Lipase

Overview
NameLipase
Smed IDSMED30002772
Length (bp)1549
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Lipase (SMED30002772) t-SNE clustered cells

Violin plots show distribution of expression levels for Lipase (SMED30002772) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Lipase (SMED30002772) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Lipase (SMED30002772) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002772

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30002772SMESG000044132.1 dd_Smed_v4_11504_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002772SMESG000044132.1 dd_Smed_v4_11504_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Lipase vs. UniProt/SwissProt
Match: sp|P04635|LIP_STAHY (Lipase OS=Staphylococcus hyicus OX=1284 GN=lip PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 6.305e-11
Identity = 59/238 (24.79%), Postives = 103/238 (43.28%), Query Frame = 1
Query:  319 MSSHHDRACEIFAQLSGRLTDFGKEHSEHFSHHRHGRDFSQKKLIQEHWSERNPVNFICHCVGINTVRYLQYLL-----AEDFWKL-----------GTNEKWIKSIVSINGNINGTQFLHFLGIDSVTGLGSXXXXXXXXXXVFNGVLWSLNRLKNLTEFQKQIAVEWNWNHWNVSTK-----TDNWQNQMLTESAIFTNSDNLFYDSTIHGANRLNSIVPPSYPCTYYLSFFAKAT 969
            ++S+H+RA E++  L G   D+G  HSE + H R+G+ +   + + + W   +PV+FI H +G  T+R L++ L     AE  ++            G  +  + SI +I    NGT     +G                       +L+S  ++ +         +++  +HW    K     TD   N+ + ES I+ + D   YD T  GA ++N     + P  YY ++   AT
Sbjct:  312 LASNHERAVELYYYLKGGRVDYGAAHSEKYGHERYGKTY---EGVLKDWKPGHPVHFIGHSMGGQTIRLLEHYLRFGDKAEIAYQQQHGGIISELFKGGQDNMVTSITTIATPHNGTHASDDIG----------------NTPTIRNILYSFAQMSSHLG-----TIDFGMDHWGFKRKDGESLTD--YNKRIAESKIWDSEDTGLYDLTREGAEKINQKTELN-PNIYYKTYTGVAT 522          
BLAST of Lipase vs. UniProt/SwissProt
Match: sp|Q6GDD3|LIP1_STAAR (Lipase 1 OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=lip1 PE=3 SV=2)

HSP 1 Score: 64.3142 bits (155), Expect = 1.729e-9
Identity = 78/320 (24.38%), Postives = 134/320 (41.88%), Query Frame = 1
Query:  325 SHHDRACEIFAQLSGRLTDFGKEHSEHFSHHRHGRDFSQKKLIQEHWSERNPVNFICHCVGINTVRYLQYLLAE------DFWK----------LGTNEKWIKSIVSINGNINGTQFLHFLGIDSVTGLGSXXXXXXXXXXVFN-GVLWSLNRLKNLTEFQKQIAVEWNWNHWNVSTK-TDNWQN--QMLTESAIFTNSDNLFYDSTIHGANRLNSIVPPSYPCTYYLSFFAKAT-KSENSFQISHQLN---PILIAPASYLLHTRFSTGILNSNAYKCVEWWESDGVYPVASQKFPLNCTRHEQIESLNSSAVFNKGCW 1212
            S++DRA E++  + G   D+G  H+  + H R+G+ +   + I + W     V+ + H +G  T+R L+ LL        ++ K           G N+  I SI ++    NGT      G +++             + VF+ G ++            K   V++    W +  K  +++ +  + + +S ++ + DN FYD T  GA  LN     + P   Y ++  +AT K+ NS +    LN   P +I            TG L   A +  EW E+DG+  V S + P N          N++    KG W
