Serine/threonine-protein phosphatase 4 regulatory subunit 2

Overview
NameSerine/threonine-protein phosphatase 4 regulatory subunit 2
Smed IDSMED30002777
Length (bp)2599
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine-protein phosphatase 4 regulatory subunit 2 (SMED30002777) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine-protein phosphatase 4 regulatory subunit 2 (SMED30002777) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine-protein phosphatase 4 regulatory subunit 2 (SMED30002777) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine-protein phosphatase 4 regulatory subunit 2 (SMED30002777) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002777

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30002777h1SMcG0015021 SmedASXL_016306SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30002777h1SMcG0015021 SmedASXL_016306SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Human
Match: PPP4R2 (protein phosphatase 4 regulatory subunit 2 [Source:HGNC Symbol;Acc:HGNC:18296])

HSP 1 Score: 89.3521 bits (220), Expect = 2.445e-19
Identity = 49/134 (36.57%), Postives = 75/134 (55.97%), Query Frame = 2
Query:  101 DAIKVALKDYQ-NTTGEIPKVLDRYLEYVARTGKPLFSWDLISNLIIKKFENVFDDFGVDKSIQNVKTINNDNATA---HSLKQECLQAIATLTGVPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTV 490
            + ++ ALKD++     E+  VLD++L +VA+TG+ +  W       I K E V DDF    S    +   N N        +K+  L+ +    G+PFTIQR+CELL +P++NYT  +KFLRG  + + VV+ V
Sbjct:    4 ERLQEALKDFEKRGKKEVCPVLDQFLCHVAKTGETMIQWSQFKGYFIFKLEKVMDDFRT--SAPEPRGPPNPNVEYIPFDEMKERILKIVTGFNGIPFTIQRLCELLTDPRRNYTGTDKFLRGVEKNVMVVSCV 135          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Human
Match: PPP4R2 (protein phosphatase 4 regulatory subunit 2 [Source:HGNC Symbol;Acc:HGNC:18296])

HSP 1 Score: 92.0485 bits (227), Expect = 5.775e-19
Identity = 49/134 (36.57%), Postives = 75/134 (55.97%), Query Frame = 2
Query:  101 DAIKVALKDYQ-NTTGEIPKVLDRYLEYVARTGKPLFSWDLISNLIIKKFENVFDDFGVDKSIQNVKTINNDNATA---HSLKQECLQAIATLTGVPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTV 490
            + ++ ALKD++     E+  VLD++L +VA+TG+ +  W       I K E V DDF    S    +   N N        +K+  L+ +    G+PFTIQR+CELL +P++NYT  +KFLRG  + + VV+ V
Sbjct:    4 ERLQEALKDFEKRGKKEVCPVLDQFLCHVAKTGETMIQWSQFKGYFIFKLEKVMDDFRT--SAPEPRGPPNPNVEYIPFDEMKERILKIVTGFNGIPFTIQRLCELLTDPRRNYTGTDKFLRGVEKNVMVVSCV 135          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Human
Match: CLSPN (claspin [Source:HGNC Symbol;Acc:HGNC:19715])

HSP 1 Score: 70.0922 bits (170), Expect = 1.493e-11
Identity = 42/98 (42.86%), Postives = 60/98 (61.22%), Query Frame = 2
Query: 1667 FIDDEAELSGSDDDDNEHYGPDEDGSDLDRYXXXXXXXXXKLPSEGRLRRQIEKIHNRLEIDKDARDIRYLKELYLEDGDLHIAGAGQRRRRYEWAAI 1960
            +++DEAE+SGSD    + Y    DG ++D YEE+   +   LPS+  L+ QI+KIH +  +D D R +R  +E YL DGDLH  G G R R++ W  I
Sbjct: 1053 YLEDEAEVSGSDVGSEDEY----DGEEIDEYEEDVIDEV--LPSDEELQSQIKKIHMKTMLDDDKRQLRLYQERYLADGDLHSDGPG-RMRKFRWKNI 1143          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Human
Match: CLSPN (claspin [Source:HGNC Symbol;Acc:HGNC:19715])

HSP 1 Score: 70.0922 bits (170), Expect = 1.541e-11
Identity = 42/98 (42.86%), Postives = 60/98 (61.22%), Query Frame = 2
Query: 1667 FIDDEAELSGSDDDDNEHYGPDEDGSDLDRYXXXXXXXXXKLPSEGRLRRQIEKIHNRLEIDKDARDIRYLKELYLEDGDLHIAGAGQRRRRYEWAAI 1960
            +++DEAE+SGSD    + Y    DG ++D YEE+   +   LPS+  L+ QI+KIH +  +D D R +R  +E YL DGDLH  G G R R++ W  I
Sbjct: 1000 YLEDEAEVSGSDVGSEDEY----DGEEIDEYEEDVIDEV--LPSDEELQSQIKKIHMKTMLDDDKRQLRLYQERYLADGDLHSDGPG-RMRKFRWKNI 1090          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Human
Match: CLSPN (claspin [Source:HGNC Symbol;Acc:HGNC:19715])

HSP 1 Score: 70.0922 bits (170), Expect = 1.702e-11
Identity = 43/104 (41.35%), Postives = 62/104 (59.62%), Query Frame = 2
Query: 1649 RMVPTDFIDDEAELSGSDDDDNEHYGPDEDGSDLDRYXXXXXXXXXKLPSEGRLRRQIEKIHNRLEIDKDARDIRYLKELYLEDGDLHIAGAGQRRRRYEWAAI 1960
            +M    +++DEAE+SGSD    + Y    DG ++D YEE+   +   LPS+  L+ QI+KIH +  +D D R +R  +E YL DGDLH  G G R R++ W  I
Sbjct:  983 QMRLRKYLEDEAEVSGSDVGSEDEY----DGEEIDEYEEDVIDEV--LPSDEELQSQIKKIHMKTMLDDDKRQLRLYQERYLADGDLHSDGPG-RMRKFRWKNI 1079          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Celegans
Match: ppfr-2 (Protein Phosphatase Four Regulatory subunit [Source:UniProtKB/TrEMBL;Acc:P91198])

HSP 1 Score: 57.3806 bits (137), Expect = 2.127e-8
Identity = 24/55 (43.64%), Postives = 35/55 (63.64%), Query Frame = 2
Query:  344 CLQAIATLTGVPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTVDRIGQK 508
             L    +  G PFT QR+CELL+ P ++Y  ++KFLR   +VI VVTT++  G +
Sbjct:  164 VLSKAKSFDGFPFTWQRLCELLIEPMRHYNTIDKFLRAVDKVINVVTTINENGGR 218          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Fly
Match: PPP4R2r (gene:FBgn0030208 transcript:FBtr0071451)

HSP 1 Score: 97.4413 bits (241), Expect = 1.584e-20
Identity = 53/150 (35.33%), Postives = 85/150 (56.67%), Query Frame = 2
Query:   80 LSIMENHDAIKVALKDYQN-TTGEIPKVLDRYLEYVARTGKPLFSWDLISNLIIKKFENVFDDFGVD----KSIQNVKTINNDNATAHSLKQECLQAIATLTGVPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTVDRIGQKIT 514
            +  MEN D I   L+ + +    EIPK L+ YL+YVA+TG  +F W  +  L  +K  +V   F  D    + I N   ++  N    ++K   L+ +      PFT+QR+CELL++P+K Y++++KF+R   + I VV+T+D  G+K T
Sbjct:    1 MVTMENSDEIMQILERFTDLKQKEIPKELEEYLQYVAKTGDTIFKWSSLKYLFREKLLSVIKHFNEDSPRLEEIPNYPNVDPFNY--ETMKSSLLERLDLFNAAPFTVQRLCELLIDPRKQYSRIDKFMRALEKNILVVSTID-PGRKRT 147          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Fly
Match: PPP4R2r (gene:FBgn0030208 transcript:FBtr0071452)

