tRNA-binding domain-containing protein

Overview
NametRNA-binding domain-containing protein
Smed IDSMED30002776
Length (bp)1094
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of tRNA-binding domain-containing protein (SMED30002776) t-SNE clustered cells

Violin plots show distribution of expression levels for tRNA-binding domain-containing protein (SMED30002776) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of tRNA-binding domain-containing protein (SMED30002776) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for tRNA-binding domain-containing protein (SMED30002776) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002776

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30002776h1SMcG0006611 Contig7667newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30002776h1SMcG0006611 Contig7667uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30002776h1SMcG0006611 SmedASXL_007958SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30002776h1SMcG0006611 dd_Smed_v4_1675_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002776h1SMcG0006611 dd_Smed_v4_1675_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30002776h1SMcG0006611 dd_Smed_v4_1675_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002776h1SMcG0006611 dd_Smed_v4_1675_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002776h1SMcG0006611 dd_Smed_v4_1675_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of tRNA-binding domain-containing protein vs. Ensembl Human
Match: AIMP1 (aminoacyl tRNA synthetase complex interacting multifunctional protein 1 [Source:HGNC Symbol;Acc:HGNC:10648])

HSP 1 Score: 167.162 bits (422), Expect = 2.488e-48
Identity = 77/162 (47.53%), Postives = 113/162 (69.75%), Query Frame = 3
Query:  483 IDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQNMVEPLLVPEGVKPGDRVTVEGFGSNPDEIMNPKKKILETVKPEMKVDENGIATYRGGRWQVNGQVGLIKSTNLKN 968
            ID+SR D+RIG I+   KH +ADSLYVE+VD+GE  PR ++SGLV +     +  RM + L NLKPAKMRG+LS+ M+MCAS+PE+  +E L  P G  PGDR+T + F   PD+ +NPKKKI E ++P++  ++  +ATY+G  ++V G+ G+ ++  + N
Sbjct:  150 IDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEK--IEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGK-GVCRAQTMSN 308          
BLAST of tRNA-binding domain-containing protein vs. Ensembl Human
Match: AIMP1 (aminoacyl tRNA synthetase complex interacting multifunctional protein 1 [Source:HGNC Symbol;Acc:HGNC:10648])

HSP 1 Score: 167.162 bits (422), Expect = 2.488e-48
Identity = 77/162 (47.53%), Postives = 113/162 (69.75%), Query Frame = 3
Query:  483 IDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQNMVEPLLVPEGVKPGDRVTVEGFGSNPDEIMNPKKKILETVKPEMKVDENGIATYRGGRWQVNGQVGLIKSTNLKN 968
            ID+SR D+RIG I+   KH +ADSLYVE+VD+GE  PR ++SGLV +     +  RM + L NLKPAKMRG+LS+ M+MCAS+PE+  +E L  P G  PGDR+T + F   PD+ +NPKKKI E ++P++  ++  +ATY+G  ++V G+ G+ ++  + N
Sbjct:  150 IDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEK--IEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGK-GVCRAQTMSN 308          
BLAST of tRNA-binding domain-containing protein vs. Ensembl Human
Match: AIMP1 (aminoacyl tRNA synthetase complex interacting multifunctional protein 1 [Source:HGNC Symbol;Acc:HGNC:10648])

HSP 1 Score: 167.162 bits (422), Expect = 2.488e-48
Identity = 77/162 (47.53%), Postives = 113/162 (69.75%), Query Frame = 3
Query:  483 IDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQNMVEPLLVPEGVKPGDRVTVEGFGSNPDEIMNPKKKILETVKPEMKVDENGIATYRGGRWQVNGQVGLIKSTNLKN 968
            ID+SR D+RIG I+   KH +ADSLYVE+VD+GE  PR ++SGLV +     +  RM + L NLKPAKMRG+LS+ M+MCAS+PE+  +E L  P G  PGDR+T + F   PD+ +NPKKKI E ++P++  ++  +ATY+G  ++V G+ G+ ++  + N
Sbjct:  150 IDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEK--IEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGK-GVCRAQTMSN 308          
BLAST of tRNA-binding domain-containing protein vs. Ensembl Human
Match: AIMP1 (aminoacyl tRNA synthetase complex interacting multifunctional protein 1 [Source:HGNC Symbol;Acc:HGNC:10648])

HSP 1 Score: 167.162 bits (422), Expect = 2.488e-48
Identity = 77/162 (47.53%), Postives = 113/162 (69.75%), Query Frame = 3
Query:  483 IDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQNMVEPLLVPEGVKPGDRVTVEGFGSNPDEIMNPKKKILETVKPEMKVDENGIATYRGGRWQVNGQVGLIKSTNLKN 968
            ID+SR D+RIG I+   KH +ADSLYVE+VD+GE  PR ++SGLV +     +  RM + L NLKPAKMRG+LS+ M+MCAS+PE+  +E L  P G  PGDR+T + F   PD+ +NPKKKI E ++P++  ++  +ATY+G  ++V G+ G+ ++  + N
Sbjct:  150 IDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEK--IEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGK-GVCRAQTMSN 308          
BLAST of tRNA-binding domain-containing protein vs. Ensembl Human
Match: AIMP1 (aminoacyl tRNA synthetase complex interacting multifunctional protein 1 [Source:HGNC Symbol;Acc:HGNC:10648])

HSP 1 Score: 167.162 bits (422), Expect = 2.488e-48
Identity = 77/162 (47.53%), Postives = 113/162 (69.75%), Query Frame = 3
Query:  483 IDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQNMVEPLLVPEGVKPGDRVTVEGFGSNPDEIMNPKKKILETVKPEMKVDENGIATYRGGRWQVNGQVGLIKSTNLKN 968
            ID+SR D+RIG I+   KH +ADSLYVE+VD+GE  PR ++SGLV +     +  RM + L NLKPAKMRG+LS+ M+MCAS+PE+  +E L  P G  PGDR+T + F   PD+ +NPKKKI E ++P++  ++  +ATY+G  ++V G+ G+ ++  + N
Sbjct:  150 IDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEK--IEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGK-GVCRAQTMSN 308          
BLAST of tRNA-binding domain-containing protein vs. Ensembl Celegans
Match: mars-1 (Methionine--tRNA ligase, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q20970])

HSP 1 Score: 150.214 bits (378), Expect = 1.502e-42
Identity = 76/172 (44.19%), Postives = 110/172 (63.95%), Query Frame = 3
Query:  396 NTIKPSEPLENKSKGDRKAQPKSSEAPEVIDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQNMVEPLLVPEGVKPGDRVTVEGFGSNPDEIMNPKKKILETVKPEMKVDENGIATYRG 911
            +T  PSEP + K +   K    ++   + ID+ R DMR+G+I++  KH +AD+LYVE++D+GE  PR ++SGLV++     +  R+ V L NLKPAKMRG+ S  M+MCAS+P++  VE + VP   KPG  V    +   PDE +NPKKKI ETV  ++KV   G A ++G
Sbjct:  103 STPAPSEPKKAKEQKKGKGGAAAAPVDDTIDVGRLDMRVGRIIKCEKHPDADALYVEQIDVGESAPRTVVSGLVRHVPLDQMQNRLVVVLCNLKPAKMRGVESRAMVMCASSPDK--VEIMEVPADSKPGTPVVCPPYTHRPDEQLNPKKKIWETVAEDLKVSAEGFAEWKG 272          
BLAST of tRNA-binding domain-containing protein vs. Ensembl Celegans
Match: mars-1 (Methionine--tRNA ligase, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q20970])

HSP 1 Score: 149.058 bits (375), Expect = 2.868e-39
Identity = 76/172 (44.19%), Postives = 110/172 (63.95%), Query Frame = 3
Query:  396 NTIKPSEPLENKSKGDRKAQPKSSEAPEVIDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQNMVEPLLVPEGVKPGDRVTVEGFGSNPDEIMNPKKKILETVKPEMKVDENGIATYRG 911
            +T  PSEP + K +   K    ++   + ID+ R DMR+G+I++  KH +AD+LYVE++D+GE  PR ++SGLV++     +  R+ V L NLKPAKMRG+ S  M+MCAS+P++  VE + VP   KPG  V    +   PDE +NPKKKI ETV  ++KV   G A ++G
Sbjct:  726 STPAPSEPKKAKEQKKGKGGAAAAPVDDTIDVGRLDMRVGRIIKCEKHPDADALYVEQIDVGESAPRTVVSGLVRHVPLDQMQNRLVVVLCNLKPAKMRGVESRAMVMCASSPDK--VEIMEVPADSKPGTPVVCPPYTHRPDEQLNPKKKIWETVAEDLKVSAEGFAEWKG 895          
BLAST of tRNA-binding domain-containing protein vs. Ensembl Fly
Match: AIMP1 (gene:FBgn0033351 transcript:FBtr0088676)