Sbjct:  353 SNYDRAVELYYYIKGGRVDYGAAHAAKYGHERYGKTY---EGIYKDWKPGQKVHLVGHSMGGQTIRQLEELLRNGSREEIEYQKKHSGEISPLFKGNNDNMISSITTLGTPHNGTHASDLAGNEALV-----------RQIVFDIGKMFG----------NKNSRVDFGLAQWGLKQKPNESYIDYVKRVKQSNLWKSKDNGFYDLTREGATDLNRKTSLN-PNIVYKTYTGEATHKALNSDRQKADLNMFFPFVI------------TGNLIGKATEK-EWRENDGLVSVISSQHPFNQAY------TNATDKIQKGIW 628          
BLAST of Lipase vs. UniProt/SwissProt
Match: sp|P65289|LIP1_STAAN (Lipase 1 OS=Staphylococcus aureus (strain N315) OX=158879 GN=lip1 PE=3 SV=2)

HSP 1 Score: 63.929 bits (154), Expect = 1.870e-9
Identity = 78/320 (24.38%), Postives = 134/320 (41.88%), Query Frame = 1
Query:  325 SHHDRACEIFAQLSGRLTDFGKEHSEHFSHHRHGRDFSQKKLIQEHWSERNPVNFICHCVGINTVRYLQYLLAE------DFWK----------LGTNEKWIKSIVSINGNINGTQFLHFLGIDSVTGLGSXXXXXXXXXXVFN-GVLWSLNRLKNLTEFQKQIAVEWNWNHWNVSTK-TDNWQN--QMLTESAIFTNSDNLFYDSTIHGANRLNSIVPPSYPCTYYLSFFAKAT-KSENSFQISHQLN---PILIAPASYLLHTRFSTGILNSNAYKCVEWWESDGVYPVASQKFPLNCTRHEQIESLNSSAVFNKGCW 1212
            S++DRA E++  + G   D+G  H+  + H R+G+ +   + I + W     V+ + H +G  T+R L+ LL        ++ K           G N+  I SI ++    NGT      G +++             + VF+ G ++            K   V++    W +  K  +++ +  + + +S ++ + DN FYD T  GA  LN     + P   Y ++  +AT K+ NS +    LN   P +I            TG L   A +  EW E+DG+  V S + P N          N++    KG W
Sbjct:  353 SNYDRAVELYYYIKGGRVDYGAAHAAKYGHERYGKTY---EGIYKDWKPGQKVHLVGHSMGGQTIRQLEELLRNGNREEIEYQKKHGGEISPLFKGNNDNMISSITTLGTPHNGTHASDLAGNEALV-----------RQIVFDIGKMFG----------NKNSRVDFGLAQWGLKQKPNESYIDYVKRVKQSNLWKSKDNGFYDLTREGATDLNRKTSLN-PNIVYKTYTGEATHKALNSDRQKADLNMFFPFVI------------TGNLIGKATEK-EWRENDGLVSVISSQHPFNQAY------TNATDKIQKGIW 628          
BLAST of Lipase vs. UniProt/SwissProt
Match: sp|P65288|LIP1_STAAM (Lipase 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=lip1 PE=3 SV=2)

HSP 1 Score: 63.929 bits (154), Expect = 1.870e-9
Identity = 78/320 (24.38%), Postives = 134/320 (41.88%), Query Frame = 1
Query:  325 SHHDRACEIFAQLSGRLTDFGKEHSEHFSHHRHGRDFSQKKLIQEHWSERNPVNFICHCVGINTVRYLQYLLAE------DFWK----------LGTNEKWIKSIVSINGNINGTQFLHFLGIDSVTGLGSXXXXXXXXXXVFN-GVLWSLNRLKNLTEFQKQIAVEWNWNHWNVSTK-TDNWQN--QMLTESAIFTNSDNLFYDSTIHGANRLNSIVPPSYPCTYYLSFFAKAT-KSENSFQISHQLN---PILIAPASYLLHTRFSTGILNSNAYKCVEWWESDGVYPVASQKFPLNCTRHEQIESLNSSAVFNKGCW 1212
            S++DRA E++  + G   D+G  H+  + H R+G+ +   + I + W     V+ + H +G  T+R L+ LL        ++ K           G N+  I SI ++    NGT      G +++             + VF+ G ++            K   V++    W +  K  +++ +  + + +S ++ + DN FYD T  GA  LN     + P   Y ++  +AT K+ NS +    LN   P +I            TG L   A +  EW E+DG+  V S + P N          N++    KG W
Sbjct:  353 SNYDRAVELYYYIKGGRVDYGAAHAAKYGHERYGKTY---EGIYKDWKPGQKVHLVGHSMGGQTIRQLEELLRNGNREEIEYQKKHGGEISPLFKGNNDNMISSITTLGTPHNGTHASDLAGNEALV-----------RQIVFDIGKMFG----------NKNSRVDFGLAQWGLKQKPNESYIDYVKRVKQSNLWKSKDNGFYDLTREGATDLNRKTSLN-PNIVYKTYTGEATHKALNSDRQKADLNMFFPFVI------------TGNLIGKATEK-EWRENDGLVSVISSQHPFNQAY------TNATDKIQKGIW 628          