HSP 1 Score: 97.4413 bits (241), Expect = 1.584e-20
Identity = 53/150 (35.33%), Postives = 85/150 (56.67%), Query Frame = 2
Query:   80 LSIMENHDAIKVALKDYQN-TTGEIPKVLDRYLEYVARTGKPLFSWDLISNLIIKKFENVFDDFGVD----KSIQNVKTINNDNATAHSLKQECLQAIATLTGVPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTVDRIGQKIT 514
            +  MEN D I   L+ + +    EIPK L+ YL+YVA+TG  +F W  +  L  +K  +V   F  D    + I N   ++  N    ++K   L+ +      PFT+QR+CELL++P+K Y++++KF+R   + I VV+T+D  G+K T
Sbjct:    1 MVTMENSDEIMQILERFTDLKQKEIPKELEEYLQYVAKTGDTIFKWSSLKYLFREKLLSVIKHFNEDSPRLEEIPNYPNVDPFNY--ETMKSSLLERLDLFNAAPFTVQRLCELLIDPRKQYSRIDKFMRALEKNILVVSTID-PGRKRT 147          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Fly
Match: PPP4R2r (gene:FBgn0030208 transcript:FBtr0071453)

HSP 1 Score: 97.4413 bits (241), Expect = 1.584e-20
Identity = 53/150 (35.33%), Postives = 85/150 (56.67%), Query Frame = 2
Query:   80 LSIMENHDAIKVALKDYQN-TTGEIPKVLDRYLEYVARTGKPLFSWDLISNLIIKKFENVFDDFGVD----KSIQNVKTINNDNATAHSLKQECLQAIATLTGVPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTVDRIGQKIT 514
            +  MEN D I   L+ + +    EIPK L+ YL+YVA+TG  +F W  +  L  +K  +V   F  D    + I N   ++  N    ++K   L+ +      PFT+QR+CELL++P+K Y++++KF+R   + I VV+T+D  G+K T
Sbjct:    1 MVTMENSDEIMQILERFTDLKQKEIPKELEEYLQYVAKTGDTIFKWSSLKYLFREKLLSVIKHFNEDSPRLEEIPNYPNVDPFNY--ETMKSSLLERLDLFNAAPFTVQRLCELLIDPRKQYSRIDKFMRALEKNILVVSTID-PGRKRT 147          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Fly
Match: PPP4R2r (gene:FBgn0030208 transcript:FBtr0336899)

HSP 1 Score: 63.929 bits (154), Expect = 4.479e-10
Identity = 25/61 (40.98%), Postives = 42/61 (68.85%), Query Frame = 2
Query:  332 LKQECLQAIATLTGVPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTVDRIGQKIT 514
            +K   L+ +      PFT+QR+CELL++P+K Y++++KF+R   + I VV+T+D  G+K T
Sbjct:    1 MKSSLLERLDLFNAAPFTVQRLCELLIDPRKQYSRIDKFMRALEKNILVVSTID-PGRKRT 60          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Zebrafish
Match: ppp4r2b (protein phosphatase 4, regulatory subunit 2b [Source:NCBI gene;Acc:100005419])

HSP 1 Score: 93.5893 bits (231), Expect = 1.144e-19
Identity = 49/132 (37.12%), Postives = 73/132 (55.30%), Query Frame = 2
Query:  101 DAIKVALKDY-QNTTGEIPKVLDRYLEYVARTGKPLFSWDLISNLIIKKFENVFDDFGVDKSIQNVKTINN-DNATAHSLKQECLQAIATLTGVPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTV 490
            D +  ALKD+ +    E   VLD++L ++A+TG+ L SW       + K E V +DF      Q      N ++     +K+  L+ +    G+PFTIQR+CELL  PK+NYT  EKFLRG  + + VV+ +
Sbjct:    4 DTLLEALKDFDKKVKKEASTVLDQFLCHIAKTGETLVSWSQFKTYFVFKLEKVMEDFHASAPEQRGPANPNVESIPFEEMKERILKIVNEYNGIPFTIQRLCELLTEPKRNYTGTEKFLRGVEKNVMVVSCI 135          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Zebrafish
Match: ppp4r2b (protein phosphatase 4, regulatory subunit 2b [Source:NCBI gene;Acc:100005419])

HSP 1 Score: 93.2041 bits (230), Expect = 1.765e-19
Identity = 49/132 (37.12%), Postives = 73/132 (55.30%), Query Frame = 2
Query:  101 DAIKVALKDY-QNTTGEIPKVLDRYLEYVARTGKPLFSWDLISNLIIKKFENVFDDFGVDKSIQ-NVKTINNDNATAHSLKQECLQAIATLTGVPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTV 490
            D +  ALKD+ +    E   VLD++L ++A+TG+ L SW       + K E V +DF      Q      N ++     +K+  L+ +    G+PFTIQR+CELL  PK+NYT  EKFLRG  + + VV+ +
Sbjct:   33 DTLLEALKDFDKKVKKEASTVLDQFLCHIAKTGETLVSWSQFKTYFVFKLEKVMEDFHASAPEQRGPANPNVESIPFEEMKERILKIVNEYNGIPFTIQRLCELLTEPKRNYTGTEKFLRGVEKNVMVVSCI 164          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Zebrafish
Match: ppp4r2a (protein phosphatase 4, regulatory subunit 2a [Source:NCBI gene;Acc:326723])

HSP 1 Score: 87.8113 bits (216), Expect = 8.572e-18
Identity = 47/134 (35.07%), Postives = 71/134 (52.99%), Query Frame = 2
Query:  101 DAIKVALKDYQNTT-GEIPKVLDRYLEYVARTGKPLFSWDLISNLIIKKFENVFDDFGVDKSIQNVKTINNDNATA---HSLKQECLQAIATLTGVPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTV 490
            D +  A +D++     E   +LD++L +VA+TG+ +  W    +  + K E V DDF    S    +   N N        +KQ  L+ +    G+PFTIQR+CELL  PK+NY   +KFLRG  + + VV+ V
Sbjct:    4 DTLLGAFRDFEKKGEKESCPILDQFLSHVAKTGETMIQWSQFKSYFLFKLEKVMDDFKA--SCPEQRGPANPNVEYIPFEEMKQRILKIVNGYNGIPFTIQRLCELLTEPKRNYAGTDKFLRGVEKNVMVVSCV 135          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Xenopus
Match: ppp4r2 (protein phosphatase 4 regulatory subunit 2 [Source:NCBI gene;Acc:496569])

HSP 1 Score: 91.6633 bits (226), Expect = 5.840e-19
Identity = 51/137 (37.23%), Postives = 74/137 (54.01%), Query Frame = 2
Query:  101 DAIKVALKDYQ-NTTGEIPKVLDRYLEYVARTGKPLFSWDLISNLIIKKFENVFDDFGVDKSIQ------NVKTINNDNATAHSLKQECLQAIATLTGVPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTV 490
            D ++ ALKD++     E    LD++L +VA+TG+ +  W       + K E V DDF      Q      NV+ I  D      +KQ  L+ +    G PFTIQR+CELL +P++NYT  +KFLRG  + + VV+ V
Sbjct:    4 DRLQEALKDFEKRGKKEASSELDQFLCHVAKTGETVVQWPQFKEYFVFKLEKVMDDFRSSAPDQRGSPNPNVEYIPFDE-----MKQRILKIVTGFNGTPFTIQRLCELLTDPRRNYTGTDKFLRGVEKNVMVVSCV 135          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Xenopus
Match: ppp4r2 (protein phosphatase 4 regulatory subunit 2 [Source:NCBI gene;Acc:496569])

HSP 1 Score: 85.8853 bits (211), Expect = 4.472e-17
Identity = 45/116 (38.79%), Postives = 64/116 (55.17%), Query Frame = 2
Query:  161 LDRYLEYVARTGKPLFSWDLISNLIIKKFENVFDDFGVDKSIQ------NVKTINNDNATAHSLKQECLQAIATLTGVPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTV 490
            LD++L +VA+TG+ +  W       + K E V DDF      Q      NV+ I  D      +KQ  L+ +    G PFTIQR+CELL +P++NYT  +KFLRG  + + VV+ V
Sbjct:   35 LDQFLCHVAKTGETVVQWPQFKEYFVFKLEKVMDDFRSSAPDQRGSPNPNVEYIPFDE-----MKQRILKIVTGFNGTPFTIQRLCELLTDPRRNYTGTDKFLRGVEKNVMVVSCV 145          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Xenopus
Match: CLSPN (claspin [Source:NCBI gene;Acc:100124314])