HSP 1 Score: 165.622 bits (418), Expect = 5.015e-48
Identity = 79/163 (48.47%), Postives = 109/163 (66.87%), Query Frame = 3
Query:  483 IDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQNMVEPLLVPEGVKPGDRVTVEGFGSNPDEIMNPKKKILETVKPEMKVDENGIATYRGGRWQVNGQVGLIKSTNLKNV 971
            +D+ R D+R+GKI+EV +H +ADSLY+EK+D GE  PR ++SGLVK+    ++  R+ V + NLKPAKMRG+ SE M+MCAS PE+  VE L  P G  PGD V  EG+   PD  +NPKKKI E+  P++K +   +A Y+G    V G+  ++  T LKNV
Sbjct:  161 VDVGRLDLRVGKIVEVGRHPDADSLYLEKIDCGEAAPRTVVSGLVKFVPLEEMQNRLVVVMCNLKPAKMRGVTSEAMVMCASTPEK--VEVLSPPAGAVPGDLVHCEGYPRQPDAQLNPKKKIFESCAPDLKTNGELVACYKGAALHVPGKGNVVAQT-LKNV 320          
BLAST of tRNA-binding domain-containing protein vs. Ensembl Fly
Match: TyrRS (gene:FBgn0027080 transcript:FBtr0075410)

HSP 1 Score: 155.221 bits (391), Expect = 2.037e-42
Identity = 66/138 (47.83%), Postives = 99/138 (71.74%), Query Frame = 3
Query:  495 RFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQNMVEPLLVPEGVKPGDRVTVEGFGSNPDEIMNPKKKILETVKPEMKVDENGIATYR 908
            R D+R+GK++EV +H +AD+LYV K+D+ E +PR IISGLVK+ +E +L  R+   L NLKP+KMRGILSEGM++C S  +  +VEP+++P     G R++ EGF   PDE +NPKKK+ E +  + K + +G+A ++
Sbjct:  366 RLDIRVGKVVEVARHPDADTLYVLKIDLAEAQPRTIISGLVKFVTEEELNQRLVAVLCNLKPSKMRGILSEGMVLCTSNADHTVVEPIVLPATATAGSRLSFEGFSGTPDEQLNPKKKVWEKLSADFKTNSDGLAVWK 503          
BLAST of tRNA-binding domain-containing protein vs. Ensembl Zebrafish
Match: aimp1a (aminoacyl tRNA synthetase complex interacting multifunctional protein 1a [Source:ZFIN;Acc:ZDB-GENE-060825-144])

HSP 1 Score: 175.252 bits (443), Expect = 1.402e-51
Identity = 80/160 (50.00%), Postives = 115/160 (71.88%), Query Frame = 3
Query:  483 IDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQNMVEPLLVPEGVKPGDRVTVEGFGSNPDEIMNPKKKILETVKPEMKVDENGIATYRGGRWQVNGQVGLIKSTNL 962
            +D+SR D+R+G+I+   KH +ADSLYVE+VD+GE  PR ++SGLVK+     +  RMAV L NLKPAKMRG+LS+ M+MCAS+PE+  VE L  P G   GDR+T +GF   PD+ +NPKKK+ E V+P++  D+  +ATY+G  ++V G+ G+ K+  +
Sbjct:  153 VDVSRLDLRVGRIISAEKHPDADSLYVEQVDVGEAAPRTVVSGLVKHIPLDQMQNRMAVLLCNLKPAKMRGVLSQAMVMCASSPEK--VEILDPPSGAAAGDRITFQGFPGEPDKELNPKKKVWEQVQPDLLTDDQCVATYKGVAFEVTGK-GVCKAQTM 309          
BLAST of tRNA-binding domain-containing protein vs. Ensembl Zebrafish
Match: aimp1b (aminoacyl tRNA synthetase complex interacting multifunctional protein 1b [Source:ZFIN;Acc:ZDB-GENE-041212-13])

HSP 1 Score: 148.673 bits (374), Expect = 3.689e-41
Identity = 64/162 (39.51%), Postives = 111/162 (68.52%), Query Frame = 3
Query:  483 IDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQNMVEPLLVPEGVKPGDRVTVEGFGSNPDEIMNPKKKILETVKPEMKVDENGIATYRGGRWQVNGQVGLIKSTNLKN 968
            +D+SR D+R+ +IL+V KH +++SLYV++V++GE  PR ++SGL  +     LLG + V L N++  K+RG+ S+  ++CA    Q  +EPL  P G +PGDRVT + +   P++ +NPK+++ E + P++++D  G+ATYRG  ++V G+ GL ++ N+ +
Sbjct:  184 LDVSRLDLRVARILDVRKHPDSESLYVQEVELGEHAPRTVVSGLTNHVPPEQLLGSLVVLLCNVRSVKVRGVQSQARLLCAV--NQERMEPLTPPTGAQPGDRVTFQLYPGEPEKELNPKQRLWERLLPDLRIDARGVATYRGVAFEVRGK-GLCRAPNITS 342          
BLAST of tRNA-binding domain-containing protein vs. Ensembl Zebrafish
Match: yars1 (tyrosyl-tRNA synthetase 1 [Source:NCBI gene;Acc:368235])

HSP 1 Score: 150.214 bits (378), Expect = 1.915e-40
Identity = 81/189 (42.86%), Postives = 120/189 (63.49%), Query Frame = 3
Query:  348 VEKKADPPKVTKQPVINTIKPSEPLENKSKGDRKAQPKSSEAPEVIDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAP-EQNMVEPLLVPEGVKPGDRVTVEGFGSN-PDEIMNPKKKILETVKPEMKVDENGIATYR 908
            + KK + P++ K         + P  +K+KG  K  PK +   + +  SR D+R+GK++ V KH +ADSLY+EK+D+GE++PR ++SGLV Y +E  L  R+ V L NLKP KMRGI S+ M++CAS   E   VEPL  PEG   GDRV VEG+ S  PD+ + PKKK+ E ++ ++K+    +A ++
Sbjct:  324 IRKKFESPELKK-----LTSSAYPEPSKNKGGAKGNPKQTTDDDEVIPSRLDIRVGKVISVEKHPDADSLYLEKIDVGEEQPRTVVSGLVAYITEEQLQDRLVVLLCNLKPQKMRGIESQAMVLCASIEGEPRKVEPLDPPEGSAAGDRVYVEGYESGKPDDELKPKKKVFEKLQVDLKISGEFVAQWK 507          
BLAST of tRNA-binding domain-containing protein vs. Ensembl Zebrafish
Match: yars1 (tyrosyl-tRNA synthetase 1 [Source:NCBI gene;Acc:368235])

HSP 1 Score: 150.214 bits (378), Expect = 1.915e-40
Identity = 81/189 (42.86%), Postives = 120/189 (63.49%), Query Frame = 3
Query:  348 VEKKADPPKVTKQPVINTIKPSEPLENKSKGDRKAQPKSSEAPEVIDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAP-EQNMVEPLLVPEGVKPGDRVTVEGFGSN-PDEIMNPKKKILETVKPEMKVDENGIATYR 908
            + KK + P++ K         + P  +K+KG  K  PK +   + +  SR D+R+GK++ V KH +ADSLY+EK+D+GE++PR ++SGLV Y +E  L  R+ V L NLKP KMRGI S+ M++CAS   E   VEPL  PEG   GDRV VEG+ S  PD+ + PKKK+ E ++ ++K+    +A ++
Sbjct:  324 IRKKFESPELKK-----LTSSAYPEPSKNKGGAKGNPKQTTDDDEVIPSRLDIRVGKVISVEKHPDADSLYLEKIDVGEEQPRTVVSGLVAYITEEQLQDRLVVLLCNLKPQKMRGIESQAMVLCASIEGEPRKVEPLDPPEGSAAGDRVYVEGYESGKPDDELKPKKKVFEKLQVDLKISGEFVAQWK 507          
BLAST of tRNA-binding domain-containing protein vs. Ensembl Zebrafish
Match: yars1 (tyrosyl-tRNA synthetase 1 [Source:NCBI gene;Acc:368235])

HSP 1 Score: 150.214 bits (378), Expect = 1.915e-40
Identity = 81/189 (42.86%), Postives = 120/189 (63.49%), Query Frame = 3
Query:  348 VEKKADPPKVTKQPVINTIKPSEPLENKSKGDRKAQPKSSEAPEVIDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAP-EQNMVEPLLVPEGVKPGDRVTVEGFGSN-PDEIMNPKKKILETVKPEMKVDENGIATYR 908
            + KK + P++ K         + P  +K+KG  K  PK +   + +  SR D+R+GK++ V KH +ADSLY+EK+D+GE++PR ++SGLV Y +E  L  R+ V L NLKP KMRGI S+ M++CAS   E   VEPL  PEG   GDRV VEG+ S  PD+ + PKKK+ E ++ ++K+    +A ++
Sbjct:  324 IRKKFESPELKK-----LTSSAYPEPSKNKGGAKGNPKQTTDDDEVIPSRLDIRVGKVISVEKHPDADSLYLEKIDVGEEQPRTVVSGLVAYITEEQLQDRLVVLLCNLKPQKMRGIESQAMVLCASIEGEPRKVEPLDPPEGSAAGDRVYVEGYESGKPDDELKPKKKVFEKLQVDLKISGEFVAQWK 507          
BLAST of tRNA-binding domain-containing protein vs. Ensembl Xenopus
Match: aimp1 (aminoacyl tRNA synthetase complex-interacting multifunctional protein 1 [Source:NCBI gene;Acc:549804])