BLAST of Lipase vs. UniProt/SwissProt
Match: sp|Q5U780|LIP_BACSP (Lipase OS=Bacillus sp. OX=1409 PE=1 SV=3)

HSP 1 Score: 62.3882 bits (150), Expect = 4.604e-9
Identity = 76/277 (27.44%), Postives = 122/277 (44.04%), Query Frame = 1
Query:  193 FVLTPGLPGWG---LMDYSYWDTLTFD-DHWTKELDVKFILVEPGPMSSHHDRACEIFAQLSGRLTDFGKEHSEHFSHHRHGRDFSQKKLIQEHWSERNPVNFICHCVGINTVRYLQYLLAEDFWKLGTNE--KWIKS-IVSINGNINGTQFLHFLGIDSVTGLGSXXXXXXXXXXV-FNGVLWSLNR-------LKNLTEFQKQIAVEWNWNHWNVSTKTDNWQN---QMLTESAIFTNSDNLFYDSTIHGANRLNSIVPPSYPCTYYLSFFAKAT 969
             VL  G  GWG   +  + YW  +  D + W  +   +   +  GP+SS+ DRACE +AQL G   D+G  H+    H R GR +    L+ E       ++ I H  G  T R L  LL       G+ E  ++ K+  VS++    G    HF  + SVT + +          V F    + L +       + +   +  Q+  ++  + W +  +     +   + L  S ++T++D   YD ++ GA +LN  V  S P TYYLSF  + T
Sbjct:   38 IVLLHGFTGWGREEMFGFKYWGGVRGDIEQWLNDNGYRTYTLAVGPLSSNWDRACEAYAQLVGGTVDYGAAHAAKHGHARFGRTY--PGLLPE-LKRGGRIHIIAHSQGGQTARMLVSLLEN-----GSQEEREYAKAHNVSLSPLFEGGH--HF--VLSVTTIATPHDGTTLVNMVDFTDRFFDLQKAVLEAAAVASNVPYTSQV-YDFKLDQWGLRRQPGESFDHYFERLKRSPVWTSTDTARYDLSVSGAEKLNQWVQAS-PNTYYLSFSTERT 300          
BLAST of Lipase vs. TrEMBL
Match: A0A183LJ77 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS3852 PE=4 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 3.047e-48
Identity = 147/476 (30.88%), Postives = 215/476 (45.17%), Query Frame = 1
Query:  181 DKKIFVLTPGLPGWGLMDYSYWDTLTFDDHWTKELDVKFILVEPGPMSSHHDRACEIFAQLSGRLTDFGKEHSEHFSHHRHGRDFSQKKLIQEHWSERNPVNFICHCVGINTVRYLQYLLAEDFWKLGTNEKWIKSIVSINGNIN--------GTQFLHFLG----IDSVTGLGSXX----XXXXXXXXVFNGVLWSLNRLKNLTEFQKQIAVEWNWNHWNVSTKTDNWQ--------NQMLT--ESAIFTNSDNLFYDSTIHGANRLNSIVPPS--------------YPCTYYLSFFAKATKSENSFQISHQLNPILIAPASYLL----------HTRFSTGILNSNAYKCVEWWESDGVYPVASQKFPLNC-------TRHEQIESLNSSAVFNKGCWYYGNIQKIIG------------------CHCVV---------DHFSMIWCRKFLKSESFQLSENDQKEFYYNLIA 1356
            DK   +L PGLPGWGL D  YW++      +   L V    V+P P++SHHDRACEIFAQ++G L D+G  HS+ F H R G+D+S+   +   W   NPV+ +CH   INT R LQ LL  DFW  GT+ KWI SI SING +N          + L  +      +    LG       K+ KA K +  GV+W+      L   Q   A+ W+ +HW VS   D+ Q        N++ +  +  +F++ DN+ YD T  G  +L  I+  S              Y  T+YLS F+ AT S ++  I  +++PIL   ++ LL          HT+ +   +   +       ++DG+  V +Q  P           + E + SL+ S     G WY  N+ + I                     C+          DHF   W R  LKS   Q+  + Q+  Y N+ +