HSP 1 Score: 62.3882 bits (150), Expect = 3.122e-9
Identity = 44/99 (44.44%), Postives = 60/99 (60.61%), Query Frame = 2
Query: 1664 DFIDDEAELSGSDDDDNEHYGPDEDGSDLDRYXXXXXXXXXKLPSEGRLRRQIEKIHNRLEIDKDARDIRYLKELYLEDGDLHIAGAGQRRRRYEWAAI 1960
            DF++DEAELSGSD       G   D  + D  E E+EA  E LPS+  L+ Q+ KIH ++ +D+D R +R  +E YL DGDLH  G G R R++ W  +
Sbjct:  949 DFMEDEAELSGSD------VG-SGDEYEGDDDEYEEEAIDEDLPSDEELQDQVNKIHMKVTMDEDQRQLRLYQERYLADGDLHSDGPG-RTRKFRWKNL 1039          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Mouse
Match: Ppp4r2 (protein phosphatase 4, regulatory subunit 2 [Source:MGI Symbol;Acc:MGI:3027896])

HSP 1 Score: 92.8189 bits (229), Expect = 2.103e-19
Identity = 49/134 (36.57%), Postives = 75/134 (55.97%), Query Frame = 2
Query:  101 DAIKVALKDYQ-NTTGEIPKVLDRYLEYVARTGKPLFSWDLISNLIIKKFENVFDDFGVDKSIQNVKTINNDNATA---HSLKQECLQAIATLTGVPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTV 490
            + ++ ALKD++     E+  VLD++L +VA+TG+ +  W       I K E V DDF    S    +   N N        +K+  L+ +    G+PFTIQR+CELL +P++NYT  +KFLRG  + + VV+ V
Sbjct:    4 ERLQEALKDFEKRGKKEVCPVLDQFLCHVAKTGETMIQWSQFKGYFIFKLEKVMDDFRT--SAPEPRGPPNPNVEYIPFDEMKERILKIVTGFNGIPFTIQRLCELLTDPRRNYTGTDKFLRGVEKNVMVVSCV 135          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Mouse
Match: Clspn (claspin [Source:MGI Symbol;Acc:MGI:2445153])

HSP 1 Score: 68.9366 bits (167), Expect = 2.534e-11
Identity = 46/112 (41.07%), Postives = 64/112 (57.14%), Query Frame = 2
Query: 1628 KQVVAVAR-MVPTDFIDDEAELSGSDDDDNEHYGPDEDGSDLDRYXXXXXXXXXKLPSEGRLRRQIEKIHNRLEIDKDARDIRYLKELYLEDGDLHIAGAGQRRRRYEWAAI 1960
            KQ   + R M    +++DEAE+SGSD    + Y    DG ++D YEE+   +   LPS+  L  QI+KIH +  +D D R +R  +E YL DGDLH  G G R R++ W  I
Sbjct: 1016 KQSEKMKRQMRLKKYLEDEAEVSGSDVGSEDEY----DGEEIDEYEEDVIDEV--LPSDEELESQIKKIHMKTMLDDDKRRLRLYQERYLADGDLHSDGPG-RTRKFRWKHI 1120          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Mouse
Match: Ppp4r2 (protein phosphatase 4, regulatory subunit 2 [Source:MGI Symbol;Acc:MGI:3027896])

HSP 1 Score: 65.4698 bits (158), Expect = 5.827e-11
Identity = 25/53 (47.17%), Postives = 38/53 (71.70%), Query Frame = 2
Query:  332 LKQECLQAIATLTGVPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTV 490
            +K+  L+ +    G+PFTIQR+CELL +P++NYT  +KFLRG  + + VV+ V
Sbjct:   14 MKERILKIVTGFNGIPFTIQRLCELLTDPRRNYTGTDKFLRGVEKNVMVVSCV 66          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Mouse
Match: Ppp4r2 (protein phosphatase 4, regulatory subunit 2 [Source:MGI Symbol;Acc:MGI:3027896])

HSP 1 Score: 63.5438 bits (153), Expect = 1.026e-10
Identity = 25/53 (47.17%), Postives = 38/53 (71.70%), Query Frame = 2
Query:  332 LKQECLQAIATLTGVPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTV 490
            +K+  L+ +    G+PFTIQR+CELL +P++NYT  +KFLRG  + + VV+ V
Sbjct:   28 MKERILKIVTGFNGIPFTIQRLCELLTDPRRNYTGTDKFLRGVEKNVMVVSCV 80          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. UniProt/SwissProt
Match: sp|Q9W2U4|PP4R2_DROME (Serine/threonine-protein phosphatase 4 regulatory subunit 2 OS=Drosophila melanogaster OX=7227 GN=PPP4R2r PE=1 SV=2)

HSP 1 Score: 97.4413 bits (241), Expect = 1.588e-19
Identity = 53/150 (35.33%), Postives = 85/150 (56.67%), Query Frame = 2
Query:   80 LSIMENHDAIKVALKDYQN-TTGEIPKVLDRYLEYVARTGKPLFSWDLISNLIIKKFENVFDDFGVD----KSIQNVKTINNDNATAHSLKQECLQAIATLTGVPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTVDRIGQKIT 514
            +  MEN D I   L+ + +    EIPK L+ YL+YVA+TG  +F W  +  L  +K  +V   F  D    + I N   ++  N    ++K   L+ +      PFT+QR+CELL++P+K Y++++KF+R   + I VV+T+D  G+K T
Sbjct:    1 MVTMENSDEIMQILERFTDLKQKEIPKELEEYLQYVAKTGDTIFKWSSLKYLFREKLLSVIKHFNEDSPRLEEIPNYPNVDPFNY--ETMKSSLLERLDLFNAAPFTVQRLCELLIDPRKQYSRIDKFMRALEKNILVVSTID-PGRKRT 147          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. UniProt/SwissProt
Match: sp|Q6DCQ0|P4R2B_XENLA (Serine/threonine-protein phosphatase 4 regulatory subunit 2-B OS=Xenopus laevis OX=8355 GN=ppp4r2-b PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 2.093e-19
Identity = 55/148 (37.16%), Postives = 82/148 (55.41%), Query Frame = 2
Query:  101 DAIKVALKDYQ-NTTGEIPKVLDRYLEYVARTGKPLFSWDLISNLIIKKFENVFDDFGVDKSIQ------NVKTINNDNATAHSLKQECLQAIATLTGVPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTVDRIGQKITTES 523
            D ++ ALKD++     ++   LD++L +VA+TG+ +  W       + K E V DDF      Q      NV+ I  D      +KQ  L+ +A+  G PFTIQR+CELL +P++NYT  +KFLRG  + I VV+ V    +K T+ S
Sbjct:    4 DRLQEALKDFEKRGKKDVSPELDQFLCHVAKTGETVVQWPQFKEYFLFKLEKVMDDFRTSAPEQRGPPNPNVEYIPFD-----EMKQRILKIVASFNGTPFTIQRLCELLTDPRRNYTGTDKFLRGVEKNIMVVSCVYPSSEKNTSPS 146          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. UniProt/SwissProt
Match: sp|A1L1M4|P4R2B_DANRE (Serine/threonine-protein phosphatase 4 regulatory subunit 2-B OS=Danio rerio OX=7955 GN=ppp4r2b PE=1 SV=2)