HSP 1 Score: 169.474 bits (428), Expect = 1.825e-49
Identity = 79/164 (48.17%), Postives = 116/164 (70.73%), Query Frame = 3
Query:  477 EVIDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQNMVEPLLVPEGVKPGDRVTVEGFGSNPDEIMNPKKKILETVKPEMKVDENGIATYRGGRWQVNGQVGLIKSTNLKN 968
            + +D+SR D+R+G I+   KH +ADSLYVE+VD+GE  PR ++SGLVK+     +  RMAV L NLKPAKMRGILS+ M+MCAS+PE+  VE L  P G  PGDR+T +G+   PD+ +NPKKK  E ++P++  ++  +ATY+G  ++V G+ G+ K+  + +
Sbjct:  140 KAVDVSRLDLRVGCIVTAKKHPDADSLYVEEVDVGEATPRTVVSGLVKHIPLEQMQNRMAVLLCNLKPAKMRGILSQAMVMCASSPEK--VEILDPPSGAVPGDRITFQGYPGEPDKELNPKKKTWEQIQPDLLTNDKCVATYKGVPFEVQGK-GVCKAQTMTS 300          
BLAST of tRNA-binding domain-containing protein vs. Ensembl Xenopus
Match: aimp1 (aminoacyl tRNA synthetase complex-interacting multifunctional protein 1 [Source:NCBI gene;Acc:549804])

HSP 1 Score: 169.474 bits (428), Expect = 2.465e-49
Identity = 79/164 (48.17%), Postives = 116/164 (70.73%), Query Frame = 3
Query:  477 EVIDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQNMVEPLLVPEGVKPGDRVTVEGFGSNPDEIMNPKKKILETVKPEMKVDENGIATYRGGRWQVNGQVGLIKSTNLKN 968
            + +D+SR D+R+G I+   KH +ADSLYVE+VD+GE  PR ++SGLVK+     +  RMAV L NLKPAKMRGILS+ M+MCAS+PE+  VE L  P G  PGDR+T +G+   PD+ +NPKKK  E ++P++  ++  +ATY+G  ++V G+ G+ K+  + +
Sbjct:  149 KAVDVSRLDLRVGCIVTAKKHPDADSLYVEEVDVGEATPRTVVSGLVKHIPLEQMQNRMAVLLCNLKPAKMRGILSQAMVMCASSPEK--VEILDPPSGAVPGDRITFQGYPGEPDKELNPKKKTWEQIQPDLLTNDKCVATYKGVPFEVQGK-GVCKAQTMTS 309          
BLAST of tRNA-binding domain-containing protein vs. Ensembl Mouse
Match: Aimp1 (aminoacyl tRNA synthetase complex-interacting multifunctional protein 1 [Source:MGI Symbol;Acc:MGI:102774])

HSP 1 Score: 169.859 bits (429), Expect = 1.472e-49
Identity = 79/162 (48.77%), Postives = 111/162 (68.52%), Query Frame = 3
Query:  483 IDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQNMVEPLLVPEGVKPGDRVTVEGFGSNPDEIMNPKKKILETVKPEMKVDENGIATYRGGRWQVNGQVGLIKSTNLKN 968
            ID SR D+RIG I+   KH +ADSLYVE+VD+GE  PR ++SGLV +     +  RM V L NLKPAKMRG+LS+ M+MCAS+PE+  VE L  P G  PGDR+T + F   PD+ +NPKKKI E ++P++  +   +ATY+G  ++V G+ G+ ++  + N
Sbjct:  148 IDASRLDLRIGCIVTAKKHPDADSLYVEEVDVGEAAPRTVVSGLVNHVPLEQMQNRMVVLLCNLKPAKMRGVLSQAMVMCASSPEK--VEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNAECVATYKGAPFEVKGK-GVCRAQTMAN 306          
BLAST of tRNA-binding domain-containing protein vs. Ensembl Mouse
Match: Aimp1 (aminoacyl tRNA synthetase complex-interacting multifunctional protein 1 [Source:MGI Symbol;Acc:MGI:102774])

HSP 1 Score: 169.088 bits (427), Expect = 3.518e-49
Identity = 79/162 (48.77%), Postives = 111/162 (68.52%), Query Frame = 3
Query:  483 IDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQNMVEPLLVPEGVKPGDRVTVEGFGSNPDEIMNPKKKILETVKPEMKVDENGIATYRGGRWQVNGQVGLIKSTNLKN 968
            ID SR D+RIG I+   KH +ADSLYVE+VD+GE  PR ++SGLV +     +  RM V L NLKPAKMRG+LS+ M+MCAS+PE+  VE L  P G  PGDR+T + F   PD+ +NPKKKI E ++P++  +   +ATY+G  ++V G+ G+ ++  + N
Sbjct:  157 IDASRLDLRIGCIVTAKKHPDADSLYVEEVDVGEAAPRTVVSGLVNHVPLEQMQNRMVVLLCNLKPAKMRGVLSQAMVMCASSPEK--VEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNAECVATYKGAPFEVKGK-GVCRAQTMAN 315          
BLAST of tRNA-binding domain-containing protein vs. Ensembl Mouse
Match: Yars (tyrosyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:2147627])

HSP 1 Score: 149.058 bits (375), Expect = 1.023e-39
Identity = 83/188 (44.15%), Postives = 119/188 (63.30%), Query Frame = 3
Query:  411 SEPLENKSKGDRKAQPKSSEAPEVIDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPE-QNMVEPLLVPEGVKPGDRVTVEGF-GSNPDEIMNPKKKILETVKPEMKVDENGIATYRGGRWQVNGQVGLIKSTNLKN 968
            + P  +K K   K   K+SE  EVI  SR D+R+GKIL V KH +ADSLYVEK+D+GE +PR ++SGLV++  + +L  R+ V L NLKP KMRG+ S+GM++CAS       VEPL  P G  PG+RV V+G+    PDE + PKKK+ E ++ + K+ E  IA ++   +    ++G +   +LK 
Sbjct:  376 AYPDPSKQKPPAKGPAKNSEPEEVIP-SRLDIRVGKILSVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVDSQGMLLCASVEGVSRQVEPLDPPAGSAPGERVFVQGYEKGQPDEELKPKKKVFEKLQADFKISEECIAQWKQTNFMT--KLGFVSCKSLKG 560          
BLAST of tRNA-binding domain-containing protein vs. UniProt/SwissProt
Match: sp|O54873|AIMP1_CRIGR (Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Cricetulus griseus OX=10029 GN=AIMP1 PE=2 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 2.839e-50
Identity = 84/175 (48.00%), Postives = 119/175 (68.00%), Query Frame = 3
Query:  444 RKAQPKSSEAPEVIDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQNMVEPLLVPEGVKPGDRVTVEGFGSNPDEIMNPKKKILETVKPEMKVDENGIATYRGGRWQVNGQVGLIKSTNLKN 968
            + A P +   P  +D+SR D+RIG+I+ V KH +ADSLYVE+VD+GE  PR +ISGLV +     +  RM V L NLKPAKMRGILS+ M+MCAS+PE+  VE L  P G  PGDR+T + F   PD+ +NPKKKI E ++P++  +   +ATY+G  ++V G+ G+ ++  + N
Sbjct:  186 QSAAPSADSKP--VDVSRLDLRIGRIVTVKKHPDADSLYVEEVDVGEAAPRTVISGLVNHVPLDQMQNRMVVLLCNLKPAKMRGILSQAMVMCASSPEK--VEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNAECVATYKGSPFEVKGK-GVCRAQTMAN 355          
BLAST of tRNA-binding domain-containing protein vs. UniProt/SwissProt
Match: sp|P31230|AIMP1_MOUSE (Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Mus musculus OX=10090 GN=Aimp1 PE=1 SV=2)

HSP 1 Score: 169.859 bits (429), Expect = 1.030e-48
Identity = 79/162 (48.77%), Postives = 111/162 (68.52%), Query Frame = 3
Query:  483 IDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQNMVEPLLVPEGVKPGDRVTVEGFGSNPDEIMNPKKKILETVKPEMKVDENGIATYRGGRWQVNGQVGLIKSTNLKN 968
            ID SR D+RIG I+   KH +ADSLYVE+VD+GE  PR ++SGLV +     +  RM V L NLKPAKMRG+LS+ M+MCAS+PE+  VE L  P G  PGDR+T + F   PD+ +NPKKKI E ++P++  +   +ATY+G  ++V G+ G+ ++  + N
Sbjct:  148 IDASRLDLRIGCIVTAKKHPDADSLYVEEVDVGEAAPRTVVSGLVNHVPLEQMQNRMVVLLCNLKPAKMRGVLSQAMVMCASSPEK--VEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNAECVATYKGAPFEVKGK-GVCRAQTMAN 306          
BLAST of tRNA-binding domain-containing protein vs. UniProt/SwissProt
Match: sp|Q12904|AIMP1_HUMAN (Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Homo sapiens OX=9606 GN=AIMP1 PE=1 SV=2)

