSQRNMVDVSV-AVDAS---------------ELLGNCVASESSKKPGLSQQQQTEVVQELEYQLGLLSSEKQSLADQIKKLQSEIQTLKRTVSSPPPATLDLSSQNSSHPSSSSNIITSSTDSPSVDNSQTLEGRGVSEAGNGGDPPSKQKASQ-----LQSCNKTHVHFDQPNRKLSPAFQQALLSFCRMCSDSRLG--AEVSRIADSEESVMLMLGRCLPHIVPNVLLAKRERMVAHLCQELIPLILCTACLHPEPKERDQLLHILFNLIKRPDDEQRQMILTGCVAFARHVGPTRVEAELLPQCWEQINHK---YPERRLLVAESCGALAPYLPKEIRSSLVLSMLQQMLAEDKADMVREAVVKSLGIIMGYIDDADKYPQGFELM---------LLSLGDPSERVVNAVHQV---FIPAFSAWSTELGNLHVALIPSLLTRIEKL---LPQGEHGLDEHKLHIFLSALQSLIP 704          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Medaka
Match: relch (RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing [Source:NCBI gene;Acc:101163777])

HSP 1 Score: 169.859 bits (429), Expect = 3.662e-42
Identity = 99/238 (41.60%), Postives = 142/238 (59.66%), Query Frame = 2
Query:   62 NITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFEN------VTSHIELPSSRIKASPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIR-------SKRHIMDENVFLVDSKPNNKC 736
             +++D I+  L+ + + LTALE   EL+E G E   LR+YF+NP NFE           +  P   +  + SIST+DS+DFA+YSDDG +++DER+ VLEFELRK  E ++ LR  LT     +  +S V+    +    N        EP+   E RALNFL+NEYLLK+G+KL++++FS+E  DQD + WDDVGLNIPK P L    R       S+R+++D +V +  S+    C
Sbjct:   85 RVSVDLIAAQLLRDQFILTALEFHTELLEAGRELPRLRDYFSNPGNFERQGGTPPAKDQVLGPGGPLNRAGSISTLDSLDFARYSDDGNRESDERVAVLEFELRKAKETIQALRANLT-----QAAESDVL----SQERKNLKSCPEIQEPIRQLEKRALNFLVNEYLLKNGYKLSSITFSDENDDQDFELWDDVGLNIPKPPGLLHLYRNCGNVPPSQRNMVDVSVAVDASELLGNC 313          

HSP 2 Score: 116.701 bits (291), Expect = 8.059e-26
Identity = 80/264 (30.30%), Postives = 128/264 (48.48%), Query Frame = 2
Query: 1268 LVDNLDQFVSLISDILPNLFDVMQDKNNNNLTTLLVQCTCLHPDSKIREKLLRFLINLHPDPSALERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEILISMRSFNTTMINVQYG----SLCLHLNVIQFLIP 2047
            + D+ +  + ++   LP++   +       L  L++   CLHP+ K R++LL  L NL   P   +R MIL      + ++GP RVEAEL+ Q WE +  K      +R+L+A  CG + P  P  +RSSL+LS+ QQML E+    V   ++ S+   + Y++D DK P   ++M         LL     +E  VN    V    +PA + W  +   LH  LI  +L  +      +   ++G     L + L+ +Q LIP
Sbjct:  505 IADSEESVMLMLGRCLPHIVPNVLLAKREELIPLILCTACLHPEPKERDQLLHILFNLIKRPDDEQRQMILTGCVAFARHVGPTRVEAELLPQCWEQINHK---YPERRLLVAESCGALAPYLPKEIRSSLVLSMLQQMLAEDKADMVREAVVKSLGIIMGYIDDADKYPQGFELM---------LLSLGDPSERVVNAVHQV---FIPAFSAWSTELGNLHVALIPSLLTRIEKL---LPQGEHGLDEHKLHIFLSALQSLIP 750          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Medaka
Match: relch (RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing [Source:NCBI gene;Acc:101163777])

HSP 1 Score: 159.458 bits (402), Expect = 5.467e-39
Identity = 99/256 (38.67%), Postives = 143/256 (55.86%), Query Frame = 2
Query:   62 NITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFEN------VTSHIELPSSRIKA------------------SPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIR-------SKRHIMDENVFLVDSKPNNKC 736
             +++D I+  L+ + + LTALE   EL+E G E   LR+YF+NP NFE           +  P   + +                  + SIST+DS+DFA+YSDDG +++DER+ VLEFELRK  E ++ LR  LT     +  +S V+    +    N        EP+   E RALNFL+NEYLLK+G+KL++++FS+E  DQD + WDDVGLNIPK P L    R       S+R+++D +V +  S+    C
Sbjct:   85 RVSVDLIAAQLLRDQFILTALEFHTELLEAGRELPRLRDYFSNPGNFERQGGTPPAKDQVLGPGGPLNSVFDDLIVIVLVSRSHSDRAGSISTLDSLDFARYSDDGNRESDERVAVLEFELRKAKETIQALRANLT-----QAAESDVL----SQERKNLKSCPEIQEPIRQLEKRALNFLVNEYLLKNGYKLSSITFSDENDDQDFELWDDVGLNIPKPPGLLHLYRNCGNVPPSQRNMVDVSVAVDASELLGNC 331          

HSP 2 Score: 116.316 bits (290), Expect = 9.852e-26
Identity = 80/264 (30.30%), Postives = 128/264 (48.48%), Query Frame = 2