HSP 1 Score: 93.5893 bits (231), Expect = 8.634e-19
Identity = 49/132 (37.12%), Postives = 73/132 (55.30%), Query Frame = 2
Query:  101 DAIKVALKDY-QNTTGEIPKVLDRYLEYVARTGKPLFSWDLISNLIIKKFENVFDDFGVDKSIQNVKTINN-DNATAHSLKQECLQAIATLTGVPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTV 490
            D +  ALKD+ +    E   VLD++L ++A+TG+ L SW       + K E V +DF      Q      N ++     +K+  L+ +    G+PFTIQR+CELL  PK+NYT  EKFLRG  + + VV+ +
Sbjct:    4 DTLLEALKDFDKKVKKEASTVLDQFLCHIAKTGETLVSWSQFKTYFVFKLEKVMEDFHASAPEQRGPANPNVESIPFEEMKERILKIVNEYNGIPFTIQRLCELLTEPKRNYTGTEKFLRGVEKNVMVVSCI 135          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. UniProt/SwissProt
Match: sp|Q5ZMU6|PP4R2_CHICK (Serine/threonine-protein phosphatase 4 regulatory subunit 2 OS=Gallus gallus OX=9031 GN=PPP4R2 PE=2 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.152e-18
Identity = 48/134 (35.82%), Postives = 75/134 (55.97%), Query Frame = 2
Query:  101 DAIKVALKDYQ-NTTGEIPKVLDRYLEYVARTGKPLFSWDLISNLIIKKFENVFDDFGVDKSIQNVKTINNDNATA---HSLKQECLQAIATLTGVPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTV 490
            + ++ ALKD++     E+  +LD++L +VA+TG+ +  W       I K E V DDF    S    +   N N        +K+  L+ +    G+PFTIQR+CELL +P++NYT  +KFLRG  + + VV+ V
Sbjct:    4 ERLQEALKDFEKRGKKEVCPILDQFLCHVAKTGETMVQWSQFKGYFIFKLEKVMDDFRT--SAPEPRGPPNPNVEYIPFEEMKERILKIVTGFNGIPFTIQRLCELLTDPRRNYTGTDKFLRGVEKNVMVVSCV 135          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. UniProt/SwissProt
Match: sp|Q0VGB7|PP4R2_MOUSE (Serine/threonine-protein phosphatase 4 regulatory subunit 2 OS=Mus musculus OX=10090 GN=Ppp4r2 PE=1 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.525e-18
Identity = 49/134 (36.57%), Postives = 75/134 (55.97%), Query Frame = 2
Query:  101 DAIKVALKDYQ-NTTGEIPKVLDRYLEYVARTGKPLFSWDLISNLIIKKFENVFDDFGVDKSIQNVKTINNDNATA---HSLKQECLQAIATLTGVPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTV 490
            + ++ ALKD++     E+  VLD++L +VA+TG+ +  W       I K E V DDF    S    +   N N        +K+  L+ +    G+PFTIQR+CELL +P++NYT  +KFLRG  + + VV+ V
Sbjct:    4 ERLQEALKDFEKRGKKEVCPVLDQFLCHVAKTGETMIQWSQFKGYFIFKLEKVMDDFRT--SAPEPRGPPNPNVEYIPFDEMKERILKIVTGFNGIPFTIQRLCELLTDPRRNYTGTDKFLRGVEKNVMVVSCV 135          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. TrEMBL
Match: K1RLX8 (Serine/threonine-protein phosphatase 4 regulatory subunit 2-A OS=Crassostrea gigas OX=29159 GN=CGI_10020996 PE=4 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 2.217e-26
Identity = 64/164 (39.02%), Postives = 98/164 (59.76%), Query Frame = 2
Query:   89 MENHDAIKVALKDYQNTTGEIPKVLDRYLEYVARTGKPLFSWDLISNLIIKKFENVFDDFGVDKSIQNVKTINN-DNATAHSLKQECLQAIATLTGVPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTVDRIGQKITTES-QLFANAM--SPFEVNES 568
            M+N + I  AL D++   GEIP VL++YL+ +A+TG+ LF W  +  L + K ENV   F  +    ++    N +N     +++  L ++   +  PFTIQR+CELL +PKK+Y + +KFLRG  + + VV+TVD  G KI +ES ++  N M  SP   NE+
Sbjct:    1 MDNQEEILDALNDFEKKKGEIPPVLEQYLKTIAKTGETLFPWPRVKPLFVGKLENVMSKFNRELPADHLAPCPNVENPKFKEMRKRILDSLNKFSDAPFTIQRLCELLTDPKKHYRRTDKFLRGVEKNMLVVSTVDPFGNKIVSESREVMVNGMEGSPVNGNEA 164          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. TrEMBL
Match: A0A0X3PRL5 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR85784 PE=4 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 1.705e-24
Identity = 63/160 (39.38%), Postives = 90/160 (56.25%), Query Frame = 2
Query:   74 MTLSIMENHDAIKVALKDYQNTTGEIPKVLDRYLEYVARTGKPLFSWDLISNLIIKKFENVFDDFGVDKSIQN-VKTINNDNATAHSLKQECLQAIATLTGVPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTVDRIGQKITTESQLFANAMSP 550
            MTL  MEN + I +ALK  +     IP +L+ YL  VAR G+ L  W  +  LI+ KF  V  +F  + S ++  +      A+   L+Q     + +  G PFTIQRICEL++ P+K+YT+ +KFLRGF R   VV+TVD  G KI      F++ + P
Sbjct:    1 MTLLDMENKEGILLALKSLEKDGSSIPAILEEYLREVARHGQTLIPWVHVKPLILHKFNQVVTEFIEEFSQEDYFRGRVLSQASLSELRQRVFDTLKSFQGTPFTIQRICELIIQPRKHYTRPDKFLRGFERTCSVVSTVDCYGNKIHNLDPRFSDHLRP 160          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. TrEMBL
Match: A0A210PFT7 (Serine/threonine-protein phosphatase 4 regulatory subunit 2-B OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT12051 PE=4 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 6.047e-23
Identity = 59/154 (38.31%), Postives = 91/154 (59.09%), Query Frame = 2
Query:   89 MENHDAIKVALKDYQNT-TGEIPKVLDRYLEYVARTGKPLFSWDLISNLIIKKFENVFDDFGVDKSIQNVKTINN-DNATAHSLKQECLQAIATLTGVPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTVDRIGQKITTESQLFANAM 544
            MEN + +  AL  Y+   T +IP VLD+YL  VA+TG+ LF W  +  L I K ++V   F  D    +++   N +N     +K+  + ++    G PFTIQR+CEL+  PKK+Y + +KFLRG  + + VV+TVD  G+KI ++S+   N +
Sbjct:    9 MENQEDVLDALCCYEKKPTPDIPPVLDQYLRRVAKTGETLFPWQQLKILFIHKLDSVITQFNQDFPADHLQNCPNVENVKFEEMKKRVVCSLEEFQGAPFTIQRLCELVTEPKKHYKRTDKFLRGIEKNVLVVSTVDPFGRKIVSDSRPMMNGL 162          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. TrEMBL
Match: A0A0V1A706 (Serine/threonine-protein phosphatase 4 regulatory subunit 2 OS=Trichinella patagoniensis OX=990121 GN=PPP4R2r PE=4 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 9.345e-23
Identity = 55/164 (33.54%), Postives = 91/164 (55.49%), Query Frame = 2
Query:  146 EIPKVLDRYLEYVARTGKPLFSWDLISNLIIKKFENVFDDFGVDKSIQNVKTINNDNATAHSLKQECLQAIATLTGVPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTVDRIGQKITTESQLFANAMSPFEVNESGDNWSGFSSQSDDSLVHIQMQSP 637
            E  + L  YL++V+RTG+PLF+W +I    I + E       + ++I+N++  +N     ++ ++  +Q +    GVPFTIQRICELLLNP +NY +++KFLR   + + VVTTVD  G++      +  N  S      +GD   G  +++ D    ++   P
Sbjct:   33 ECKRTLMEYLDFVSRTGRPLFAWSIIQPFFIHECER-----SISEAIRNLQVPSNGREQLNAYRRRIIQRMQDFDGVPFTIQRICELLLNPARNYKRVDKFLRALEKCVYVVTTVDANGEREIDRDHIVLNGSS-----NTGDAERGEETENGDLAAQVEGHRP 186          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. TrEMBL
Match: A0A2C9LGZ1 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106056515 PE=4 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 1.203e-22
Identity = 63/163 (38.65%), Postives = 95/163 (58.28%), Query Frame = 2
Query:   89 MENHDAIKVALKDY-QNTTGEIPKVLDRYLEYVARTGKPLFSWDLISNLIIKKFENVFDDFGVDKSIQNVKTINN-DNATAHSLKQECLQAIATLTGVPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTVDRIGQKITTES--QLFANAM----SPF 553
            M+N +    AL  + +N T EIP +L++YL  VA+ G+ LF W L+  LI+ K E V  +     S +N+ T  N +N     + +  + +I    G PFTIQR+CELL++PK++Y + +KFLRG  R + VV+TVD  G+K+  +S  +   N M    SPF
Sbjct:    1 MDNKEDYLDALTAFSKNPTPEIPHILEQYLNGVAKNGETLFHWPLLKPLIVSKMEQVIAELRKGLSAENIPTRPNVENVQFDVMHKRIMDSIHKFNGAPFTIQRLCELLIDPKQHYKRSDKFLRGLERNVLVVSTVDPYGRKVVADSGNKHLVNGMDLNGSPF 163          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Cavefish
Match: ppp4r2b (serine/threonine-protein phosphatase 4 regulatory subunit 2-B-like [Source:NCBI gene;Acc:103031541])