Sbjct:    2 DKGKVILIPGLPGWGLTD-GYWESALDSSIFPTNLSVSS--VDPSPIASHHDRACEIFAQITGTLVDYGSGHSQIFGHSRWGKDYSKIPPLYLEWGASNPVHLVCHSTAINTARVLQRLLEIDFWNKGTSAKWILSITSINGALNECALSDVINKEILRLINGKFLCNECKNLGCPVCIHIKVQKAAKILSRGVIWAAMSKLKLDSEQLSRALNWSIDHW-VSDTGDSLQFLSAEEVVNKLNSSLKCGMFSSGDNIIYDQTPEGILKLQEILHNSSNTKGSLKRVPDFIYNDTFYLSLFSSATMS-STLYIPSEMSPILWPFSAILLDKTNDNCLDDHTKEAIHKIQKISTDVDPLRDNDGLVTVINQCIPRGAESFVEVFPKQECLLSLHES--IKPGVWYIDNVNRWIDGIQKNESHLDVDCENTSKTSCISNKRTFKFLWDHFDACWSRTLLKSSQEQVPLDFQRSLYRNVFS 470          
BLAST of Lipase vs. TrEMBL
Match: A0A4Z2D9L7 (Lipase 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_003154 PE=4 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 3.477e-48
Identity = 141/478 (29.50%), Postives = 217/478 (45.40%), Query Frame = 1
Query:  184 KKIFVLTPGLPGWGLMDYSYWDTLTFDDHWTKELDVKFILVEPGPMSSHHDRACEIFAQLSGRLTDFGKEHSEHFSHHRHGRDFSQKKLIQEHWSERNPVNFICHCVGINTVRYLQYLLAEDFWKLGTNEKWIKSIVSINGNIN--------GTQFLHFLG----IDSVTGLGSXX----XXXXXXXXVFNGVLWSLNRLKNLTEFQKQIAVEWNWNHWNVSTKTDNWQ--NQMLTES------------AIFTNSDNLFYDSTIHGANRLNSIV-PPS-------------YPCTYYLSFFAKATKSENSFQISHQLNPILIAPASYLLHTRFSTGILNSNAYKCVE-----------WWESDGVYPVASQKFPLNC-------TRHEQIESLNSSAVFNKGCWYYGNIQK------------------IIGCHCVV---------DHFSMIWCRKFLKSESFQLSENDQKEFYYNL 1350
            K I +L PGLPGWGL D  YW++   +  +   L V  + V+P P++SHHDRACEIFA+++G L D+G EHS+ F H R G+D+S    +   W   NP++ +CH   +NT R LQ LL ++FW   T+ KWI SI SING +N          + LH +           LG       K+ KA K +   V+W+      L   Q++ A+ W  + W V    ++    +Q L++              IF++ DN+ YD T  G ++L  ++  PS             +  T+YL  F+ AT S  S  I  +++PIL  P S +L  + +   L+ +  K ++             ++DG+  V +Q  P           +HE  + LN   +   G WY  N+ +                  +   +C+          DHF   W R  LKS   Q+S + Q+  Y N+
Sbjct:    3 KGIVILVPGLPGWGLTD-GYWESALDNSIFPANLCV--LTVKPSPIASHHDRACEIFAEITGTLVDYGIEHSQTFKHSRWGKDYSNIPPLYSEWGTSNPIHLVCHSTAVNTARVLQRLLEDNFWNKETSSKWILSITSINGALNECAVSDVINKEILHLISRKFVCKECNNLGCSSCIHIKIQKAAKMLSRSVIWAAISKLKLNSEQRRQALNWPVDQWIVDNNNNDNNGVSQCLSDEEVVSKLNSSLKCGIFSSGDNIIYDQTFDGISKLEEVLNKPSNTNGSLKDVPNFIHNGTFYLCLFSSATISSTS-HIPSEMSPIL-WPFSAILLDKTNESCLDDHTKKIIQKIQTVSSNVDPLRDNDGLVTVVNQCVPRGVGPAFEVFPKHESFQLLN--KIVKPGIWYIDNVNRWIDGIQNIESHQDFVCENVSKINCISNKQKPNFLWDHFDACWSRTLLKSSQDQVSLDFQRSLYRNI 473          
BLAST of Lipase vs. TrEMBL
Match: A0A095AQ32 (Lipase 1 OS=Schistosoma haematobium OX=6185 GN=MS3_04707 PE=4 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 6.124e-48
Identity = 146/476 (30.67%), Postives = 215/476 (45.17%), Query Frame = 1
Query:  181 DKKIFVLTPGLPGWGLMDYSYWDTLTFDDHWTKELDVKFILVEPGPMSSHHDRACEIFAQLSGRLTDFGKEHSEHFSHHRHGRDFSQKKLIQEHWSERNPVNFICHCVGINTVRYLQYLLAEDFWKLGTNEKWIKSIVSINGNIN--------GTQFLHFLG----IDSVTGLGSXX----XXXXXXXXVFNGVLWSLNRLKNLTEFQKQIAVEWNWNHWNVSTKTDNWQ--------NQMLT--ESAIFTNSDNLFYDSTIHGANRLNSIVPPS--------------YPCTYYLSFFAKATKSENSFQISHQLNPILIAPASYLL----------HTRFSTGILNSNAYKCVEWWESDGVYPVASQKFPLNC-------TRHEQIESLNSSAVFNKGCWYYGNIQKIIG------------------CHCVV---------DHFSMIWCRKFLKSESFQLSENDQKEFYYNLIA 1356