Query: 1268 LVDNLDQFVSLISDILPNLFDVMQDKNNNNLTTLLVQCTCLHPDSKIREKLLRFLINLHPDPSALERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEILISMRSFNTTMINVQYG----SLCLHLNVIQFLIP 2047
            + D+ +  + ++   LP++   +       L  L++   CLHP+ K R++LL  L NL   P   +R MIL      + ++GP RVEAEL+ Q WE +  K      +R+L+A  CG + P  P  +RSSL+LS+ QQML E+    V   ++ S+   + Y++D DK P   ++M         LL     +E  VN    V    +PA + W  +   LH  LI  +L  +      +   ++G     L + L+ +Q LIP
Sbjct:  412 IADSEESVMLMLGRCLPHIVPNVLLAKREELIPLILCTACLHPEPKERDQLLHILFNLIKRPDDEQRQMILTGCVAFARHVGPTRVEAELLPQCWEQINHK---YPERRLLVAESCGALAPYLPKEIRSSLVLSMLQQMLAEDKADMVREAVVKSLGIIMGYIDDADKYPQGFELM---------LLSLGDPSERVVNAVHQV---FIPAFSAWSTELGNLHVALIPSLLTRIEKL---LPQGEHGLDEHKLHIFLSALQSLIP 657          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Planmine SMEST
Match: SMESG000080793.1 (SMESG000080793.1)

HSP 1 Score: 2220.66 bits (5753), Expect = 0.000e+0
Identity = 1101/1109 (99.28%), Postives = 1105/1109 (99.64%), Query Frame = 2
Query:   35 MIILNQMTENITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTSHIELPSSRIKASPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIRSKRHIMDENVFLVDSKPNNKCEEIQTDPMDQELIQNYISCNSDLKSSIDLLTEQLESSNYKFQKTDIQLKDQTQVIIQLKKELNDTRSKLICAQRDLMFESTKKKVANTGNQSTSGDTDFKSETVSNISDAINENPNSETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTVRNPTINFVKSLQLVKDDDLNHSNNLVTLVDNLDQFVSLISDILPNLFDVMQDKNNNNLTTLLVQCTCLHPDSKIREKLLRFLINLHPDPSALERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEILISMRSFNTTMINVQYGSLCLHLNVIQFLIPFIDVWIKLSTPQVFNEIVDDKDSDFIANSDNSKILELYRTDVIVNREKYIKSQKSFLHYTSINIPMSSITDLDESTIDSKEMIQGWFIWPQLKWLQTELVNTLVDFLFNIRSKTDKVDLTNPQTMSDIAKNQFTANPLKSKETCLKIGAIMFELGCRFSVPVINNVFIPCFSHLLYESSSKGVDCNLKSEIISTGIVSGYCALLASLIQLDHSHAASENLKRFLTNISFLVAAESLSYDGVRLAIDVXXXXXXXXXXXXEIIISSLQPCIGCPNVSVRLFVCLMIQELVVQWATLPTIEDNNFGSVINSLKNLIDSPHEVVKVMCVGPLVSLLQVKSATPVIRKQIYDCLSELMNESVNFKSESLEKTHSSTPCTEVLITALIQMINVVGPTSPESFRDESILPWLFGITEINNGTSDTARRSGIAMILYSTFSTLSY 3361
            MIILNQMTENITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTSHIELPSSRIKASPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIRSKRHIMDENVFLVDSKPNNKCEEIQTDPMDQELIQNYISCNSDLKSSIDLLTEQLESSNYKFQKTDIQLKDQTQVIIQLKKELNDTRSKLICAQRDLM+ESTKKKVANTGNQSTSGDTDFKSETVSNISDAINENPN ETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTVRNPTINFVKSLQLVKDDDLNHSNNLVTLVDNLDQFVSLISDILPNLFDV+QDKNNNNLTTLLVQCTCLHPDSKIREKLLRFLINLHPDPSA ERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEILISMRSFNTT+INVQYGSLCLHLNVIQFLIPFIDVWIKLSTPQVFNEIVDDKDSDFIANS NSKILELYRTDVIVNREKYIKSQKSFLHYTSINIPMSSITDLDESTIDSKEMIQGWFIWPQLKWLQTELVNTLVDFLFNIRSKTDKVDLTNPQTMSDIAKNQFTANPLKSKETCLKIGAIMFELGCRFSVPVINNVFIPCFSHLLYESSSKGVDCNLKSEIISTGIVSGYCALLASLIQLDHSHAASENLKRFLTNISFLVAAESLSYDG+RLAIDVLSSGLGNANLLSEIIISSLQPCIGCPNVSVRLFVCLMIQELVVQWATLPTIEDNNFGSVINSLKNLIDSPHEVVKVMCVGPLVSLLQVKSATPVIRKQIYDCLSELMNESVNFKSESLEKTHSS PCTEVLITALIQMINVVGPTSPESFRDESILPWLFGITEINNGTSDTARRSGIAMILYSTFSTLSY
Sbjct:    1 MIILNQMTENITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTSHIELPSSRIKASPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIRSKRHIMDENVFLVDSKPNNKCEEIQTDPMDQELIQNYISCNSDLKSSIDLLTEQLESSNYKFQKTDIQLKDQTQVIIQLKKELNDTRSKLICAQRDLMYESTKKKVANTGNQSTSGDTDFKSETVSNISDAINENPNPETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTVRNPTINFVKSLQLVKDDDLNHSNNLVTLVDNLDQFVSLISDILPNLFDVIQDKNNNNLTTLLVQCTCLHPDSKIREKLLRFLINLHPDPSASERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEILISMRSFNTTIINVQYGSLCLHLNVIQFLIPFIDVWIKLSTPQVFNEIVDDKDSDFIANSVNSKILELYRTDVIVNREKYIKSQKSFLHYTSINIPMSSITDLDESTIDSKEMIQGWFIWPQLKWLQTELVNTLVDFLFNIRSKTDKVDLTNPQTMSDIAKNQFTANPLKSKETCLKIGAIMFELGCRFSVPVINNVFIPCFSHLLYESSSKGVDCNLKSEIISTGIVSGYCALLASLIQLDHSHAASENLKRFLTNISFLVAAESLSYDGIRLAIDVLSSGLGNANLLSEIIISSLQPCIGCPNVSVRLFVCLMIQELVVQWATLPTIEDNNFGSVINSLKNLIDSPHEVVKVMCVGPLVSLLQVKSATPVIRKQIYDCLSELMNESVNFKSESLEKTHSSIPCTEVLITALIQMINVVGPTSPESFRDESILPWLFGITEINNGTSDTARRSGIAMILYSTFSTLSY 1109          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Planmine SMEST