HSP 1 Score: 92.8189 bits (229), Expect = 1.566e-19
Identity = 47/132 (35.61%), Postives = 76/132 (57.58%), Query Frame = 2
Query:  101 DAIKVALKDYQNTTG-EIPKVLDRYLEYVARTGKPLFSWDLISNLIIKKFENVFDDFGVDKSIQNVKTINN-DNATAHSLKQECLQAIATLTGVPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTV 490
            D +  AL+D++     ++  VLD++L +VA+TG+ + SW    +  + K E V +DF      Q      N ++     +K+  L+ +    G+PFTIQR+CELL +PK+NY+  EKFLRG  + + VV+ V
Sbjct:    4 DGLLEALEDFEKKGKKDVSPVLDQFLCHVAKTGETMVSWSQFKSYFLFKLEKVMEDFRASAPEQRGPANPNVESVPFEEMKERILKIVNGYNGIPFTIQRLCELLTDPKRNYSGTEKFLRGVEKNVMVVSCV 135          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Cavefish
Match: ppp4r2a (serine/threonine-protein phosphatase 4 regulatory subunit 2-A [Source:NCBI gene;Acc:103045173])

HSP 1 Score: 89.3521 bits (220), Expect = 3.321e-18
Identity = 46/132 (34.85%), Postives = 71/132 (53.79%), Query Frame = 2
Query:  101 DAIKVALKDYQNTTG-EIPKVLDRYLEYVARTGKPLFSWDLISNLIIKKFENVFDDFGVDKSIQNVKTINN-DNATAHSLKQECLQAIATLTGVPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTV 490
            D +  A +D++     E   VLD++L ++A+TG+ +  W    +  + K E V DDF      Q      N +      +K+  L+ +    G+PFTIQR+CELL  PK+NYT  +KFLRG  + + VV+ V
Sbjct:    4 DTLLSAFRDFEKKGKQETCPVLDQFLCHIAKTGETMIQWSQFKSYFLFKLEKVMDDFKASSPEQRGPANPNVEYIPFEEMKERILKIVDGYNGIPFTIQRLCELLTEPKRNYTGTDKFLRGVEKNVMVVSCV 135          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Cavefish
Match: CLSPN (claspin [Source:NCBI gene;Acc:103043308])

HSP 1 Score: 58.5362 bits (140), Expect = 3.441e-8
Identity = 43/104 (41.35%), Postives = 56/104 (53.85%), Query Frame = 2
Query: 1649 RMVPTDFIDDEAELSGSDDDDNEHYGPDEDGSDLDRYXXXXXXXXXKLPSEGRLRRQIEKIHNRLEIDKDARDIRYLKELYLEDGDLHIAGAGQRRRRYEWAAI 1960
            +M   +F+D EAELSGSD    +         D    E E+E   E+LPS+  L  Q+ KIH +  +D D R +R  +E YL DGDLH  G G R RR+ W  I
Sbjct:  994 KMRMAEFVDSEAELSGSDLGSEDE-------DDEGGDEYEEEELQEELPSDEELMDQVNKIHMKQIMDDDKRKLRLYQERYLADGDLHSEGPG-RERRFRWKNI 1089          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Sea Lamprey
Match: ppp4r2b (protein phosphatase 4, regulatory subunit 2b [Source:NCBI gene;Acc:100005419])

HSP 1 Score: 85.8853 bits (211), Expect = 3.061e-18
Identity = 42/118 (35.59%), Postives = 67/118 (56.78%), Query Frame = 2
Query:  146 EIPKVLDRYLEYVARTGKPLFSWDLISNLIIKKFENVFDDFGVDKSIQNVKTINNDNA---TAHSLKQECLQAIATLTGVPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTV 490
            E+   LD ++ +VA+TG+ +  W  +    + K E V DDF    S+  V+   N N        +K+  L+ +   T  PFTIQR+CELL+ PKK+Y + +KF+RG  + + VV++V
Sbjct:   20 EVTPELDGFMRHVAKTGETMLPWPQLKGYFMYKLERVLDDFRA--SVPEVRGPPNWNVEYVPYDDMKERLLKIVDGFTSAPFTIQRLCELLMEPKKHYKRTDKFMRGIEKNVLVVSSV 135          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Sea Lamprey
Match: CLSPN (claspin [Source:HGNC Symbol;Acc:HGNC:19715])

HSP 1 Score: 60.077 bits (144), Expect = 2.029e-9
Identity = 40/101 (39.60%), Postives = 63/101 (62.38%), Query Frame = 2
Query: 1661 TDFIDDEAELSGSDDDDNEHYGPDEDGS-DLDRYXXXXXXXXXKLPSEGRLRRQIEKIHNRLEIDKDARDIRYLKELYLEDGDLHIAGAGQRRRRYEWAAI 1960
            + F+++EAELSGS+       G DED S + +  E E+E   E+LPS+  L+ Q++++H +  +D+D R +R  +E+ L DGDLH  G G RRR + W  +
Sbjct:  816 SHFVEEEAELSGSE------AGSDEDFSGNEEDNEYEEEDIQEELPSDDELQDQVKRLHMKALLDEDKRQLRLYQEVLLPDGDLHSDGPG-RRRTFRWKNL 909          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Sea Lamprey
Match: CLSPN (claspin [Source:HGNC Symbol;Acc:HGNC:19715])

HSP 1 Score: 60.077 bits (144), Expect = 2.265e-9
Identity = 39/98 (39.80%), Postives = 61/98 (62.24%), Query Frame = 2
Query: 1661 TDFIDDEAELSGSDDDDNEHYGPDEDGSDLDRYXXXXXXXXXK-LPSEGRLRRQIEKIHNRLEIDKDARDIRYLKELYLEDGDLHIAGAGQRRRRYEW 1951
            + F+++EAELSGS+       G DED S  +   E +E D ++ LPS+  L+ Q++++H +  +D+D R +R  +E+ L DGDLH  G G RRR + W
Sbjct:  781 SHFVEEEAELSGSE------AGSDEDFSGNEEDNEYEEEDIQEELPSDDELQDQVKRLHMKALLDEDKRQLRLYQEVLLPDGDLHSDGPG-RRRTFRW 871          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Nematostella
Match: EDO48233 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKE9])

HSP 1 Score: 69.3218 bits (168), Expect = 9.115e-13
Identity = 35/111 (31.53%), Postives = 64/111 (57.66%), Query Frame = 2
Query:  161 LDRYLEYVARTGKPLFSWDLISNLIIKKFENVFDDFGVDKSIQNVKTINNDN-ATAHSLKQECLQAIATLTGVPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTV 490
            L++ L  +A+TG+ L+ W+ +  + + K + V  DF      +N  +    + A    ++Q  L  + + T  PFTIQR+CEL++ PK++Y   EKF+RG  + + VV+++
Sbjct:   12 LEQLLTNIAQTGRILYPWNNLKPVFMYKMDRVMRDFFESSPSRNSTSSEPTHVADFEVMRQRLLDCLDSFTSPPFTIQRLCELMVEPKRHYKNSEKFMRGIEKNVLVVSSL 122          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Medaka
Match: ppp4r2b (protein phosphatase 4 regulatory subunit 2 [Source:NCBI gene;Acc:101161798])

HSP 1 Score: 93.5893 bits (231), Expect = 1.007e-19
Identity = 49/138 (35.51%), Postives = 76/138 (55.07%), Query Frame = 2
Query:  101 DAIKVALKDYQNTTGEIPK-VLDRYLEYVARTGKPLFSWDLISNLIIKKFENVFDDFGVDKSIQ-NVKTINNDNATAHSLKQECLQAIATLTGVPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTVDRIGQK 508
            D+I+ AL D+   + + P  VL+ +L +VA+TG+ +  W    +  + K E V DDF      Q      N ++     +K+  L+ +    G+PFTIQR+CELL  PK+NYT  +KFLRG  + + VV+ V    +K
Sbjct:    4 DSIQEALIDFDKKSKKEPSPVLEEFLCHVAKTGQTMVQWSQFKSYFLFKLETVMDDFRASAPEQRGAANPNVESVPFEDMKERILKIVDGYNGIPFTIQRLCELLTEPKRNYTGTDKFLRGVEKNVMVVSCVHPTSEK 141          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Medaka
Match: ENSORLT00000033486.1 (serine/threonine-protein phosphatase 4 regulatory subunit 2-A [Source:NCBI gene;Acc:101162291])