            DK   +L PGLPGWGL D  YW++      +   L V    V+P P++SHHDRACEIFAQ++G L D+G  HS+ F H R G+D+S+   +   W   NPV+ +CH   INT R LQ LL  DFW  GT+ KWI SI SING +N          + L  +           LG       K+ KA K +  GV+W+      L   Q   A+ W+ +HW VS  +++ Q        N++ +  +  +F++ DN+ YD T  G  +L  I+  S              Y  T+YLS F+ AT S ++  I  +++PIL   ++ LL          HT+ +   +   +       ++DG+  V +Q  P           + E + SL+ S     G WY  N+ + I                     C+          DHF   W R  LKS   Q+  + Q+  Y N+ +
Sbjct:    2 DKGKVILIPGLPGWGLTD-GYWESALDSSIFPTSLSVSS--VDPSPIASHHDRACEIFAQITGTLVDYGSGHSQFFGHSRWGKDYSKIPPVYLEWGPSNPVHLVCHSTAINTARVLQRLLEIDFWNKGTSAKWILSITSINGALNECALSDVINKEILRLINGKFLCKECKNLGCSACIHIKVQKAAKILRRGVIWAAMSKLKLDSEQLNRALNWSIDHW-VSDTSNSLQFLSGEEVLNKLNSSLKCGMFSSGDNIIYDQTPEGILKLQEILHNSSNIKGSLKCVPDFIYNDTFYLSLFSSATMS-STLYIPSEMSPILWPFSASLLDKTNDNCLDDHTKEAIYKIQKISTDVDPLRDNDGLVTVINQCIPRGAESFVEVFPKQECLLSLHES--IKPGVWYIDNVNRWIDGIQKNESHLDVDCENTSKTSCISNKRRFKFLWDHFDACWSRTLLKSSQEQVPIDFQRSLYRNVFS 470          
BLAST of Lipase vs. TrEMBL
Match: A0A183PCP8 (Uncharacterized protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS12134 PE=4 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 1.336e-47
Identity = 143/471 (30.36%), Postives = 214/471 (45.44%), Query Frame = 1
Query:  196 VLTPGLPGWGLMDYSYWDTLTFDDHWTKELDVKFILVEPGPMSSHHDRACEIFAQLSGRLTDFGKEHSEHFSHHRHGRDFSQKKLIQEHWSERNPVNFICHCVGINTVRYLQYLLAEDFWKLGTNEKWIKSIVSINGNIN--------GTQFLHFLG----IDSVTGLGSXX----XXXXXXXXVFNGVLWSLNRLKNLTEFQKQIAVEWNWNHWNVSTKTDNWQ----NQMLT------ESAIFTNSDNLFYDSTIHGANRLNSIVPPS--------------YPCTYYLSFFAKATKSENSFQISHQLNPILIAPASYLL----------HTRFSTGILNSNAYKCVEWWESDGVYPVASQKFPLNC-------TRHEQIESLNSSAVFNKGCWYYGNIQKIIG------------------CHCVV---------DHFSMIWCRKFLKSESFQLSENDQKEFYYNLIA 1356
            +L PGLPGWGL D  YW++    D     +++    V+P P++SHHDRACEIFAQ++G L D+G EHS+ F H R G+D+S+   +   W   NP++ +CH   INT R LQ LL  +FW  GT+ KWI SI SING +N          + L  +           LG       K+ KA K +  GV+W+      L   Q   A+ W+ +HW VS  +D+ Q     ++L       +  +F++ DN+ YD T  G  +L  I+  S              Y  T+YLS F+ AT S ++  I  +++PIL   ++ LL          HT+ +   +   +       ++DG+  V +Q  P           + E + SL+ S     G WY  N+ + I                     C+          DHF   W R  LKS   Q+  + Q+  Y N+ +
Sbjct:    7 ILIPGLPGWGLTD-GYWESAL--DSSIFPINLSVSSVDPSPIASHHDRACEIFAQITGTLVDYGSEHSQFFGHSRWGKDYSKIPPLYLEWGPSNPIHLVCHSTAINTARVLQRLLEINFWNKGTSAKWILSITSINGALNECALSDVINKEILRLINGKFLCKECKNLGCSACIHIKVQKAAKILRRGVVWAAMSKLKLDSEQLSRALNWSIDHW-VSDTSDSLQFLSEKEVLNKLNSSLKCGMFSSGDNIIYDQTPEGILKLQEILHNSSNIKGSLKRVPDFVYNDTFYLSLFSSATMS-STLYIPSEMSPILWPFSAILLDKTNDNCLDDHTKEAIHKIQKISTDVNPLRDNDGLVTVINQCIPRGAESFVEVFPKQECLLSLHES--IKPGVWYIDNVSRWIDGIQKNESHLDVDCENTSKTSCISNKRKFTFLWDHFDACWSRTLLKSSQEQVPLDFQRSLYRNVFS 470          