Match: SMESG000080793.1 (SMESG000080793.1)

HSP 1 Score: 2219.51 bits (5750), Expect = 0.000e+0
Identity = 1101/1109 (99.28%), Postives = 1105/1109 (99.64%), Query Frame = 2
Query:   35 MIILNQMTENITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTSHIELPSSRIKASPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIRSKRHIMDENVFLVDSKPNNKCEEIQTDPMDQELIQNYISCNSDLKSSIDLLTEQLESSNYKFQKTDIQLKDQTQVIIQLKKELNDTRSKLICAQRDLMFESTKKKVANTGNQSTSGDTDFKSETVSNISDAINENPNSETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTVRNPTINFVKSLQLVKDDDLNHSNNLVTLVDNLDQFVSLISDILPNLFDVMQDKNNNNLTTLLVQCTCLHPDSKIREKLLRFLINLHPDPSALERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEILISMRSFNTTMINVQYGSLCLHLNVIQFLIPFIDVWIKLSTPQVFNEIVDDKDSDFIANSDNSKILELYRTDVIVNREKYIKSQKSFLHYTSINIPMSSITDLDESTIDSKEMIQGWFIWPQLKWLQTELVNTLVDFLFNIRSKTDKVDLTNPQTMSDIAKNQFTANPLKSKETCLKIGAIMFELGCRFSVPVINNVFIPCFSHLLYESSSKGVDCNLKSEIISTGIVSGYCALLASLIQLDHSHAASENLKRFLTNISFLVAAESLSYDGVRLAIDVXXXXXXXXXXXXEIIISSLQPCIGCPNVSVRLFVCLMIQELVVQWATLPTIEDNNFGSVINSLKNLIDSPHEVVKVMCVGPLVSLLQVKSATPVIRKQIYDCLSELMNESVNFKSESLEKTHSSTPCTEVLITALIQMINVVGPTSPESFRDESILPWLFGITEINNGTSDTARRSGIAMILYSTFSTLSY 3361
            MIILNQMTENITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTSHIELPSSRIKASPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIRSKRHIMDENVFLVDSKPNNKCEEIQTDPMDQELIQNYISCNSDLKSSIDLLTEQLESSNYKFQKTDIQLKDQTQVIIQLKKELNDTRSKLICAQRDLM+ESTKKKVANTGNQSTSGDTDFKSETVSNISDAINENPN ETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTVRNPTINFVKSLQLVKDDDLNHSNNLVTLVDNLDQFVSLISDILPNLFDV+QDKNNNNLTTLLVQCTCLHPDSKIREKLLRFLINLHPDPSA ERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEILISMRSFNTT+INVQYGSLCLHLNVIQFLIPFIDVWIKLSTPQVFNEIVDDKDSDFIANS NSKILELYRTDVIVNREKYIKSQKSFLHYTSINIPMSSITDLDESTIDSKEMIQGWFIWPQLKWLQTELVNTLVDFLFNIRSKTDKVDLTNPQTMSDIAKNQFTANPLKSKETCLKIGAIMFELGCRFSVPVINNVFIPCFSHLLYESSSKGVDCNLKSEIISTGIVSGYCALLASLIQLDHSHAASENLKRFLTNISFLVAAESLSYDG+RLAIDVLSSGLGNANLLSEIIISSLQPCIGCPNVSVRLFVCLMIQELVVQWATLPTIEDNNFGSVINSLKNLIDSPHEVVKVMCVGPLVSLLQVKSATPVIRKQIYDCLSELMNESVNFKSESLEKTHSS PCTEVLITALIQMINVVGPTSPESFRDESILPWLFGITEINNGTSDTARRSGIAMILYSTFSTLSY
Sbjct:    1 MIILNQMTENITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTSHIELPSSRIKASPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIRSKRHIMDENVFLVDSKPNNKCEEIQTDPMDQELIQNYISCNSDLKSSIDLLTEQLESSNYKFQKTDIQLKDQTQVIIQLKKELNDTRSKLICAQRDLMYESTKKKVANTGNQSTSGDTDFKSETVSNISDAINENPNPETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTVRNPTINFVKSLQLVKDDDLNHSNNLVTLVDNLDQFVSLISDILPNLFDVIQDKNNNNLTTLLVQCTCLHPDSKIREKLLRFLINLHPDPSASERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEILISMRSFNTTIINVQYGSLCLHLNVIQFLIPFIDVWIKLSTPQVFNEIVDDKDSDFIANSVNSKILELYRTDVIVNREKYIKSQKSFLHYTSINIPMSSITDLDESTIDSKEMIQGWFIWPQLKWLQTELVNTLVDFLFNIRSKTDKVDLTNPQTMSDIAKNQFTANPLKSKETCLKIGAIMFELGCRFSVPVINNVFIPCFSHLLYESSSKGVDCNLKSEIISTGIVSGYCALLASLIQLDHSHAASENLKRFLTNISFLVAAESLSYDGIRLAIDVLSSGLGNANLLSEIIISSLQPCIGCPNVSVRLFVCLMIQELVVQWATLPTIEDNNFGSVINSLKNLIDSPHEVVKVMCVGPLVSLLQVKSATPVIRKQIYDCLSELMNESVNFKSESLEKTHSSIPCTEVLITALIQMINVVGPTSPESFRDESILPWLFGITEINNGTSDTARRSGIAMILYSTFSTLSY 1109          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Planmine SMEST