HSP 1 Score: 92.8189 bits (229), Expect = 1.140e-19
Identity = 48/132 (36.36%), Postives = 76/132 (57.58%), Query Frame = 2
Query:  101 DAIKVALKDYQNTTGE-IPKVLDRYLEYVARTGKPLFSWDLISNLIIKKFENVFDDFGVDKSIQN-VKTINNDNATAHSLKQECLQAIATLTGVPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTV 490
            DA+  A +D++    E +  +L+++L +VA+TG+PL  W       + K E V  DF      Q  ++  N D      +K+  L+ +   +GVPFTIQR+CELL +PK+NYT  +KFLRG  + + VV+ +
Sbjct:    4 DALVEAFQDFEKKGKEEVCPLLEQFLCHVAKTGQPLIPWSQFKMYFMFKLEKVISDFHDSSPEQRTLRNPNVDYVPFEEMKRRILKIVDGYSGVPFTIQRLCELLTDPKRNYTSTDKFLRGLEKNVMVVSCL 135          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Medaka
Match: CLSPN (claspin [Source:NCBI gene;Acc:101169623])

HSP 1 Score: 60.077 bits (144), Expect = 1.103e-8
Identity = 44/105 (41.90%), Postives = 58/105 (55.24%), Query Frame = 2
Query: 1652 MVPTDFIDDEAELSGSDDDDNEHYGPDEDGSDLDRYXXXXXXXXXKLPSEGRLRRQIEKIHNRLEIDKDARDIRYLKELYLEDGDLHIAGAGQRRRRYEWAAISE 1966
            M   D+++ EAELSGSD          ED  D    E E+E   E+LPS+  L+ Q+ KIH +  +D D R +R  +E YL DGDLH  G G R RR+ W  + E
Sbjct:  988 MTLMDYVESEAELSGSDVGS-------EDEDDERGSEYEEEESLEELPSDEELQDQVNKIHMKQVLDDDKRRLRLYQERYLADGDLHSDGPG-RARRFRWKNMDE 1084          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Planmine SMEST
Match: SMESG000011697.1 (SMESG000011697.1)

HSP 1 Score: 858.596 bits (2217), Expect = 0.000e+0
Identity = 455/461 (98.70%), Postives = 457/461 (99.13%), Query Frame = 2
Query:   74 MTLSIMENHDAIKVALKDYQNTTGEIPKVLDRYLEYVARTGKPLFSWDLISNLIIKKFENVFDDFGVDKSIQNVKTINNDNATAHSLKQECLQAIATLTGVPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTVDRIGQKITTESQLFANAMSPFEVNESGDNWSGFSSQSDDSLVHIQMQSPDNNLLDDPKQSIDFIDEKTPQPVTVCLSSGPSDSYATKMIDQGQQTSDSIYPNNEQQYFMEQKTIISMPPIGALFKPIDQLEAFXXXXXXXXX--XXXXXTPPKIEDTKKRTADESVDCLTAESPCSSLDEHLGNDFVSQVKKRKLDIVSQEAVISSTEVMSEEIPTKDEAQISEIETGLPAVSSQANLCAEEPSSSTNEIKPSSNSIVNGAIIGPIKPNDDDELLCCYSAVDDGNCSTNRAVEAXXXXXXXXXXXXXXXXXPMPIDENNCAN 1450
            MTLSIMENHDAIKVALKDYQNTTGEIPKVLDRYLEYVARTGKPLFSWDLISNLIIKKFENVFDDFGVDKSIQNVKTINNDNATAHSLKQECLQAIATLTGVPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTVDRIGQKITTESQLFANAMSPFEVNESGDNWSGFSSQSDDSLVHIQMQSPDNNLLDDPKQSIDFIDEKTPQPVTVCLSSGPSDSYATKMIDQGQQTSDSIYPNNEQQYFMEQKTIISMPPIGALFKPIDQLEAFVQNVSNQVE  SSSSSTPPKIEDTKKRTADESVDCLTAESPCSSLDEHLGNDFVSQVKKRKLDIVSQEAVISSTEVMSEEIPTKDEAQISEIETGLP VSSQANLCAEEPSSSTNEIKP+SNSIVN AIIGPIKPNDDDELLCCYSAVDDGNCSTN+AVEADQSNNCDDDDNDSNSIDPMPIDENNCAN
Sbjct:    1 MTLSIMENHDAIKVALKDYQNTTGEIPKVLDRYLEYVARTGKPLFSWDLISNLIIKKFENVFDDFGVDKSIQNVKTINNDNATAHSLKQECLQAIATLTGVPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTVDRIGQKITTESQLFANAMSPFEVNESGDNWSGFSSQSDDSLVHIQMQSPDNNLLDDPKQSIDFIDEKTPQPVTVCLSSGPSDSYATKMIDQGQQTSDSIYPNNEQQYFMEQKTIISMPPIGALFKPIDQLEAFVQNVSNQVESSSSSSSTPPKIEDTKKRTADESVDCLTAESPCSSLDEHLGNDFVSQVKKRKLDIVSQEAVISSTEVMSEEIPTKDEAQISEIETGLPTVSSQANLCAEEPSSSTNEIKPNSNSIVNSAIIGPIKPNDDDELLCCYSAVDDGNCSTNQAVEADQSNNCDDDDNDSNSIDPMPIDENNCAN 461          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Planmine SMEST
Match: SMESG000011697.1 (SMESG000011697.1)

HSP 1 Score: 848.581 bits (2191), Expect = 0.000e+0
Identity = 450/456 (98.68%), Postives = 452/456 (99.12%), Query Frame = 2
Query:   89 MENHDAIKVALKDYQNTTGEIPKVLDRYLEYVARTGKPLFSWDLISNLIIKKFENVFDDFGVDKSIQNVKTINNDNATAHSLKQECLQAIATLTGVPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTVDRIGQKITTESQLFANAMSPFEVNESGDNWSGFSSQSDDSLVHIQMQSPDNNLLDDPKQSIDFIDEKTPQPVTVCLSSGPSDSYATKMIDQGQQTSDSIYPNNEQQYFMEQKTIISMPPIGALFKPIDQLEAFXXXXXXXXX--XXXXXTPPKIEDTKKRTADESVDCLTAESPCSSLDEHLGNDFVSQVKKRKLDIVSQEAVISSTEVMSEEIPTKDEAQISEIETGLPAVSSQANLCAEEPSSSTNEIKPSSNSIVNGAIIGPIKPNDDDELLCCYSAVDDGNCSTNRAVEAXXXXXXXXXXXXXXXXXPMPIDENNCAN 1450
            MENHDAIKVALKDYQNTTGEIPKVLDRYLEYVARTGKPLFSWDLISNLIIKKFENVFDDFGVDKSIQNVKTINNDNATAHSLKQECLQAIATLTGVPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTVDRIGQKITTESQLFANAMSPFEVNESGDNWSGFSSQSDDSLVHIQMQSPDNNLLDDPKQSIDFIDEKTPQPVTVCLSSGPSDSYATKMIDQGQQTSDSIYPNNEQQYFMEQKTIISMPPIGALFKPIDQLEAFVQNVSNQVE  SSSSSTPPKIEDTKKRTADESVDCLTAESPCSSLDEHLGNDFVSQVKKRKLDIVSQEAVISSTEVMSEEIPTKDEAQISEIETGLP VSSQANLCAEEPSSSTNEIKP+SNSIVN AIIGPIKPNDDDELLCCYSAVDDGNCSTN+AVEADQSNNCDDDDNDSNSIDPMPIDENNCAN
Sbjct:    1 MENHDAIKVALKDYQNTTGEIPKVLDRYLEYVARTGKPLFSWDLISNLIIKKFENVFDDFGVDKSIQNVKTINNDNATAHSLKQECLQAIATLTGVPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTVDRIGQKITTESQLFANAMSPFEVNESGDNWSGFSSQSDDSLVHIQMQSPDNNLLDDPKQSIDFIDEKTPQPVTVCLSSGPSDSYATKMIDQGQQTSDSIYPNNEQQYFMEQKTIISMPPIGALFKPIDQLEAFVQNVSNQVESSSSSSSTPPKIEDTKKRTADESVDCLTAESPCSSLDEHLGNDFVSQVKKRKLDIVSQEAVISSTEVMSEEIPTKDEAQISEIETGLPTVSSQANLCAEEPSSSTNEIKPNSNSIVNSAIIGPIKPNDDDELLCCYSAVDDGNCSTNQAVEADQSNNCDDDDNDSNSIDPMPIDENNCAN 456          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Planmine SMEST
Match: SMESG000049039.1 (SMESG000049039.1)