HSP 1 Score: 167.162 bits (422), Expect = 1.195e-47
Identity = 77/162 (47.53%), Postives = 113/162 (69.75%), Query Frame = 3
Query:  483 IDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQNMVEPLLVPEGVKPGDRVTVEGFGSNPDEIMNPKKKILETVKPEMKVDENGIATYRGGRWQVNGQVGLIKSTNLKN 968
            ID+SR D+RIG I+   KH +ADSLYVE+VD+GE  PR ++SGLV +     +  RM + L NLKPAKMRG+LS+ M+MCAS+PE+  +E L  P G  PGDR+T + F   PD+ +NPKKKI E ++P++  ++  +ATY+G  ++V G+ G+ ++  + N
Sbjct:  150 IDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEK--IEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGK-GVCRAQTMSN 308          
BLAST of tRNA-binding domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6TGS6|SYYC_DANRE (Tyrosine--tRNA ligase, cytoplasmic OS=Danio rerio OX=7955 GN=yars1 PE=2 SV=2)

HSP 1 Score: 149.828 bits (377), Expect = 2.189e-39
Identity = 81/189 (42.86%), Postives = 120/189 (63.49%), Query Frame = 3
Query:  348 VEKKADPPKVTKQPVINTIKPSEPLENKSKGDRKAQPKSSEAPEVIDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAP-EQNMVEPLLVPEGVKPGDRVTVEGFGSN-PDEIMNPKKKILETVKPEMKVDENGIATYR 908
            + KK + P++ K         + P  +K+KG  K  PK +   + +  SR D+R+GK++ V KH +ADSLY+EK+D+GE++PR ++SGLV Y +E  L  R+ V L NLKP KMRGI S+ M++CAS   E   VEPL  PEG   GDRV VEG+ S  PD+ + PKKK+ E ++ ++K+    +A ++
Sbjct:  324 IRKKFESPELKK-----LTSSAYPEPSKNKGGVKGNPKQTTDDDEVIPSRLDIRVGKVISVEKHPDADSLYLEKIDVGEEQPRTVVSGLVAYITEEQLQDRLVVLLCNLKPQKMRGIESQAMVLCASIEGEPRKVEPLDPPEGSAAGDRVYVEGYESGKPDDELKPKKKVFEKLQVDLKISGEFVAQWK 507          
BLAST of tRNA-binding domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4KM49|SYYC_RAT (Tyrosine--tRNA ligase, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Yars1 PE=2 SV=3)

HSP 1 Score: 149.443 bits (376), Expect = 2.784e-39
Identity = 81/187 (43.32%), Postives = 120/187 (64.17%), Query Frame = 3
Query:  411 SEPLENKSKGDRKAQPKSSEAPEVIDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPE-QNMVEPLLVPEGVKPGDRVTVEGF-GSNPDEIMNPKKKILETVKPEMKVDENGIATYRGGRWQVNGQVGLIKSTNLK 965
            + P  +K K   K   KSSE  E+I  SR D+R+GKIL V KH +ADSLYVEK+D+GE +PR ++SGLV++  + +L  R+ V L NLKP KMRG+ S+GM++CAS       VEPL  P G  PG+RV V+G+    PDE + PKKK+ E ++ + K+ ++ +A ++   +    ++G +   +LK
Sbjct:  340 AYPDPSKQKPTAKGPAKSSEPEEIIP-SRLDIRVGKILSVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVDSQGMLLCASVEGVSRQVEPLDPPAGSAPGERVFVQGYEKGQPDEELKPKKKVFEKLQADFKISDDCVAQWKQTNFMT--KLGFVSCKSLK 523          
BLAST of tRNA-binding domain-containing protein vs. TrEMBL
Match: A0A4S2LX39 (tRNA-binding domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004250 PE=4 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 2.561e-60
Identity = 108/224 (48.21%), Postives = 148/224 (66.07%), Query Frame = 3
Query:  333 RLEQVVEKKADPPKVTKQPVINTIKPSE--PLENKSKGDRKAQPKSSEAP----EVIDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQNMVEPLLV-PEGVKPGDRVTVEGFGSNPDEIMNPKKKILETVKPEMKVDENGIATYRGGRWQVNGQ-VGLIKSTNLKNVPIA 980
             + + + ++  P   TK    N +K +   P ++KS G  K   K+S +       +D+ R DMRIG+I+EV++H +ADSLYVEKVD+GE + R ++SGLVK+    +L  RM +F+ NLKPAKMRG+ SE M+MCASAPE  +VEPL++  E V  GD V V GF  NPD  +NPKKKI E VKP+++VD++G ATY+G RW +      LIKST LK+V IA
Sbjct:    6 HISRHILQRLQPSAATKTVESNNVKAASDSPGKSKSAGGSKTLGKASGSATASEATVDVGRLDMRIGRIVEVSRHPDADSLYVEKVDLGEGRLRTVVSGLVKFVPLEELQNRMGIFMCNLKPAKMRGVESEAMLMCASAPEAGVVEPLVIGSENVNLGDPVIVPGFEHNPDSQLNPKKKIFEQVKPDLRVDQDGYATYKGVRWTLKSSPSTLIKSTKLKDVQIA 229          
BLAST of tRNA-binding domain-containing protein vs. TrEMBL
Match: G7YX80 (Methionyl-tRNA synthetase cytoplasmic OS=Clonorchis sinensis OX=79923 GN=CLF_112893 PE=4 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 6.671e-60
Identity = 104/197 (52.79%), Postives = 137/197 (69.54%), Query Frame = 3
Query:  408 PSEPLENKSKGDRKAQPKSS----EAPEVIDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQNMVEPLLV-PEGVKPGDRVTVEGFGSNPDEIMNPKKKILETVKPEMKVDENGIATYRGGRWQVNGQ-VGLIKSTNLKNVPIA 980
            P  P ++KS G  K   K+S     A   +D+ R DMRIG+I+EV++H +ADSLYVEKVD+GE + R ++SGLVK+    +L  RM +F+ NLKPAKMRG+ SE M+MCASAPE  +VEPL++  E V  GD V V GF  NPD  +NPKKKI E VKP+++VD++G ATY+G RW +      LIKST L++V IA
Sbjct:   93 PDSPGKSKSAGGTKTLGKASGPTTAAEAAVDVGRLDMRIGRIVEVSRHPDADSLYVEKVDLGEGRLRTVVSGLVKFVQLEELQNRMGIFMCNLKPAKMRGVESEAMLMCASAPETGVVEPLVIGSEDVNLGDPVIVPGFEHNPDSQLNPKKKIFEQVKPDLRVDQDGYATYKGVRWTLKSSPSTLIKSTKLRDVQIA 289          
BLAST of tRNA-binding domain-containing protein vs. TrEMBL
Match: A0A4S2LX37 (tRNA-binding domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004250 PE=4 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 6.696e-60
Identity = 109/215 (50.70%), Postives = 144/215 (66.98%), Query Frame = 3
Query:  360 ADPPKVTKQPVINTIKPSE--PLENKSKGDRKAQPKSS----EAPEVIDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQNMVEPLLV-PEGVKPGDRVTVEGFGSNPDEIMNPKKKILETVKPEMKVDENGIATYRGGRWQVNGQ-VGLIKSTNLKNVPIA 980
            AD    TK    N +K +   P ++KS G  K   K+S     +   +D+ R DMRIG+I+EV++H +ADSLYVEKVD+GE + R ++SGLVK+    +L  RM +F+ NLKPAKMRG+ SE M+MCASAPE  +VEPL++  E V  GD V V GF  NPD  +NPKKKI E VKP+++VD++G ATY+G RW +      LIKST LK+V IA
Sbjct:   92 ADKTTATKTVESNNVKAASDSPGKSKSAGGSKTLGKASGSATASEATVDVGRLDMRIGRIVEVSRHPDADSLYVEKVDLGEGRLRTVVSGLVKFVPLEELQNRMGIFMCNLKPAKMRGVESEAMLMCASAPEAGVVEPLVIGSENVNLGDPVIVPGFEHNPDSQLNPKKKIFEQVKPDLRVDQDGYATYKGVRWTLKSSPSTLIKSTKLKDVQIA 306          
BLAST of tRNA-binding domain-containing protein vs. TrEMBL
Match: A0A3R7FUF9 (Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Clonorchis sinensis OX=79923 GN=AIMP1 PE=4 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 1.554e-59
Identity = 109/214 (50.93%), Postives = 143/214 (66.82%), Query Frame = 3
Query:  363 DPPKVTKQPVINTIK--PSEPLENKSKGDRKAQPKSS----EAPEVIDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQNMVEPLLV-PEGVKPGDRVTVEGFGSNPDEIMNPKKKILETVKPEMKVDENGIATYRGGRWQVNGQ-VGLIKSTNLKNVPIA 980
            D    TK    N +K  P  P ++KS G  K   K+S     A   +D+ R DMRIG+I+EV++H +ADSLYVEKVD+GE + R ++SGLVK+    +L  RM +F+ NLKPAKMRG+ SE M+MCASAPE  +VEPL++  E V  GD V V GF  NPD  +NPKKKI E VKP+++VD++G ATY+G RW +      LIKST L++V IA
Sbjct:  113 DKTTATKTVESNNVKAAPDSPGKSKSAGGTKTLGKASGPTTAAEAAVDVGRLDMRIGRIVEVSRHPDADSLYVEKVDLGEGRLRTVVSGLVKFVQLEELQNRMGIFMCNLKPAKMRGVESEAMLMCASAPEAGVVEPLVIGSEDVNLGDPVIVPGFEHNPDSQLNPKKKIFEQVKPDLRVDQDGYATYKGVRWTLKSSPSTLIKSTKLRDVQIA 326          
BLAST of tRNA-binding domain-containing protein vs. TrEMBL
Match: A0A074ZSD3 (tRNA-binding domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_14039 PE=4 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 2.036e-58
Identity = 107/215 (49.77%), Postives = 142/215 (66.05%), Query Frame = 3
Query:  360 ADPPKVTKQPVINTIKPSE--PLENKSKGDRKAQPKSS----EAPEVIDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQNMVEPLLV-PEGVKPGDRVTVEGFGSNPDEIMNPKKKILETVKPEMKVDENGIATYRGGRWQVNGQ-VGLIKSTNLKNVPIA 980
            AD    +K    N +K +   P  +KS G  K   K+S         +D+ R DMRIG+I+EV++H +ADSLYVEKVD+GE + R ++SGLVK+    +L  R+ +F+ NLKPAKMRG+ SE M+MCASAPE  +VEPL++  E VK GD V V GF  NPD  +NPKKKI E VKP+++VD++G ATY+G RW +      LIKS  LK+V IA
Sbjct:   92 ADKTTASKTVESNNVKAASDSPGASKSAGSTKTVGKASGLATAGEAAVDVGRLDMRIGRIVEVSRHPDADSLYVEKVDLGEGRLRTVVSGLVKFVPLEELQNRIGIFMCNLKPAKMRGVESEAMLMCASAPEAGVVEPLVIGSEDVKLGDPVVVPGFEHNPDSQLNPKKKIFEQVKPDLRVDQDGYATYKGVRWTLKSNPSTLIKSAKLKDVQIA 306          
BLAST of tRNA-binding domain-containing protein vs. Ensembl Cavefish
Match: aimp1a (aminoacyl tRNA synthetase complex interacting multifunctional protein 1 [Source:NCBI gene;Acc:103042821])