Match: SMESG000080793.1 (SMESG000080793.1)

HSP 1 Score: 2208.34 bits (5721), Expect = 0.000e+0
Identity = 1095/1103 (99.27%), Postives = 1099/1103 (99.64%), Query Frame = 2
Query:   53 MTENITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTSHIELPSSRIKASPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIRSKRHIMDENVFLVDSKPNNKCEEIQTDPMDQELIQNYISCNSDLKSSIDLLTEQLESSNYKFQKTDIQLKDQTQVIIQLKKELNDTRSKLICAQRDLMFESTKKKVANTGNQSTSGDTDFKSETVSNISDAINENPNSETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTVRNPTINFVKSLQLVKDDDLNHSNNLVTLVDNLDQFVSLISDILPNLFDVMQDKNNNNLTTLLVQCTCLHPDSKIREKLLRFLINLHPDPSALERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEILISMRSFNTTMINVQYGSLCLHLNVIQFLIPFIDVWIKLSTPQVFNEIVDDKDSDFIANSDNSKILELYRTDVIVNREKYIKSQKSFLHYTSINIPMSSITDLDESTIDSKEMIQGWFIWPQLKWLQTELVNTLVDFLFNIRSKTDKVDLTNPQTMSDIAKNQFTANPLKSKETCLKIGAIMFELGCRFSVPVINNVFIPCFSHLLYESSSKGVDCNLKSEIISTGIVSGYCALLASLIQLDHSHAASENLKRFLTNISFLVAAESLSYDGVRLAIDVXXXXXXXXXXXXEIIISSLQPCIGCPNVSVRLFVCLMIQELVVQWATLPTIEDNNFGSVINSLKNLIDSPHEVVKVMCVGPLVSLLQVKSATPVIRKQIYDCLSELMNESVNFKSESLEKTHSSTPCTEVLITALIQMINVVGPTSPESFRDESILPWLFGITEINNGTSDTARRSGIAMILYSTFSTLSY 3361
            MTENITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTSHIELPSSRIKASPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIRSKRHIMDENVFLVDSKPNNKCEEIQTDPMDQELIQNYISCNSDLKSSIDLLTEQLESSNYKFQKTDIQLKDQTQVIIQLKKELNDTRSKLICAQRDLM+ESTKKKVANTGNQSTSGDTDFKSETVSNISDAINENPN ETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTVRNPTINFVKSLQLVKDDDLNHSNNLVTLVDNLDQFVSLISDILPNLFDV+QDKNNNNLTTLLVQCTCLHPDSKIREKLLRFLINLHPDPSA ERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEILISMRSFNTT+INVQYGSLCLHLNVIQFLIPFIDVWIKLSTPQVFNEIVDDKDSDFIANS NSKILELYRTDVIVNREKYIKSQKSFLHYTSINIPMSSITDLDESTIDSKEMIQGWFIWPQLKWLQTELVNTLVDFLFNIRSKTDKVDLTNPQTMSDIAKNQFTANPLKSKETCLKIGAIMFELGCRFSVPVINNVFIPCFSHLLYESSSKGVDCNLKSEIISTGIVSGYCALLASLIQLDHSHAASENLKRFLTNISFLVAAESLSYDG+RLAIDVLSSGLGNANLLSEIIISSLQPCIGCPNVSVRLFVCLMIQELVVQWATLPTIEDNNFGSVINSLKNLIDSPHEVVKVMCVGPLVSLLQVKSATPVIRKQIYDCLSELMNESVNFKSESLEKTHSS PCTEVLITALIQMINVVGPTSPESFRDESILPWLFGITEINNGTSDTARRSGIAMILYSTFSTLSY
Sbjct:    1 MTENITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTSHIELPSSRIKASPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIRSKRHIMDENVFLVDSKPNNKCEEIQTDPMDQELIQNYISCNSDLKSSIDLLTEQLESSNYKFQKTDIQLKDQTQVIIQLKKELNDTRSKLICAQRDLMYESTKKKVANTGNQSTSGDTDFKSETVSNISDAINENPNPETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTVRNPTINFVKSLQLVKDDDLNHSNNLVTLVDNLDQFVSLISDILPNLFDVIQDKNNNNLTTLLVQCTCLHPDSKIREKLLRFLINLHPDPSASERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEILISMRSFNTTIINVQYGSLCLHLNVIQFLIPFIDVWIKLSTPQVFNEIVDDKDSDFIANSVNSKILELYRTDVIVNREKYIKSQKSFLHYTSINIPMSSITDLDESTIDSKEMIQGWFIWPQLKWLQTELVNTLVDFLFNIRSKTDKVDLTNPQTMSDIAKNQFTANPLKSKETCLKIGAIMFELGCRFSVPVINNVFIPCFSHLLYESSSKGVDCNLKSEIISTGIVSGYCALLASLIQLDHSHAASENLKRFLTNISFLVAAESLSYDGIRLAIDVLSSGLGNANLLSEIIISSLQPCIGCPNVSVRLFVCLMIQELVVQWATLPTIEDNNFGSVINSLKNLIDSPHEVVKVMCVGPLVSLLQVKSATPVIRKQIYDCLSELMNESVNFKSESLEKTHSSIPCTEVLITALIQMINVVGPTSPESFRDESILPWLFGITEINNGTSDTARRSGIAMILYSTFSTLSY 1103          
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Planmine SMEST
Match: SMESG000080793.1 (SMESG000080793.1)

HSP 1 Score: 2207.95 bits (5720), Expect = 0.000e+0
Identity = 1095/1103 (99.27%), Postives = 1099/1103 (99.64%), Query Frame = 2