BLAST of Lipase vs. TrEMBL
Match: A0A183L4Q5 (Uncharacterized protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS22317 PE=4 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 3.193e-47
Identity = 145/476 (30.46%), Postives = 214/476 (44.96%), Query Frame = 1
Query:  181 DKKIFVLTPGLPGWGLMDYSYWDTLTFDDHWTKELDVKFILVEPGPMSSHHDRACEIFAQLSGRLTDFGKEHSEHFSHHRHGRDFSQKKLIQEHWSERNPVNFICHCVGINTVRYLQYLLAEDFWKLGTNEKWIKSIVSINGNIN--------GTQFLHFLG----IDSVTGLGSXX----XXXXXXXXVFNGVLWSLNRLKNLTEFQKQIAVEWNWNHWNVSTKTDNWQ--------NQM--LTESAIFTNSDNLFYDSTIHGANRLNSIVPPS--------------YPCTYYLSFFAKATKSENSFQISHQLNPILIAPASYLL----------HTRFSTGILNSNAYKCVEWWESDGVYPVASQKFPLNC-------TRHEQIESLNSSAVFNKGCWYYGNIQKIIG------------------CHCVV---------DHFSMIWCRKFLKSESFQLSENDQKEFYYNLIA 1356
            DK   +L PGLPGWGL D  YW++      +   L V    V+P P++SHHDRACEIFAQ++  L D+G  HS+ F H R G+D+S+   +   W   NPV+ +CH   INT R LQ LL  DFW  GT+ KWI SI SING +N          + L  +           LG       K+ KA K +  GV+W+      L   Q   A+ W+ +HW VS  +++ Q        N++  + +  +F++ DN+ YD T  G  +L  I+  S              Y  T+YLS F+ AT S ++  I  +++PIL   ++ LL          HT+ +   +   +       ++DG+  V +Q  P           + E + SL+ S     G WY  N+ + I                     C+          DHF   W R  LKS   Q+  + Q+  Y N+ +
Sbjct:    2 DKGKVILIPGLPGWGLTD-GYWESALDSSIFPTNLSVSS--VDPSPIASHHDRACEIFAQITSTLVDYGSGHSQFFGHSRWGKDYSKIPPLYLEWGPSNPVHLVCHSTAINTARVLQRLLEIDFWNKGTSAKWILSITSINGALNECALSDVINKEILRLINGKFLCKECKNLGCSACIHIKIQKAAKILRRGVIWAAMSKLKLDSEQLNRALNWSIDHW-VSDTSNSLQFLSGEEVLNKLNSILKCGMFSSGDNIIYDQTPEGILKLQEILHNSSNIKGSLKRVPDFIYNDTFYLSLFSSATMS-STLYIPSEMSPILWPFSAILLDKTNDNCLDDHTKEAIYKIQKISTNVDPLRDNDGLVTVINQCIPRGAESFVEVFPKQECLLSLHES--IKPGVWYIDNVNRWIDGIQKNESHLDVDCENTSKTSCISNKRRFKFLWDHFDACWSRTLLKSSQEQVPIDFQRSLYRNVFS 470          
BLAST of Lipase vs. Planmine SMEST
Match: SMESG000044132.1 (SMESG000044132.1)

HSP 1 Score: 817.379 bits (2110), Expect = 0.000e+0
Identity = 401/406 (98.77%), Postives = 403/406 (99.26%), Query Frame = 1
Query:  157 MTDFQEFSDKKIFVLTPGLPGWGLMDYSYWDTLTFDDHWTKELDVKFILVEPGPMSSHHDRACEIFAQLSGRLTDFGKEHSEHFSHHRHGRDFSQKKLIQEHWSERNPVNFICHCVGINTVRYLQYLLAEDFWKLGTNEKWIKSIVSINGNINGTQFLHFLGIDSVTGLGSXXXXXXXXXXVFNGVLWSLNRLKNLTEFQKQIAVEWNWNHWNVSTKTDNWQNQMLTESAIFTNSDNLFYDSTIHGANRLNSIVPPSYPCTYYLSFFAKATKSENSFQISHQLNPILIAPASYLLHTRFSTGILNSNAYKCVEWWESDGVYPVASQKFPLNCTRHEQIESLNSSAVFNKGCWYYGNIQKIIGCHCVVDHFSMIWCRKFLKSESFQLSENDQKEFYYNLIANLIAFD 1374
            MTDF+EFSDKKIFVLTPGLPGWGLMDYSYWDTLTFDDHWTKELDVKFILVEPGPMSSHHDRACEIFAQLSGRLTDFGKEHSEHFSHHRHGRDFS KKLIQEHWSERNPVNFICHCVGINTVRYLQYLLAEDFWKLGTNEKWIKSIVSINGNINGTQFLHFLGIDSVTGLGSKKKL KATKKVFNGVLWSLNRLKNLTEFQKQIAVEWNWNHWNVSTKTDNWQNQMLTESAIFTNSDNLFYDSTIHGANRLNSIVPPSYPCTYYLSFFAKATKSENSFQISHQLNPILIAPASYLLHTRFSTGILNSNAYKCVEWWESDGVYPVASQKFPLNCTRHEQIESLNSSA FNKGCWYYGNIQKIIGCHCVVDHFSMIWCRKFLKSESFQLSEN+QKEFYYNLIANLIAFD