HSP 1 Score: 373.244 bits (957), Expect = 7.001e-164
Identity = 177/180 (98.33%), Postives = 179/180 (99.44%), Query Frame = 3
Query: 2019 LDAGDDGFGRYQIDADGDEQDDNSDEANNDQVDLDQSNADITAATGNDDEQEEGNEPLMERYGRHLHARKYVPRVQEQQ-HNAWQPLTARATLGSNGGTHKGGPTDSGDFMRPVQQKHGSLMNKISQLPPVNPNHQSTMSLKSRMQQHTFTVQSKQSATKRQPSNANEELGNDASKKQKF 2555
            ++AGDDGFGRYQIDADGDEQDDNSDEANNDQVDLDQSNADITAATGNDDEQEEGNEPLMERYGRHLHARKYVPRVQEQQ HNAWQPLTARATLGSNGGTHKGGPTDSGDFMRPVQQKHGSLMNKISQLPPVNPNHQSTMSLKSRMQQHTFTVQSKQSATKRQPSNANEELGNDASKKQKF
Sbjct:  839 INAGDDGFGRYQIDADGDEQDDNSDEANNDQVDLDQSNADITAATGNDDEQEEGNEPLMERYGRHLHARKYVPRVQEQQQHNAWQPLTARATLGSNGGTHKGGPTDSGDFMRPVQQKHGSLMNKISQLPPVNPNHQSTMSLKSRMQQHTFTVQSKQSATKRQPSNANEELGNDASKKQKF 1018          

HSP 2 Score: 225.328 bits (573), Expect = 7.001e-164
Identity = 133/136 (97.79%), Postives = 135/136 (99.26%), Query Frame = 2
Query: 1556 ISIDTETXXXXXXXXXXXXXXXXRKQVVAVARMVPTDFIDDEAELSGSDDDDNEHYGPDEDGSDLDRYXXXXXXXXXKLPSEGRLRRQIEKIHNRLEIDKDARDIRYLKELYLEDGDLHIAGAGQRRRRYEWAAIS 1963
            ISIDTETLDSDDNRYDDDEEE LRKQVVAVARMVPTDFIDDEAELSGSDDDDNEHYGPDEDGSDLDRYEEEDEAD+EKLPSEGRLRRQIEKIHNRLEIDKDARDIRYLKELYLEDGDLHIAGAGQRRRRYEWAAI+
Sbjct:  705 ISIDTETLDSDDNRYDDDEEEQLRKQVVAVARMVPTDFIDDEAELSGSDDDDNEHYGPDEDGSDLDRYEEEDEADSEKLPSEGRLRRQIEKIHNRLEIDKDARDIRYLKELYLEDGDLHIAGAGQRRRRYEWAAIN 840          
The following BLAST results are available for this feature:
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPP4R22.445e-1936.57protein phosphatase 4 regulatory subunit 2 [Source... [more]
PPP4R25.775e-1936.57protein phosphatase 4 regulatory subunit 2 [Source... [more]
CLSPN1.493e-1142.86claspin [Source:HGNC Symbol;Acc:HGNC:19715][more]
CLSPN1.541e-1142.86claspin [Source:HGNC Symbol;Acc:HGNC:19715][more]
CLSPN1.702e-1141.35claspin [Source:HGNC Symbol;Acc:HGNC:19715][more]
back to top
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ppfr-22.127e-843.64Protein Phosphatase Four Regulatory subunit [Sour... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
PPP4R2r1.584e-2035.33gene:FBgn0030208 transcript:FBtr0071451[more]
PPP4R2r1.584e-2035.33gene:FBgn0030208 transcript:FBtr0071452[more]
PPP4R2r1.584e-2035.33gene:FBgn0030208 transcript:FBtr0071453[more]
PPP4R2r4.479e-1040.98gene:FBgn0030208 transcript:FBtr0336899[more]
back to top
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ppp4r2b1.144e-1937.12protein phosphatase 4, regulatory subunit 2b [Sour... [more]
ppp4r2b1.765e-1937.12protein phosphatase 4, regulatory subunit 2b [Sour... [more]
ppp4r2a8.572e-1835.07protein phosphatase 4, regulatory subunit 2a [Sour... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ppp4r25.840e-1937.23protein phosphatase 4 regulatory subunit 2 [Source... [more]
ppp4r24.472e-1738.79protein phosphatase 4 regulatory subunit 2 [Source... [more]
CLSPN3.122e-944.44claspin [Source:NCBI gene;Acc:100124314][more]
back to top
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Ppp4r22.103e-1936.57protein phosphatase 4, regulatory subunit 2 [Sourc... [more]
Clspn2.534e-1141.07claspin [Source:MGI Symbol;Acc:MGI:2445153][more]
Ppp4r25.827e-1147.17protein phosphatase 4, regulatory subunit 2 [Sourc... [more]
Ppp4r21.026e-1047.17protein phosphatase 4, regulatory subunit 2 [Sourc... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9W2U4|PP4R2_DROME1.588e-1935.33Serine/threonine-protein phosphatase 4 regulatory ... [more]
sp|Q6DCQ0|P4R2B_XENLA2.093e-1937.16Serine/threonine-protein phosphatase 4 regulatory ... [more]
sp|A1L1M4|P4R2B_DANRE8.634e-1937.12Serine/threonine-protein phosphatase 4 regulatory ... [more]
sp|Q5ZMU6|PP4R2_CHICK1.152e-1835.82Serine/threonine-protein phosphatase 4 regulatory ... [more]
sp|Q0VGB7|PP4R2_MOUSE1.525e-1836.57Serine/threonine-protein phosphatase 4 regulatory ... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1RLX82.217e-2639.02Serine/threonine-protein phosphatase 4 regulatory ... [more]
A0A0X3PRL51.705e-2439.38Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A210PFT76.047e-2338.31Serine/threonine-protein phosphatase 4 regulatory ... [more]
A0A0V1A7069.345e-2333.54Serine/threonine-protein phosphatase 4 regulatory ... [more]
A0A2C9LGZ11.203e-2238.65Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ppp4r2b1.566e-1935.61serine/threonine-protein phosphatase 4 regulatory ... [more]
ppp4r2a3.321e-1834.85serine/threonine-protein phosphatase 4 regulatory ... [more]
CLSPN3.441e-841.35claspin [Source:NCBI gene;Acc:103043308][more]
back to top
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ppp4r2b3.061e-1835.59protein phosphatase 4, regulatory subunit 2b [Sour... [more]
CLSPN2.029e-939.60claspin [Source:HGNC Symbol;Acc:HGNC:19715][more]
CLSPN2.265e-939.80claspin [Source:HGNC Symbol;Acc:HGNC:19715][more]
back to top
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO482339.115e-1331.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ppp4r2b1.007e-1935.51protein phosphatase 4 regulatory subunit 2 [Source... [more]
ENSORLT00000033486.11.140e-1936.36serine/threonine-protein phosphatase 4 regulatory ... [more]
CLSPN1.103e-841.90claspin [Source:NCBI gene;Acc:101169623][more]
back to top
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000011697.10.000e+098.70SMESG000011697.1[more]
SMESG000011697.10.000e+098.68SMESG000011697.1[more]
SMESG000049039.17.001e-16498.33SMESG000049039.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002777 ID=SMED30002777|Name=Serine/threonine-protein phosphatase 4 regulatory subunit 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2599bp
TTCCGATCTATATAGAGTTTTAAATTTTAAGTTATTAATTAATCTTCTTA
TTATTTTATAGTTTAATTAACAAATGACATTGTCTATAATGGAAAATCAT
GATGCTATAAAAGTAGCTTTAAAGGATTATCAGAATACTACAGGAGAAAT
ACCTAAAGTATTGGATAGATATCTTGAATATGTTGCTAGAACTGGGAAAC
CATTATTTTCATGGGATTTGATTAGTAACTTAATAATAAAAAAATTTGAA
AATGTTTTTGATGATTTCGGGGTCGATAAGTCAATTCAAAACGTTAAAAC
TATCAATAATGACAACGCAACAGCTCATTCATTAAAACAGGAATGCCTAC
AGGCTATTGCCACTTTAACTGGTGTTCCATTCACAATTCAACGAATTTGT
GAATTATTGTTGAACCCCAAGAAAAACTATACTAAACTCGAAAAGTTTTT
GCGAGGATTTTTACGAGTTATTAAAGTTGTTACGACTGTCGACAGAATAG
GACAAAAAATTACTACAGAATCTCAACTATTTGCTAATGCGATGTCACCA
TTTGAAGTGAATGAATCTGGTGATAATTGGTCAGGATTTTCCAGTCAATC
TGATGATTCCCTTGTCCACATTCAAATGCAAAGTCCCGATAATAATTTAC
TGGATGACCCGAAGCAAAGTATCGATTTTATTGATGAGAAAACCCCCCAA
CCAGTTACTGTTTGTCTCTCATCTGGTCCCAGTGATAGTTACGCAACGAA
AATGATAGACCAAGGACAACAAACCTCTGATAGCATTTACCCGAATAATG
AGCAGCAATATTTCATGGAACAGAAAACAATTATATCTATGCCACCGATC
GGCGCACTGTTCAAACCGATCGATCAATTGGAAGCGTTTGTGCAGAATGT
CTCGAATCAAGTCGAATCCAGCAGCAGCAGTACACCACCGAAAATTGAAG
ACACCAAGAAACGAACTGCCGATGAAAGTGTCGATTGCCTGACCGCCGAG
TCACCGTGCTCGAGTCTCGATGAGCATTTGGGCAATGATTTCGTGAGCCA
GGTGAAAAAGCGTAAACTCGATATCGTTTCCCAGGAGGCCGTTATCAGCT
CGACCGAAGTGATGTCGGAAGAAATTCCAACAAAAGATGAAGCCCAAATC
TCAGAAATCGAGACAGGATTGCCCGCTGTGTCATCTCAAGCGAATCTCTG
TGCCGAGGAGCCTTCTTCATCGACCAATGAAATAAAGCCCAGCAGCAACA
GCATTGTCAACGGTGCTATTATTGGGCCAATCAAACCAAATGATGATGAT
GAATTGCTGTGTTGTTACTCGGCTGTTGATGATGGCAACTGCAGTACAAA
TCGGGCTGTTGAGGCCGATCAAAGCAATAACTGTGATGATGATGACAACG
ACAGTAACTCCATTGATCCGATGCCAATCGATGAGAACAATTGCGCTAAT
GATGATGATGAGGAGGAGGAGGATGCAGCTGGTGGTGCTGATGGGGTGGA
TCTAGACCGAGACCTTGATGATGAGCAACTGGAACAAGAGCACGATCGAG
ATGATATATCTATCGATACGGAAACCTTGGACAGTGATGACAATCGATAC
GATGATGACGAGGAGGAGCTGTTGAGGAAGCAAGTTGTAGCGGTTGCTAG
AATGGTTCCGACGGATTTTATTGATGACGAGGCGGAATTATCGGGATCAG
ATGATGATGATAACGAGCATTATGGGCCGGACGAGGACGGGTCTGATCTG
GATCGATATGAGGAGGAAGATGAAGCAGACGCAGAGAAGTTGCCATCGGA
GGGCCGCTTGCGTCGGCAAATTGAGAAAATTCACAACCGACTTGAGATCG
ACAAGGACGCTCGTGACATTCGGTACTTGAAGGAGCTGTACCTGGAGGAC
GGTGACCTGCACATTGCTGGCGCTGGCCAGAGGAGGCGCCGATACGAGTG
GGCGGCCATCAGTGAGTGATAATGCACAATGTTGCTATGGTTATTGCGTG
TGTGTGTATGTATGTTGTCTAGACGCCGGTGATGACGGATTCGGTCGGTA
CCAGATCGATGCTGACGGTGACGAGCAAGATGATAACTCCGATGAGGCAA
ATAACGATCAGGTGGATTTGGACCAATCAAATGCCGACATCACTGCTGCT
ACTGGTAACGATGATGAGCAGGAGGAGGGCAATGAGCCACTGATGGAGCG
GTACGGCAGGCATCTCCATGCCAGGAAATACGTCCCGAGGGTTCAGGAAC
AACAACACAATGCATGGCAACCGCTCACTGCCCGTGCGACATTGGGTAGC
AACGGCGGCACACACAAAGGAGGACCAACGGACAGTGGTGATTTCATGCG
GCCGGTGCAGCAAAAGCACGGGTCACTGATGAACAAGATCAGTCAGCTGC
CGCCAGTCAATCCCAATCATCAATCCACAATGTCACTCAAATCCAGAATG
CAGCAGCACACATTCACTGTCCAATCCAAGCAATCTGCAACCAAGCGGCA
ACCTAGCAACGCGAATGAGGAGCTCGGAAATGACGCCAGCAAGAAACAAA
AATTTTAGATTATAAAATCGCTTTTTGTATGAATATAATTATTTCATTG
back to top