Query:   53 MTENITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTSHIELPSSRIKASPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIRSKRHIMDENVFLVDSKPNNKCEEIQTDPMDQELIQNYISCNSDLKSSIDLLTEQLESSNYKFQKTDIQLKDQTQVIIQLKKELNDTRSKLICAQRDLMFESTKKKVANTGNQSTSGDTDFKSETVSNISDAINENPNSETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTVRNPTINFVKSLQLVKDDDLNHSNNLVTLVDNLDQFVSLISDILPNLFDVMQDKNNNNLTTLLVQCTCLHPDSKIREKLLRFLINLHPDPSALERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEILISMRSFNTTMINVQYGSLCLHLNVIQFLIPFIDVWIKLSTPQVFNEIVDDKDSDFIANSDNSKILELYRTDVIVNREKYIKSQKSFLHYTSINIPMSSITDLDESTIDSKEMIQGWFIWPQLKWLQTELVNTLVDFLFNIRSKTDKVDLTNPQTMSDIAKNQFTANPLKSKETCLKIGAIMFELGCRFSVPVINNVFIPCFSHLLYESSSKGVDCNLKSEIISTGIVSGYCALLASLIQLDHSHAASENLKRFLTNISFLVAAESLSYDGVRLAIDVXXXXXXXXXXXXEIIISSLQPCIGCPNVSVRLFVCLMIQELVVQWATLPTIEDNNFGSVINSLKNLIDSPHEVVKVMCVGPLVSLLQVKSATPVIRKQIYDCLSELMNESVNFKSESLEKTHSSTPCTEVLITALIQMINVVGPTSPESFRDESILPWLFGITEINNGTSDTARRSGIAMILYSTFSTLSY 3361
            MTENITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTSHIELPSSRIKASPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIRSKRHIMDENVFLVDSKPNNKCEEIQTDPMDQELIQNYISCNSDLKSSIDLLTEQLESSNYKFQKTDIQLKDQTQVIIQLKKELNDTRSKLICAQRDLM+ESTKKKVANTGNQSTSGDTDFKSETVSNISDAINENPN ETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTVRNPTINFVKSLQLVKDDDLNHSNNLVTLVDNLDQFVSLISDILPNLFDV+QDKNNNNLTTLLVQCTCLHPDSKIREKLLRFLINLHPDPSA ERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEILISMRSFNTT+INVQYGSLCLHLNVIQFLIPFIDVWIKLSTPQVFNEIVDDKDSDFIANS NSKILELYRTDVIVNREKYIKSQKSFLHYTSINIPMSSITDLDESTIDSKEMIQGWFIWPQLKWLQTELVNTLVDFLFNIRSKTDKVDLTNPQTMSDIAKNQFTANPLKSKETCLKIGAIMFELGCRFSVPVINNVFIPCFSHLLYESSSKGVDCNLKSEIISTGIVSGYCALLASLIQLDHSHAASENLKRFLTNISFLVAAESLSYDG+RLAIDVLSSGLGNANLLSEIIISSLQPCIGCPNVSVRLFVCLMIQELVVQWATLPTIEDNNFGSVINSLKNLIDSPHEVVKVMCVGPLVSLLQVKSATPVIRKQIYDCLSELMNESVNFKSESLEKTHSS PCTEVLITALIQMINVVGPTSPESFRDESILPWLFGITEINNGTSDTARRSGIAMILYSTFSTLSY
Sbjct:    1 MTENITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYFTNPENFENVTSHIELPSSRIKASPSISTIDSIDFAKYSDDGLQQADERIKVLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTFSAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGLNIPKLPHLESFIRSKRHIMDENVFLVDSKPNNKCEEIQTDPMDQELIQNYISCNSDLKSSIDLLTEQLESSNYKFQKTDIQLKDQTQVIIQLKKELNDTRSKLICAQRDLMYESTKKKVANTGNQSTSGDTDFKSETVSNISDAINENPNPETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTVRNPTINFVKSLQLVKDDDLNHSNNLVTLVDNLDQFVSLISDILPNLFDVIQDKNNNNLTTLLVQCTCLHPDSKIREKLLRFLINLHPDPSASERLMILKQIRILSGYLGPFRVEAELITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQMLEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEKKISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEILISMRSFNTTIINVQYGSLCLHLNVIQFLIPFIDVWIKLSTPQVFNEIVDDKDSDFIANSVNSKILELYRTDVIVNREKYIKSQKSFLHYTSINIPMSSITDLDESTIDSKEMIQGWFIWPQLKWLQTELVNTLVDFLFNIRSKTDKVDLTNPQTMSDIAKNQFTANPLKSKETCLKIGAIMFELGCRFSVPVINNVFIPCFSHLLYESSSKGVDCNLKSEIISTGIVSGYCALLASLIQLDHSHAASENLKRFLTNISFLVAAESLSYDGIRLAIDVLSSGLGNANLLSEIIISSLQPCIGCPNVSVRLFVCLMIQELVVQWATLPTIEDNNFGSVINSLKNLIDSPHEVVKVMCVGPLVSLLQVKSATPVIRKQIYDCLSELMNESVNFKSESLEKTHSSIPCTEVLITALIQMINVVGPTSPESFRDESILPWLFGITEINNGTSDTARRSGIAMILYSTFSTLSY 1103          
The following BLAST results are available for this feature:
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
RELCH6.743e-6829.21RAB11 binding and LisH domain, coiled-coil and HEA... [more]
RELCH3.909e-6729.21RAB11 binding and LisH domain, coiled-coil and HEA... [more]
RELCH4.014e-6729.21RAB11 binding and LisH domain, coiled-coil and HEA... [more]
RELCH4.846e-6729.21RAB11 binding and LisH domain, coiled-coil and HEA... [more]
back to top
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