HSP 1 Score: 180.644 bits (457), Expect = 1.108e-53
Identity = 82/165 (49.70%), Postives = 119/165 (72.12%), Query Frame = 3
Query:  483 IDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQNMVEPLLVPEGVKPGDRVTVEGFGSNPDEIMNPKKKILETVKPEMKVDENGIATYRGGRWQVNGQVGLIKSTNLKNVPI 977
            +D+SR D+R+G+I+   KH +AD+LYVE+VD+GE  PR ++SGLVK+     +  RMAV L NLKPAKMRG++S+ M+MCAS+P++  VE L  P G  PGDRVT +GF   PD+ +NPKKK+ E V+P+++ D   +ATY+G  ++VNG+ G+ K+  + N  I
Sbjct:  157 VDVSRLDLRVGRIISAEKHPDADALYVEQVDVGEAAPRTVVSGLVKHIPLEQMQNRMAVLLCNLKPAKMRGVVSQAMVMCASSPDK--VEILDPPSGAVPGDRVTFQGFPGEPDKELNPKKKVWEQVQPDLRTDGQCVATYKGAAFEVNGK-GICKAQTMTNTGI 318          
BLAST of tRNA-binding domain-containing protein vs. Ensembl Cavefish
Match: aimp1a (aminoacyl tRNA synthetase complex interacting multifunctional protein 1 [Source:NCBI gene;Acc:103042821])

HSP 1 Score: 180.259 bits (456), Expect = 1.409e-53
Identity = 82/165 (49.70%), Postives = 119/165 (72.12%), Query Frame = 3
Query:  483 IDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQNMVEPLLVPEGVKPGDRVTVEGFGSNPDEIMNPKKKILETVKPEMKVDENGIATYRGGRWQVNGQVGLIKSTNLKNVPI 977
            +D+SR D+R+G+I+   KH +AD+LYVE+VD+GE  PR ++SGLVK+     +  RMAV L NLKPAKMRG++S+ M+MCAS+P++  VE L  P G  PGDRVT +GF   PD+ +NPKKK+ E V+P+++ D   +ATY+G  ++VNG+ G+ K+  + N  I
Sbjct:  158 VDVSRLDLRVGRIISAEKHPDADALYVEQVDVGEAAPRTVVSGLVKHIPLEQMQNRMAVLLCNLKPAKMRGVVSQAMVMCASSPDK--VEILDPPSGAVPGDRVTFQGFPGEPDKELNPKKKVWEQVQPDLRTDGQCVATYKGAAFEVNGK-GICKAQTMTNTGI 319          
BLAST of tRNA-binding domain-containing protein vs. Ensembl Cavefish
Match: yars1 (tyrosyl-tRNA synthetase 1 [Source:NCBI gene;Acc:103038774])

HSP 1 Score: 152.525 bits (384), Expect = 2.994e-41
Identity = 89/191 (46.60%), Postives = 126/191 (65.97%), Query Frame = 3
Query:  348 VEKKADPPKVTKQPVINTIKPSEPLENKSKGDRKAQPKSSEAPEVIDI--SRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAP-EQNMVEPLLVPEGVKPGDRVTVEGFGSN-PDEIMNPKKKILETVKPEMKVDENGIATYR 908
            + KK + P + K  + N+  P EP  +K+K   K  PK++ A E  DI  SR D+R+GKI+ V KH +ADSLY+EK+D+GE++PR ++SGLV Y S+  L  R+ + L NLKP KMRGI S+ M++CAS   E   VEPL  PEG  PGDRV VEGF S  PD+ + PKKK+ E ++ ++K+ +   A ++
Sbjct:  324 IRKKFEMPALKK--LTNSAYP-EP--SKNKFATKGNPKNAAAEE-DDIIPSRLDIRVGKIISVEKHPDADSLYLEKIDVGEEQPRTVVSGLVAYVSQEQLQDRLVLMLCNLKPQKMRGIESQAMLLCASVEGEPRKVEPLDPPEGSAPGDRVFVEGFESGKPDDELKPKKKVFEKLQVDLKISDECTAQWK 508          
BLAST of tRNA-binding domain-containing protein vs. Ensembl Cavefish
Match: aimp1b (aminoacyl tRNA synthetase complex interacting multifunctional protein 1b [Source:ZFIN;Acc:ZDB-GENE-041212-13])

HSP 1 Score: 138.658 bits (348), Expect = 4.588e-38
Identity = 64/161 (39.75%), Postives = 105/161 (65.22%), Query Frame = 3
Query:  486 DISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQNMVEPLLVPEGVKPGDRVTVEGFGSNPDEIMNPKKKILETVKPEMKVDENGIATYRGGRWQVNGQVGLIKSTNLKN 968
            D+S+ D+RIG+IL V KH +++SLYV++VD+GE  PR ++ GL  +     L   +AV L N+KP K+RG+ S+  ++CA+   Q+ +EPL  P G  PGDRVT + +    ++ +NPK++I E + P++  D  G+A Y+G  ++V G+ GL ++  + N
Sbjct:  130 DVSQLDLRIGRILTVRKHPDSESLYVQEVDLGEPAPRTVVCGLANHMLPEQLQDSLAVLLCNVKPVKVRGVQSQARLVCAA--NQDRIEPLDPPRGALPGDRVTFQNYPGGVEKELNPKRRIWERLLPDLHTDAKGVANYKGVAFEVRGK-GLCRAPTINN 287          
BLAST of tRNA-binding domain-containing protein vs. Ensembl Cavefish
Match: aimp1b (aminoacyl tRNA synthetase complex interacting multifunctional protein 1b [Source:ZFIN;Acc:ZDB-GENE-041212-13])