Sbjct:    1 MTDFKEFSDKKIFVLTPGLPGWGLMDYSYWDTLTFDDHWTKELDVKFILVEPGPMSSHHDRACEIFAQLSGRLTDFGKEHSEHFSHHRHGRDFSHKKLIQEHWSERNPVNFICHCVGINTVRYLQYLLAEDFWKLGTNEKWIKSIVSINGNINGTQFLHFLGIDSVTGLGSKKKLCKATKKVFNGVLWSLNRLKNLTEFQKQIAVEWNWNHWNVSTKTDNWQNQMLTESAIFTNSDNLFYDSTIHGANRLNSIVPPSYPCTYYLSFFAKATKSENSFQISHQLNPILIAPASYLLHTRFSTGILNSNAYKCVEWWESDGVYPVASQKFPLNCTRHEQIESLNSSAAFNKGCWYYGNIQKIIGCHCVVDHFSMIWCRKFLKSESFQLSENNQKEFYYNLIANLIAFD 406          
The following BLAST results are available for this feature:
BLAST of Lipase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lipase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lipase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lipase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lipase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lipase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lipase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P04635|LIP_STAHY6.305e-1124.79Lipase OS=Staphylococcus hyicus OX=1284 GN=lip PE=... [more]
sp|Q6GDD3|LIP1_STAAR1.729e-924.38Lipase 1 OS=Staphylococcus aureus (strain MRSA252)... [more]
sp|P65289|LIP1_STAAN1.870e-924.38Lipase 1 OS=Staphylococcus aureus (strain N315) OX... [more]
sp|P65288|LIP1_STAAM1.870e-924.38Lipase 1 OS=Staphylococcus aureus (strain Mu50 / A... [more]
sp|Q5U780|LIP_BACSP4.604e-927.44Lipase OS=Bacillus sp. OX=1409 PE=1 SV=3[more]
back to top
BLAST of Lipase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183LJ773.047e-4830.88Uncharacterized protein OS=Schistosoma margrebowie... [more]
A0A4Z2D9L73.477e-4829.50Lipase 2 OS=Schistosoma japonicum OX=6182 GN=EWB00... [more]
A0A095AQ326.124e-4830.67Lipase 1 OS=Schistosoma haematobium OX=6185 GN=MS3... [more]
A0A183PCP81.336e-4730.36Uncharacterized protein OS=Schistosoma mattheei OX... [more]
A0A183L4Q53.193e-4730.46Uncharacterized protein OS=Schistosoma curassoni O... [more]
back to top
BLAST of Lipase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lipase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lipase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lipase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lipase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lipase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000044132.10.000e+098.77SMESG000044132.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002772 ID=SMED30002772|Name=Lipase|organism=Schmidtea mediterranea sexual|type=transcript|length=1549bp
ACAAATGACCTTCAGACTTATTTACACAATAACAAAACTGTGGTAATCAA