relch5.502e-4345.02RAB11 binding and LisH domain, coiled-coil and HEA... [more]
relch5.530e-4345.02RAB11 binding and LisH domain, coiled-coil and HEA... [more]
relch6.151e-4345.02RAB11 binding and LisH domain, coiled-coil and HEA... [more]
relch1.082e-3339.34RAB11 binding and LisH domain, coiled-coil and HEA... [more]
relch4.083e-3150.36RAB11 binding and LisH domain, coiled-coil and HEA... [more]
back to top
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mrpl282.255e-6729.11mitochondrial ribosomal protein L28 [Source:Xenbas... [more]
mrpl282.380e-6729.11mitochondrial ribosomal protein L28 [Source:Xenbas... [more]
mrpl282.906e-6729.11mitochondrial ribosomal protein L28 [Source:Xenbas... [more]
mrpl283.417e-6729.45mitochondrial ribosomal protein L28 [Source:Xenbas... [more]
mrpl281.177e-6629.15mitochondrial ribosomal protein L28 [Source:Xenbas... [more]
back to top
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Relch1.909e-6929.89RAB11 binding and LisH domain, coiled-coil and HEA... [more]
Relch1.943e-6929.89RAB11 binding and LisH domain, coiled-coil and HEA... [more]
Relch2.582e-6028.33RAB11 binding and LisH domain, coiled-coil and HEA... [more]
Relch7.110e-4340.77RAB11 binding and LisH domain, coiled-coil and HEA... [more]
Relch7.821e-1047.62RAB11 binding and LisH domain, coiled-coil and HEA... [more]
back to top
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q148V7|RELCH_MOUSE1.312e-6829.89RAB11-binding protein RELCH OS=Mus musculus OX=100... [more]
sp|Q9P260|RELCH_HUMAN1.877e-6629.21RAB11-binding protein RELCH OS=Homo sapiens OX=960... [more]
sp|Q08BT5|RELCH_XENTR5.285e-5727.38RAB11-binding protein RELCH homolog OS=Xenopus tro... [more]
sp|Q6P6Y1|RELCH_DANRE3.897e-4245.02RAB11-binding protein RELCH homolog OS=Danio rerio... [more]
back to top
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4D5RUA01.560e-7626.89Protein phosphatase 2a regulatory subunit a (Fragm... [more]
A0A5K3EI075.191e-7628.27Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A4S2M2791.124e-7527.36LisH domain-containing protein OS=Opisthorchis fel... [more]
A0A131YBH71.370e-7527.33Protein phosphatase 2a regulatory subunit a OS=Ixo... [more]
V5HYB62.613e-7527.33Protein phosphatase 2a regulatory subunit a OS=Ixo... [more]
back to top
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
relch5.284e-7130.64RAB11 binding and LisH domain, coiled-coil and HEA... [more]
relch2.772e-7030.87RAB11 binding and LisH domain, coiled-coil and HEA... [more]
relch3.908e-6029.07RAB11 binding and LisH domain, coiled-coil and HEA... [more]
back to top
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000000188.11.130e-5725.75pep scaffold:Pmarinus_7.0:GL476590:153062:177616:1... [more]
ENSPMAT00000002860.16.389e-631.82pep scaffold:Pmarinus_7.0:GL476846:138808:150066:1... [more]
back to top
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO339122.284e-2125.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
relch4.084e-7230.03RAB11 binding and LisH domain, coiled-coil and HEA... [more]
relch4.548e-7130.26RAB11 binding and LisH domain, coiled-coil and HEA... [more]
relch8.194e-6228.53RAB11 binding and LisH domain, coiled-coil and HEA... [more]
relch3.662e-4241.60RAB11 binding and LisH domain, coiled-coil and HEA... [more]
relch5.467e-3938.67RAB11 binding and LisH domain, coiled-coil and HEA... [more]
back to top
BLAST of RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000080793.10.000e+099.28SMESG000080793.1[more]
SMESG000080793.10.000e+099.28SMESG000080793.1[more]