HSP 1 Score: 139.043 bits (349), Expect = 9.752e-38
Identity = 64/161 (39.75%), Postives = 105/161 (65.22%), Query Frame = 3
Query:  486 DISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQNMVEPLLVPEGVKPGDRVTVEGFGSNPDEIMNPKKKILETVKPEMKVDENGIATYRGGRWQVNGQVGLIKSTNLKN 968
            D+S+ D+RIG+IL V KH +++SLYV++VD+GE  PR ++ GL  +     L   +AV L N+KP K+RG+ S+  ++CA+   Q+ +EPL  P G  PGDRVT + +    ++ +NPK++I E + P++  D  G+A Y+G  ++V G+ GL ++  + N
Sbjct:  168 DVSQLDLRIGRILTVRKHPDSESLYVQEVDLGEPAPRTVVCGLANHMLPEQLQDSLAVLLCNVKPVKVRGVQSQARLVCAA--NQDRIEPLDPPRGALPGDRVTFQNYPGGVEKELNPKRRIWERLLPDLHTDAKGVANYKGVAFEVRGK-GLCRAPTINN 325          
BLAST of tRNA-binding domain-containing protein vs. Ensembl Sea Lamprey
Match: aimp1a (aminoacyl tRNA synthetase complex interacting multifunctional protein 1a [Source:ZFIN;Acc:ZDB-GENE-060825-144])

HSP 1 Score: 165.236 bits (417), Expect = 2.039e-48
Identity = 116/315 (36.83%), Postives = 186/315 (59.05%), Query Frame = 3
Query:   78 KSIKMEELLRKNEEAENMIKLVTSQIEILKKHGVDVSISEDQGNQLKNENXXXXXXXXXXXXXXXXXXXXNGEIQVDLPE---VIISP----RLEQVVEKKA---------DPPKVTKQPVINTIKPSEPLENKSKGDRKAQPKSS--EAPEVIDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQNMVEPLLVPEGVKPGDRVTVEGFGSNPDEIMNPKKKILETVKPEMKVDENGIATYRGGRWQVNGQVGLIKSTNLKN 968
            +S  ++ L R   EA+ +I  +  Q+++LK   V +  S+ +   L++EN+ L+++I ++K++LI  E+ NG +Q+ LP    V ++P      + V EK +         D P+   QP     K  E  E K +   K +  +   EA   +D+SR D+R+G+I+   KH +ADSLYVE+VD+ E   R ++SGLVK+     +  RM V + NLKPAKMRG+LS+ M+MCAS+ ++  VE L  P G  PGDR+T +G+   PD+ +NPKKKI E V+P++  +   +ATY+G  ++V G+ G+ K+  + N
Sbjct:   13 QSTVIDRLERWAAEADQIIGYLKQQVDLLKDRAV-LQQSQREEESLQHENETLKQEIEVVKQQLIAAEVRNGLVQIPLPTQQTVCVTPPSKAGTDTVAEKTSQSLSSPSDVDSPQAAAQPPPTGDKKKEKAEKKGEKKDKEKKVAGVEEAARPVDVSRLDLRVGRIVSAQKHPDADSLYVEQVDVAEAAARTVVSGLVKHIPLEQMQDRMIVVMCNLKPAKMRGVLSQAMVMCASSSDK--VEILDPPAGAVPGDRITFKGYPGEPDKELNPKKKIWEQVQPDLLTNGEFVATYKGVPFEVAGK-GVCKAQTMAN 323          
BLAST of tRNA-binding domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008601.1 (pep scaffold:Pmarinus_7.0:GL490070:605:2099:1 gene:ENSPMAG00000007796.1 transcript:ENSPMAT00000008601.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.929 bits (154), Expect = 4.464e-13
Identity = 36/89 (40.45%), Postives = 53/89 (59.55%), Query Frame = 3
Query:  663 LVNLKPAKMRGILSEGMIMCASAP-----EQNMVEPLLVPEGVKPGDRVTVEGFGS-NPDEIMNPKKKILETVKPEMKVDENGIATYRG 911
            L N K A+MRG+ S  M++CAS+        N +E L  PEG  PGD V V G+ + +PD  + PKKKI E ++ +++  E  IA ++G
Sbjct:    1 LCNTKVARMRGVESRAMLLCASSSPYVQRTDNTLELLDPPEGSAPGDLVHVAGYEAVSPDAELKPKKKIFEKIQVDLRTSEGRIAQWKG 89          
BLAST of tRNA-binding domain-containing protein vs. Ensembl Yeast
Match: ARC1 (Protein that binds tRNA and methionyl- and glutamyl-tRNA synthetases; involved in tRNA delivery, stimulating catalysis, and ensuring localization; also binds quadruplex nucleic acids; protein abundance increases in response to DNA replication stress; methionyl-tRNA synthetase is Mes1p; glutamyl-tRNA synthetase is Gus1p [Source:SGD;Acc:S000003073])

HSP 1 Score: 108.612 bits (270), Expect = 4.435e-27
Identity = 62/148 (41.89%), Postives = 87/148 (58.78%), Query Frame = 3
Query:  453 QPKSSEAPEVIDISRFDMRIGKILEVTKHAEADSLYVEKVDIG-EDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQ-NMVEPLLVPEGVKPGDRVTVEGFGSN-PDEIMNPKKKILETVKPEMKVDE 887
            Q + ++APE    S  D R+G I +  KH +ADSLYV  +D+G E+ PR + SGLVK+     +  R  V + NLKP  MRGI S  M++C S  ++   VEP   P+  K GD+V  EGFG   P + +NPKKKI E ++P    ++
Sbjct:  194 QEQQNKAPEKPKPSAIDFRVGFIQKAIKHPDADSLYVSTIDVGDEEGPRTVCSGLVKHFPLDAMQERYVVVVCNLKPVNMRGIKSTAMVLCGSNDDKVEFVEP---PKDSKAGDKVFFEGFGDEAPMKQLNPKKKIWEHLQPHFTTND 338          
BLAST of tRNA-binding domain-containing protein vs. Ensembl Nematostella
Match: EDO32430 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SV20])

HSP 1 Score: 160.999 bits (406), Expect = 7.816e-45
Identity = 93/219 (42.47%), Postives = 133/219 (60.73%), Query Frame = 3
Query:  348 VEKKADPPKVTKQPVINTIKPSEPLENKSKGDRKAQPKSSEAPEVIDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQN---MVEPLLVPEGVKPGDRVTVEGFGSN----PDEIMNPKKKILETVKPEMKVDENGIATYRGGRWQVN-GQVGLIKSTNLKNVPIA 980
            V KK + P+  K   I  +    P + K+KG       S+ A   +D SR D+R+GK++   KH +AD+LY+E+VD+GE+ PR ++SGL +Y S  DL  RM V L NLKP  MRG+ SE M++ AS   ++    V PL  P G KPGDRV VEG+G +    PDE +NPKKK+ ET+KP++ V  +G+A Y+G  +  + GQ+    +  LKN  I+
Sbjct:  334 VRKKFEQPEFLK---IKNLAYPPPKKTKTKGG-----GSANAERAVDPSRLDLRVGKVVSAKKHPDADALYLEQVDVGEEAPRTVVSGLAEYISLEDLQDRMVVMLCNLKPVNMRGVKSEAMLLAASIIGEDGKRTVVPLDPPAGSKPGDRVVVEGYGHDVIGAPDEQLNPKKKVFETLKPDLVVSSSGVAEYKGSPFVTSVGQI----TAMLKNAQIS 540          
BLAST of tRNA-binding domain-containing protein vs. Ensembl Nematostella
Match: EDO47243 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN11])

HSP 1 Score: 125.561 bits (314), Expect = 5.105e-35
Identity = 64/142 (45.07%), Postives = 88/142 (61.97%), Query Frame = 3
Query:  510 IGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQNMVEPLLVPEGVKPGDRVTVEGFGSNPDEIMNPKKKILETVKPEMKVDENGIATYRGGRWQVNGQ 935
            +GKI  + KH +ADSL+VE++D+GE  PR I SGL  +   S L   M V L NLKP KMRGI S+GM+MC +  ++  V  ++ PEG  PGDRV  +G    PD  +NPKKK+ ET+ P+ K +  G   +R   + V G+
Sbjct:    2 VGKIQSIKKHPDADSLFVEEIDVGEAAPRTICSGLNGHIEMSSLQDAMVVILANLKPVKMRGIFSQGMVMCCNRDDKWTV--VVPPEGSAPGDRVVFDGQEGEPDAQLNPKKKVWETLAPDFKTNSEGQPCFRDLPFTVRGK 141          
BLAST of tRNA-binding domain-containing protein vs. Ensembl Nematostella
Match: EDO27780 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8B1])

HSP 1 Score: 69.3218 bits (168), Expect = 5.581e-15
Identity = 33/74 (44.59%), Postives = 46/74 (62.16%), Query Frame = 3
Query:  687 MRGILSEGMIMCASAPEQNMVEPLLVPEGVKPGDRVTVEGFGSNPDEIMNPKKKILETVKPEMKVDENGIATYR 908
            MRGI S+GM+MC +  E+  V  ++ PEG  PGDRV  +G    PD  +NPKKK+ ET+ P+ K +  G   +R
Sbjct:    2 MRGIFSQGMVMCCNRDEKWTV--VVPPEGAAPGDRVVFDGQEGEPDAQLNPKKKVWETLAPDFKTNSEGQPCFR 73          
BLAST of tRNA-binding domain-containing protein vs. Ensembl Medaka
Match: aimp1a (aminoacyl tRNA synthetase complex interacting multifunctional protein 1 [Source:NCBI gene;Acc:101166192])