TTATCGTGTTATTTTTCGTGTGCACAGAGTTTATTGGCTACATTTGTTTA
ATTAAACAATCGTGAAGAAATTATTGATTTATTATATTCTATTGATTATT
GTATTTATGACTGATTTTCAAGAATTTAGTGATAAGAAAATATTTGTCTT
GACTCCTGGTCTTCCCGGTTGGGGATTGATGGATTATTCTTATTGGGATA
CTCTTACGTTTGATGATCATTGGACAAAAGAATTGGACGTCAAATTTATT
TTAGTCGAGCCCGGACCAATGAGCTCTCACCATGATCGCGCTTGTGAAAT
CTTTGCTCAATTGAGTGGGAGATTAACTGATTTTGGGAAAGAGCATTCAG
AACATTTCTCCCATCACCGACACGGAAGAGATTTCAGTCAAAAGAAATTA
ATACAAGAGCACTGGTCAGAAAGAAATCCAGTAAATTTCATATGCCACTG
CGTTGGCATAAATACAGTCAGATATTTGCAATATCTATTAGCAGAGGATT
TCTGGAAATTAGGAACCAATGAAAAATGGATAAAATCTATTGTCAGCATC
AATGGAAATATCAACGGGACTCAATTTCTACATTTTCTCGGAATCGATTC
AGTGACAGGGCTTGGTTCGAAGAAAAAGTTGTTTAAGGCCACTAAAAAAG
TGTTCAATGGAGTTTTGTGGTCCCTAAACCGATTAAAGAATTTGACAGAA
TTCCAAAAGCAAATTGCTGTTGAATGGAACTGGAATCACTGGAACGTTTC
AACTAAAACTGACAACTGGCAAAATCAAATGCTTACGGAATCGGCGATAT
TTACGAATTCAGATAACTTATTTTACGACTCTACTATTCACGGAGCGAAT
CGTTTGAATTCAATAGTGCCGCCCAGTTACCCTTGCACTTATTATTTATC
ATTTTTTGCAAAGGCCACCAAAAGCGAGAATTCTTTTCAAATTTCTCACC
AGCTCAATCCAATATTGATTGCACCGGCTTCCTATTTGTTGCACACTCGG
TTTTCAACGGGAATTTTAAATTCAAATGCCTACAAATGTGTCGAATGGTG
GGAAAGCGACGGAGTGTATCCCGTAGCTTCTCAAAAGTTTCCATTAAATT
GCACTAGACACGAGCAAATCGAATCACTGAACTCTTCGGCGGTTTTTAAT
AAAGGCTGTTGGTATTATGGCAACATACAGAAAATTATAGGCTGCCATTG
TGTTGTTGATCATTTCAGTATGATTTGGTGCAGAAAATTCTTAAAATCGG
AATCTTTCCAATTGTCAGAAAACGATCAAAAAGAATTTTATTACAATCTA
ATAGCGAATTTGATCGCTTTCGATTAAATGCAATTTTATATTTTAATAAA
AAATTTCTAAATCTATGTAAATCAGTTTTTTTCATAACCAATGCCCTTCA
ATTGCCGCAATCGCAGCCTTCTGGGATTGGTCAAAAAAAATGTTTTCGCT
TTGTGATCAATTTTACAAAACCTATAGCTGTTTGGCGTTTCAAATTAAA
back to top

protein sequence of SMED30002772-orf-1

>SMED30002772-orf-1 ID=SMED30002772-orf-1|Name=SMED30002772-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=407bp
MTDFQEFSDKKIFVLTPGLPGWGLMDYSYWDTLTFDDHWTKELDVKFILV
EPGPMSSHHDRACEIFAQLSGRLTDFGKEHSEHFSHHRHGRDFSQKKLIQ
EHWSERNPVNFICHCVGINTVRYLQYLLAEDFWKLGTNEKWIKSIVSING
NINGTQFLHFLGIDSVTGLGSKKKLFKATKKVFNGVLWSLNRLKNLTEFQ
KQIAVEWNWNHWNVSTKTDNWQNQMLTESAIFTNSDNLFYDSTIHGANRL
NSIVPPSYPCTYYLSFFAKATKSENSFQISHQLNPILIAPASYLLHTRFS
TGILNSNAYKCVEWWESDGVYPVASQKFPLNCTRHEQIESLNSSAVFNKG
CWYYGNIQKIIGCHCVVDHFSMIWCRKFLKSESFQLSENDQKEFYYNLIA
NLIAFD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
Vocabulary: INTERPRO
TermDefinition
IPR029058AB_hydrolase
Vocabulary: molecular function
TermDefinition
GO:0004806triglyceride lipase activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0006629lipid metabolic process
GO:0016042lipid catabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029058Alpha/Beta hydrolase foldGENE3DG3DSA:3.40.50.1820coord: 8..405
e-value: 7.9E-70
score: 237.9
IPR029058Alpha/Beta hydrolase foldSUPERFAMILYSSF53474alpha/beta-Hydrolasescoord: 9..374
NoneNo IPR availablePANTHERPTHR34043FAMILY NOT NAMEDcoord: 12..364