SMESG000080793.10.000e+099.27SMESG000080793.1[more]
SMESG000080793.10.000e+099.27SMESG000080793.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002798 ID=SMED30002798|Name=RAB11 binding and LisH domain, coiled-coil and HEAT repeat containing|organism=Schmidtea mediterranea sexual|type=transcript|length=3935bp
TTATAAGTAGCAGATTATTTAATCCTTTTATTGTATGATTATATTAAATC
AAATGACGGAAAATATTACAATAGATGACATATCTCATTTTCTAATAAAT
AATAACTATCAATTAACTGCTTTAGAATTAGATTTTGAATTAATAGAGAG
AGGAATTGAAAATAAGTTCTTAAGAAATTATTTTACAAATCCTGAAAACT
TTGAAAATGTCACATCTCATATTGAATTACCATCAAGCAGAATTAAAGCA
TCGCCAAGTATTTCTACTATCGATAGTATAGATTTCGCTAAATATTCTGA
CGATGGATTGCAGCAAGCAGATGAAAGAATCAAAGTTCTTGAATTCGAAT
TGCGAAAAAAGAATGAAGAAGTCAAAAAACTTCGTGAAGAATTGACATTA
ATGTCCACTTTCAAAACCAACAAATCCTCTGTTATAGACTGGATTCCAAA
TTCTTCGAATTACAATGACGATTACGATACTTTCTCAGCTGAACCATTAA
TGGCTCATGAAAATAGAGCTTTAAATTTTCTTATCAACGAATATTTATTA
AAACATGGGTTCAAATTGACTGCAGTTTCATTTTCAGAAGAAATTACAGA
CCAGGATTTGGATACGTGGGATGATGTTGGTCTTAATATTCCGAAGTTAC
CTCATTTGGAAAGTTTTATTCGTTCCAAGAGACATATTATGGACGAAAAT
GTTTTTCTGGTTGACTCGAAGCCAAATAATAAATGTGAAGAAATTCAAAC
TGATCCCATGGATCAAGAATTGATCCAGAATTACATTAGCTGTAATTCCG
ATCTCAAGAGCTCTATTGATTTATTGACAGAACAGTTAGAATCATCGAAT
TACAAATTTCAAAAAACGGATATCCAGTTGAAAGATCAAACCCAAGTGAT
TATTCAATTGAAGAAAGAACTTAACGATACAAGAAGCAAACTAATTTGCG
CCCAGAGAGATTTAATGTTTGAAAGTACCAAGAAAAAAGTTGCAAACACC
GGAAATCAATCTACATCCGGTGACACAGATTTCAAGTCCGAGACAGTTTC
CAATATCAGTGATGCCATTAATGAGAATCCTAACTCTGAAACTTTTCCAC
AGAAAGATAATGAAACAAATTTTGAACCGACAGATGTTGAAGATAACAAT
GTTGTAAAAAATATATTTGATGAAGTTTCAACTGTCAGAAATCCTACTAT
AAATTTCGTGAAATCCCTTCAGTTAGTCAAAGATGATGATCTTAATCATA
GTAACAATTTGGTGACTCTTGTTGATAATTTAGATCAATTCGTATCCTTG
ATTTCCGATATTCTTCCGAATCTATTTGATGTTATGCAGGATAAAAATAA
TAATAATTTAACTACATTACTTGTCCAATGTACTTGTCTACATCCTGATT
CTAAGATTCGTGAGAAATTGCTCAGATTTCTGATAAACCTACATCCGGAC
CCCTCTGCATTAGAACGACTGATGATTCTAAAACAAATCCGTATTCTATC
TGGCTACCTTGGTCCATTCAGAGTTGAAGCGGAATTGATTACTCAAATCT
GGGAAATGCTTTATGAAAAGCCAAAGCCAAATTCGAATAAACGGATTTTG
TTGGCAAATATTTGTGGTGTAGTTTGTCCCTTGGCACCGTCAAATCTTAG
AAGTTCGCTTATCTTGAGTATTCATCAACAGATGCTTGAAGAGGAACATG
ACGCTAAAGTTATCGCTCACATCCTTTCGAGCATAGCTAGCACAATTCCT
TATTTAGAAGACACTGATAAAATACCCCATGTCATTCAAATGATGGCACG
CTATCTATGGAAATCGGAATCCTTACTTGAAAAAAAGATTTCTACGGAAA
ATGAAGTAAATGGTGAAGATGTTGTTAAATTTCAACTCCTGCCTGCCGTT
GCACAGTGGTGCATTGATGCTGATGTGTTGCACAATTTCTTAATTCATGA
GATATTGATTTCGATGAGAAGTTTTAACACGACAATGATTAACGTACAGT
ATGGAAGTCTTTGCCTTCATTTGAATGTCATTCAGTTTCTGATACCCTTC
ATTGACGTTTGGATTAAGTTATCTACTCCTCAGGTTTTCAATGAAATAGT
TGATGACAAGGACTCTGATTTCATTGCTAATTCCGACAATTCAAAAATTT
TGGAGCTCTATCGTACTGACGTCATTGTCAATCGTGAAAAATACATAAAA
TCCCAGAAATCATTTCTGCATTACACCTCAATAAACATTCCGATGTCATC
AATCACTGATTTAGATGAATCGACGATTGACAGCAAGGAAATGATTCAGG
GCTGGTTTATATGGCCACAGCTGAAGTGGTTACAAACTGAATTAGTTAAC
ACCCTTGTCGATTTTCTCTTCAATATTCGATCAAAGACGGACAAAGTTGA
TCTAACGAATCCTCAAACAATGTCTGACATTGCTAAAAATCAATTTACAG
CAAATCCTTTGAAGTCGAAAGAGACGTGTTTGAAAATCGGAGCTATTATG
TTTGAATTAGGTTGTCGTTTTTCAGTGCCTGTGATAAATAATGTTTTTAT
TCCGTGCTTTTCTCATCTATTATATGAATCATCAAGTAAAGGGGTTGATT
GCAATCTGAAATCGGAAATAATCAGTACAGGAATAGTATCTGGATATTGT
GCTCTCCTTGCATCTTTGATTCAATTGGATCATTCACATGCTGCTTCTGA
AAATCTTAAAAGATTTCTTACAAATATTTCGTTTCTAGTTGCTGCAGAAA
GTCTTTCTTATGATGGAGTCAGATTAGCTATAGATGTGTTGAGTTCTGGT
TTAGGAAATGCAAATTTATTGTCAGAAATCATAATCTCGTCATTACAACC
ATGTATAGGTTGTCCGAATGTATCTGTGAGATTATTTGTTTGTCTGATGA
TTCAGGAACTTGTGGTACAGTGGGCTACCTTACCCACTATTGAGGATAAC
AATTTCGGTTCTGTAATAAATTCATTAAAGAATCTAATAGATTCTCCACA
TGAAGTTGTCAAAGTCATGTGCGTAGGTCCCCTTGTCAGCCTATTACAAG
TAAAATCAGCAACCCCTGTTATTAGGAAACAGATTTACGATTGTTTATCT