HSP 1 Score: 183.726 bits (465), Expect = 3.089e-55
Identity = 88/197 (44.67%), Postives = 131/197 (66.50%), Query Frame = 3
Query:  387 PVINTIKPSEPLENKSKGDRKAQPKSSEAPEVIDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQNMVEPLLVPEGVKPGDRVTVEGFGSNPDEIMNPKKKILETVKPEMKVDENGIATYRGGRWQVNGQVGLIKSTNLKNVPI 977
            P+ N I       NK++  ++ Q   S+    +D+SR D+R+G+I+   KH +ADSLYVE+VD+GE  PR ++SGLVK+     +  RMAV L NLKPAKMRG++S+ M+MCAS+P++  VE L  P G  PGDRVT + F   PD+ +NPKKK+ E ++P+++ DE  +ATY+G  ++V G+ G+ K+  + N  I
Sbjct:   96 PLSNVIFSGNGASNKAEKKQQQQVAVSQEDAKVDVSRLDLRVGRIVSAQKHPDADSLYVEQVDVGEAAPRTVVSGLVKHIPLDQMQNRMAVLLCNLKPAKMRGVVSQAMVMCASSPDK--VEILDPPSGAAPGDRVTFQNFPGEPDKELNPKKKVWEQIQPDLRTDERCVATYKGAAFEVAGK-GVCKAQTMSNSGI 289          
BLAST of tRNA-binding domain-containing protein vs. Ensembl Medaka
Match: aimp1a (aminoacyl tRNA synthetase complex interacting multifunctional protein 1 [Source:NCBI gene;Acc:101166192])

HSP 1 Score: 179.104 bits (453), Expect = 3.632e-53
Identity = 81/165 (49.09%), Postives = 118/165 (71.52%), Query Frame = 3
Query:  483 IDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQNMVEPLLVPEGVKPGDRVTVEGFGSNPDEIMNPKKKILETVKPEMKVDENGIATYRGGRWQVNGQVGLIKSTNLKNVPI 977
            +D+SR D+R+G+I+   KH +ADSLYVE+VD+GE  PR ++SGLVK+     +  RMAV L NLKPAKMRG++S+ M+MCAS+P++  VE L  P G  PGDRVT + F   PD+ +NPKKK+ E ++P+++ DE  +ATY+G  ++V G+ G+ K+  + N  I
Sbjct:  157 VDVSRLDLRVGRIVSAQKHPDADSLYVEQVDVGEAAPRTVVSGLVKHIPLDQMQNRMAVLLCNLKPAKMRGVVSQAMVMCASSPDK--VEILDPPSGAAPGDRVTFQNFPGEPDKELNPKKKVWEQIQPDLRTDERCVATYKGAAFEVAGK-GVCKAQTMSNSGI 318          
BLAST of tRNA-binding domain-containing protein vs. Ensembl Medaka
Match: yars1 (tyrosyl-tRNA synthetase 1 [Source:NCBI gene;Acc:101169468])

HSP 1 Score: 146.362 bits (368), Expect = 6.444e-39
Identity = 71/141 (50.35%), Postives = 101/141 (71.63%), Query Frame = 3
Query:  492 SRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAP-EQNMVEPLLVPEGVKPGDRVTVEGFGSN-PDEIMNPKKKILETVKPEMKVDENGIATYR 908
            SR D+R+GK++ V KH +ADSL++EK+D+GE +PR ++SGLV Y S+ DL  R  V L NLKP KMRGI S+ M++CAS   E   VEPL  PEG  PG+RV VEG+ +  PD+ +NPKKK+ E ++ ++KV +  +A ++
Sbjct:  372 SRLDIRVGKVISVEKHPDADSLFLEKIDVGEPEPRTVVSGLVAYVSQKDLQDRTVVLLCNLKPQKMRGIESQAMLLCASVEGEPRRVEPLDPPEGSSPGERVFVEGYETGKPDDRLNPKKKVWEKLQVDLKVSDQCVAQWK 512          
BLAST of tRNA-binding domain-containing protein vs. Ensembl Medaka
Match: aimp1b (aminoacyl tRNA synthase complex-interacting multifunctional protein 1 [Source:NCBI gene;Acc:101171033])

HSP 1 Score: 119.398 bits (298), Expect = 1.260e-30
Identity = 62/167 (37.13%), Postives = 104/167 (62.28%), Query Frame = 3
Query:  483 IDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIIS--GLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQNMVEPLLVPEGVKPGDRVTVEGFGSNPDEIMNPKKKILETVKPEMKVDENGIATYRGGRWQVNGQVGLIKSTNLKNVPI 977
            +D SR D+R+G++L V  H  +D L V++VD+GE+ PR ++S  G   +  E  L+    V L N+K +K+RG++S+  ++C SA + + VE L  P G  PGDRVT   +  +PD  +  K+++ E +K +++VD  G+A Y+G  ++V G+ GL ++ +L N  I
Sbjct:  158 MDASRLDLRVGRLLSVRPHPLSDGLSVQEVDVGENGPRTVVSKQGGGTHLDERSLV----VVLCNVKASKLRGVVSQARLLCCSASD-DCVEMLAPPVGSAPGDRVTFLSYPGDPDRELQSKQRVWEVLKTDLQVDCRGVANYKGCAFEVKGK-GLCRAPSLVNCAI 318          
BLAST of tRNA-binding domain-containing protein vs. Planmine SMEST
Match: SMESG000033588.1 (SMESG000033588.1)