protein sequence of SMED30002777-orf-1

>SMED30002777-orf-1 ID=SMED30002777-orf-1|Name=SMED30002777-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=122bp
MERYGRHLHARKYVPRVQEQQHNAWQPLTARATLGSNGGTHKGGPTDSGD
FMRPVQQKHGSLMNKISQLPPVNPNHQSTMSLKSRMQQHTFTVQSKQSAT
KRQPSNANEELGNDASKKQKF*
back to top

protein sequence of SMED30002777-orf-2

>SMED30002777-orf-2 ID=SMED30002777-orf-2|Name=SMED30002777-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=632bp
MTLSIMENHDAIKVALKDYQNTTGEIPKVLDRYLEYVARTGKPLFSWDLI
SNLIIKKFENVFDDFGVDKSIQNVKTINNDNATAHSLKQECLQAIATLTG
VPFTIQRICELLLNPKKNYTKLEKFLRGFLRVIKVVTTVDRIGQKITTES
QLFANAMSPFEVNESGDNWSGFSSQSDDSLVHIQMQSPDNNLLDDPKQSI
DFIDEKTPQPVTVCLSSGPSDSYATKMIDQGQQTSDSIYPNNEQQYFMEQ
KTIISMPPIGALFKPIDQLEAFVQNVSNQVESSSSSTPPKIEDTKKRTAD
ESVDCLTAESPCSSLDEHLGNDFVSQVKKRKLDIVSQEAVISSTEVMSEE
IPTKDEAQISEIETGLPAVSSQANLCAEEPSSSTNEIKPSSNSIVNGAII
GPIKPNDDDELLCCYSAVDDGNCSTNRAVEADQSNNCDDDDNDSNSIDPM
PIDENNCANDDDEEEEDAAGGADGVDLDRDLDDEQLEQEHDRDDISIDTE
TLDSDDNRYDDDEEELLRKQVVAVARMVPTDFIDDEAELSGSDDDDNEHY
GPDEDGSDLDRYEEEDEADAEKLPSEGRLRRQIEKIHNRLEIDKDARDIR
YLKELYLEDGDLHIAGAGQRRRRYEWAAISE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0043666regulation of phosphoprotein phosphatase activity
GO:0050790regulation of catalytic activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR015267PPP4R2
Vocabulary: cellular component
TermDefinition
GO:0030289protein phosphatase 4 complex
Vocabulary: molecular function
TermDefinition
GO:0030362protein phosphatase type 4 regulator activity
GO:0019888protein phosphatase regulator activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015267Protein phosphatase 4 core regulatory subunit R2PFAMPF09184PPP4R2coord: 15..433
e-value: 4.1E-27
score: 95.5
IPR015267Protein phosphatase 4 core regulatory subunit R2PANTHERPTHR16487PPP4R2-RELATED PROTEINcoord: 8..387
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 279..304
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 433..468