GAACTGATGAATGAATCGGTAAATTTCAAATCAGAATCTCTTGAAAAAAC
ACATTCTAGTACACCATGCACTGAAGTATTAATTACGGCTCTCATTCAAA
TGATTAACGTTGTCGGTCCAACTAGTCCAGAATCTTTTAGAGACGAATCT
ATTCTGCCCTGGCTTTTTGGTATCACTGAAATTAATAATGGGACATCAGA
TACTGCCAGGCGATCTGGAATCGCTATGATTCTTTATAGTACATTTTCAA
CCTTGAGTTACTGTATCCTTTTATTAGTAATGTAACATAATTATACATTT
CAAATTGTTTGTTAATAAGAGTAGTAACTAAGAATTTGTAAAATTAGCTA
TAAAATTAGTGAAATCGATTAAAAACAATAACAATAAACAAAAAAAATAT
TTCGTAGACATTGTAATACAAGTGCCGACAAATAAAACAATGTTACCAAA
AATATATCTTCCTGGTGTAGACAATTTATTTGCAATTAAATATCAGGAGA
TATACTTGAAGAATCTAAAATTTTCAATTAAAACTAAAACAGAAAAAATG
ATGACTGCCCAAGACCGAACAGGATTAATTTACCAACCCAGTAAAGAGGT
TGGGAGGAAGTTCTGTAGGAACGGGGAAGTATATGACGATAAACTAGAGT
ATGTTCAATTCGATTTCACAAAAATGTTTTGTGATATTGTTGACTTTTTA
GCGGTTTCTGCAACATCAACTATCATGTGCAAAAGAACAGAAACAATTAT
CTCACCGATTAAATATAAATTTTTATTGTTTTATTGATTTCTATAATTAT
AATTATTAAATATATTTAAATTAATAACTAAGCCA
back to top

protein sequence of SMED30002798-orf-1

>SMED30002798-orf-1 ID=SMED30002798-orf-1|Name=SMED30002798-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1117bp
MIILNQMTENITIDDISHFLINNNYQLTALELDFELIERGIENKFLRNYF
TNPENFENVTSHIELPSSRIKASPSISTIDSIDFAKYSDDGLQQADERIK
VLEFELRKKNEEVKKLREELTLMSTFKTNKSSVIDWIPNSSNYNDDYDTF
SAEPLMAHENRALNFLINEYLLKHGFKLTAVSFSEEITDQDLDTWDDVGL
NIPKLPHLESFIRSKRHIMDENVFLVDSKPNNKCEEIQTDPMDQELIQNY
ISCNSDLKSSIDLLTEQLESSNYKFQKTDIQLKDQTQVIIQLKKELNDTR
SKLICAQRDLMFESTKKKVANTGNQSTSGDTDFKSETVSNISDAINENPN
SETFPQKDNETNFEPTDVEDNNVVKNIFDEVSTVRNPTINFVKSLQLVKD
DDLNHSNNLVTLVDNLDQFVSLISDILPNLFDVMQDKNNNNLTTLLVQCT
CLHPDSKIREKLLRFLINLHPDPSALERLMILKQIRILSGYLGPFRVEAE
LITQIWEMLYEKPKPNSNKRILLANICGVVCPLAPSNLRSSLILSIHQQM
LEEEHDAKVIAHILSSIASTIPYLEDTDKIPHVIQMMARYLWKSESLLEK
KISTENEVNGEDVVKFQLLPAVAQWCIDADVLHNFLIHEILISMRSFNTT
MINVQYGSLCLHLNVIQFLIPFIDVWIKLSTPQVFNEIVDDKDSDFIANS
DNSKILELYRTDVIVNREKYIKSQKSFLHYTSINIPMSSITDLDESTIDS
KEMIQGWFIWPQLKWLQTELVNTLVDFLFNIRSKTDKVDLTNPQTMSDIA
KNQFTANPLKSKETCLKIGAIMFELGCRFSVPVINNVFIPCFSHLLYESS
SKGVDCNLKSEIISTGIVSGYCALLASLIQLDHSHAASENLKRFLTNISF
LVAAESLSYDGVRLAIDVLSSGLGNANLLSEIIISSLQPCIGCPNVSVRL
FVCLMIQELVVQWATLPTIEDNNFGSVINSLKNLIDSPHEVVKVMCVGPL
VSLLQVKSATPVIRKQIYDCLSELMNESVNFKSESLEKTHSSTPCTEVLI
TALIQMINVVGPTSPESFRDESILPWLFGITEINNGTSDTARRSGIAMIL
YSTFSTLSYCILLLVM*
back to top

protein sequence of SMED30002798-orf-2

>SMED30002798-orf-2 ID=SMED30002798-orf-2|Name=SMED30002798-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=116bp
MLPKIYLPGVDNLFAIKYQEIYLKNLKFSIKTKTEKMMTAQDRTGLIYQP
SKEVGRKFCRNGEVYDDKLEYVQFDFTKMFCDIVDFLAVSATSTIMCKRT
ETIISPIKYKFLLFY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005802trans-Golgi network
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0032367intracellular cholesterol transport
GO:0008150biological_process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR040362RELCH
IPR006594LisH
IPR011989ARM-like
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005488binding
GO:0003674molecular_function
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 282..309
NoneNo IPR availableCOILSCoilCoilcoord: 92..119
NoneNo IPR availablePANTHERPTHR32059:SF0LISH DOMAIN AND HEAT REPEAT-CONTAINING PROTEIN KIAA1468coord: 8..1112
NoneNo IPR availableTMHMMTMhelixcoord: 1096..1115
IPR006594LIS1 homology motifSMARTSM00667Lishcoord: 159..191
e-value: 5.3E-4
score: 29.3
IPR006594LIS1 homology motifPROSITEPS50896LISHcoord: 159..191
score: 9.647
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 389..591
e-value: 2.6E-5
score: 26.1
IPR040362RAB11-binding protein RELCHPANTHERPTHR32059FAMILY NOT NAMEDcoord: 8..1112
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 408..1078