HSP 1 Score: 545.043 bits (1403), Expect = 0.000e+0
Identity = 296/297 (99.66%), Postives = 296/297 (99.66%), Query Frame = 3
Query:   90 MEELLRKNEEAENMIKLVTSQIEILKKHGVDVSISEDQGNQLKNENXXXXXXXXXXXXXXXXXXXXNGEIQVDLPEVIISPRLEQVVEKKADPPKVTKQPVINTIKPSEPLENKSKGDRKAQPKSSEAPEVIDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQNMVEPLLVPEGVKPGDRVTVEGFGSNPDEIMNPKKKILETVKPEMKVDENGIATYRGGRWQVNGQVGLIKSTNLKNVPIA 980
            MEELLRKNEEAENMIKLVTSQIEILKKHGVDVSISEDQGNQLKNENKELREKISLLKKELIKTELLNGEIQVDLPEVIISPRLEQVVEKKAD PKVTKQPVINTIKPSEPLENKSKGDRKAQPKSSEAPEVIDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQNMVEPLLVPEGVKPGDRVTVEGFGSNPDEIMNPKKKILETVKPEMKVDENGIATYRGGRWQVNGQVGLIKSTNLKNVPIA
Sbjct:    1 MEELLRKNEEAENMIKLVTSQIEILKKHGVDVSISEDQGNQLKNENKELREKISLLKKELIKTELLNGEIQVDLPEVIISPRLEQVVEKKADAPKVTKQPVINTIKPSEPLENKSKGDRKAQPKSSEAPEVIDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCSESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQNMVEPLLVPEGVKPGDRVTVEGFGSNPDEIMNPKKKILETVKPEMKVDENGIATYRGGRWQVNGQVGLIKSTNLKNVPIA 297          
The following BLAST results are available for this feature:
BLAST of tRNA-binding domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AIMP12.488e-4847.53aminoacyl tRNA synthetase complex interacting mult... [more]
AIMP12.488e-4847.53aminoacyl tRNA synthetase complex interacting mult... [more]
AIMP12.488e-4847.53aminoacyl tRNA synthetase complex interacting mult... [more]
AIMP12.488e-4847.53aminoacyl tRNA synthetase complex interacting mult... [more]
AIMP12.488e-4847.53aminoacyl tRNA synthetase complex interacting mult... [more]
back to top
BLAST of tRNA-binding domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mars-11.502e-4244.19Methionine--tRNA ligase, cytoplasmic [Source:UniP... [more]
mars-12.868e-3944.19Methionine--tRNA ligase, cytoplasmic [Source:UniP... [more]
back to top
BLAST of tRNA-binding domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
AIMP15.015e-4848.47gene:FBgn0033351 transcript:FBtr0088676[more]
TyrRS2.037e-4247.83gene:FBgn0027080 transcript:FBtr0075410[more]
back to top
BLAST of tRNA-binding domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aimp1a1.402e-5150.00aminoacyl tRNA synthetase complex interacting mult... [more]
aimp1b3.689e-4139.51aminoacyl tRNA synthetase complex interacting mult... [more]
yars11.915e-4042.86tyrosyl-tRNA synthetase 1 [Source:NCBI gene;Acc:36... [more]
yars11.915e-4042.86tyrosyl-tRNA synthetase 1 [Source:NCBI gene;Acc:36... [more]
yars11.915e-4042.86tyrosyl-tRNA synthetase 1 [Source:NCBI gene;Acc:36... [more]
back to top
BLAST of tRNA-binding domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
aimp11.825e-4948.17aminoacyl tRNA synthetase complex-interacting mult... [more]
aimp12.465e-4948.17aminoacyl tRNA synthetase complex-interacting mult... [more]
back to top
BLAST of tRNA-binding domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Aimp11.472e-4948.77aminoacyl tRNA synthetase complex-interacting mult... [more]
Aimp13.518e-4948.77aminoacyl tRNA synthetase complex-interacting mult... [more]
Yars1.023e-3944.15tyrosyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of tRNA-binding domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O54873|AIMP1_CRIGR2.839e-5048.00Aminoacyl tRNA synthase complex-interacting multif... [more]
sp|P31230|AIMP1_MOUSE1.030e-4848.77Aminoacyl tRNA synthase complex-interacting multif... [more]
sp|Q12904|AIMP1_HUMAN1.195e-4747.53Aminoacyl tRNA synthase complex-interacting multif... [more]
sp|Q6TGS6|SYYC_DANRE2.189e-3942.86Tyrosine--tRNA ligase, cytoplasmic OS=Danio rerio ... [more]
sp|Q4KM49|SYYC_RAT2.784e-3943.32Tyrosine--tRNA ligase, cytoplasmic OS=Rattus norve... [more]
back to top
BLAST of tRNA-binding domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LX392.561e-6048.21tRNA-binding domain-containing protein OS=Opisthor... [more]
G7YX806.671e-6052.79Methionyl-tRNA synthetase cytoplasmic OS=Clonorchi... [more]
A0A4S2LX376.696e-6050.70tRNA-binding domain-containing protein OS=Opisthor... [more]
A0A3R7FUF91.554e-5950.93Aminoacyl tRNA synthase complex-interacting multif... [more]
A0A074ZSD32.036e-5849.77tRNA-binding domain-containing protein OS=Opisthor... [more]
back to top
BLAST of tRNA-binding domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aimp1a1.108e-5349.70aminoacyl tRNA synthetase complex interacting mult... [more]
aimp1a1.409e-5349.70aminoacyl tRNA synthetase complex interacting mult... [more]
yars12.994e-4146.60tyrosyl-tRNA synthetase 1 [Source:NCBI gene;Acc:10... [more]
aimp1b4.588e-3839.75aminoacyl tRNA synthetase complex interacting mult... [more]
aimp1b9.752e-3839.75aminoacyl tRNA synthetase complex interacting mult... [more]
back to top
BLAST of tRNA-binding domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
aimp1a2.039e-4836.83aminoacyl tRNA synthetase complex interacting mult... [more]
ENSPMAT00000008601.14.464e-1340.45pep scaffold:Pmarinus_7.0:GL490070:605:2099:1 gene... [more]
back to top
BLAST of tRNA-binding domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ARC14.435e-2741.89Protein that binds tRNA and methionyl- and glutamy... [more]
back to top
BLAST of tRNA-binding domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO324307.816e-4542.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO472435.105e-3545.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO277805.581e-1544.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of tRNA-binding domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
aimp1a3.089e-5544.67aminoacyl tRNA synthetase complex interacting mult... [more]
aimp1a3.632e-5349.09aminoacyl tRNA synthetase complex interacting mult... [more]
yars16.444e-3950.35tyrosyl-tRNA synthetase 1 [Source:NCBI gene;Acc:10... [more]
aimp1b1.260e-3037.13aminoacyl tRNA synthase complex-interacting multif... [more]
back to top
BLAST of tRNA-binding domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000033588.10.000e+099.66SMESG000033588.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002776 ID=SMED30002776|Name=tRNA-binding domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1094bp
TATTGTAAGAATAAATTTTATTAGTGACAATGTGTTTAACTACAATCTAT
TTGACGTATTTTAAAAATAATATAATAAAAAGCATTAAAATGGAGGAATT
ATTGAGAAAAAATGAAGAAGCAGAAAATATGATTAAGTTAGTTACATCTC
AAATTGAAATATTGAAGAAACACGGTGTTGATGTATCTATCTCAGAAGAC
CAAGGAAACCAATTAAAGAATGAAAATAAAGAATTACGCGAAAAAATTTC
ACTATTAAAAAAAGAATTAATTAAGACTGAATTATTAAATGGAGAAATTC
AAGTTGACCTTCCTGAAGTTATTATTTCTCCAAGATTAGAACAAGTGGTT
GAAAAAAAAGCGGACCCGCCTAAGGTTACTAAGCAACCAGTTATAAATAC
AATAAAGCCATCAGAACCATTGGAGAACAAGTCTAAAGGAGACCGAAAAG
CCCAACCCAAATCCTCTGAAGCACCTGAAGTTATCGATATTTCAAGATTT
GATATGAGGATTGGAAAGATTTTAGAAGTAACAAAACACGCCGAAGCAGA
CAGCTTATACGTAGAAAAAGTTGATATAGGAGAAGATAAACCTCGTCAAA
TTATTAGTGGACTCGTAAAATATTGCAGTGAATCTGATCTACTAGGTCGT
ATGGCTGTGTTTTTGGTCAATCTTAAGCCTGCTAAGATGCGTGGTATTTT
ATCAGAAGGCATGATTATGTGCGCTTCGGCTCCAGAACAAAATATGGTTG
AACCACTTTTAGTTCCTGAAGGAGTTAAGCCAGGAGATCGAGTAACAGTT
GAAGGTTTCGGTAGCAATCCAGATGAAATTATGAATCCTAAGAAGAAAAT
TTTAGAAACTGTTAAGCCCGAAATGAAGGTTGATGAAAACGGTATTGCTA
CATATCGTGGAGGACGCTGGCAGGTAAATGGCCAAGTCGGGTTAATTAAG
TCTACCAACTTGAAAAATGTACCAATAGCATAAATTTTGTTAGGATTTTG
AATACATGAATGGTTTTGTCTGAATTTTTTATAAATCATAATCTTTTGTA
GCGTCAACTAAAATATAAAGTTTTTGTACTGTTTTATAAAAAAA
back to top

protein sequence of SMED30002776-orf-1

>SMED30002776-orf-1 ID=SMED30002776-orf-1|Name=SMED30002776-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=318bp
MCLTTIYLTYFKNNIIKSIKMEELLRKNEEAENMIKLVTSQIEILKKHGV
DVSISEDQGNQLKNENKELREKISLLKKELIKTELLNGEIQVDLPEVIIS
PRLEQVVEKKADPPKVTKQPVINTIKPSEPLENKSKGDRKAQPKSSEAPE
VIDISRFDMRIGKILEVTKHAEADSLYVEKVDIGEDKPRQIISGLVKYCS
ESDLLGRMAVFLVNLKPAKMRGILSEGMIMCASAPEQNMVEPLLVPEGVK
PGDRVTVEGFGSNPDEIMNPKKKILETVKPEMKVDENGIATYRGGRWQVN
GQVGLIKSTNLKNVPIA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR002547tRNA-bd_dom
IPR012340NA-bd_OB-fold
Vocabulary: molecular function
TermDefinition
GO:0000049tRNA binding
GO:0000166nucleotide binding
GO:0003723RNA binding
GO:0004812aminoacyl-tRNA ligase activity
GO:0004831tyrosine-tRNA ligase activity
GO:0005524ATP binding
GO:0016874ligase activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0017101aminoacyl-tRNA synthetase multienzyme complex
GO:0017102methionyl glutamyl tRNA synthetase complex
Vocabulary: biological process
TermDefinition
GO:0006412translation
GO:0006418tRNA aminoacylation for protein translation
GO:0006437tyrosyl-tRNA aminoacylation
GO:0006974cellular response to DNA damage stimulus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 32..66
NoneNo IPR availableCOILSCoilCoilcoord: 1..28
NoneNo IPR availableGENE3DG3DSA:2.40.50.140coord: 132..297
e-value: 8.7E-56
score: 190.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 98..129
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 111..129
NoneNo IPR availablePANTHERPTHR11586FAMILY NOT NAMEDcoord: 4..296
NoneNo IPR availablePANTHERPTHR11586:SF33AMINOACYL TRNA SYNTHASE COMPLEX-INTERACTING MULTIFUNCTIONAL PROTEIN 1coord: 4..296
NoneNo IPR availableCDDcd02799tRNA_bind_EMAP-II_likecoord: 132..236
e-value: 7.34975E-50
score: 158.546
IPR002547tRNA-binding domainPFAMPF01588tRNA_bindcoord: 139..233
e-value: 2.4E-28
score: 98.1
IPR002547tRNA-binding domainPROSITEPS50886TRBDcoord: 133..236
score: 32.575
IPR012340Nucleic acid-binding, OB-foldSUPERFAMILYSSF50249Nucleic acid-binding proteinscoord: 133..281