Endoplasmic reticulum resident protein 29

Overview
NameEndoplasmic reticulum resident protein 29
Smed IDSMED30002766
Length (bp)980
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Endoplasmic reticulum resident protein 29 (SMED30002766) t-SNE clustered cells

Violin plots show distribution of expression levels for Endoplasmic reticulum resident protein 29 (SMED30002766) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Endoplasmic reticulum resident protein 29 (SMED30002766) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Endoplasmic reticulum resident protein 29 (SMED30002766) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002766

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30002766SMESG000060467.1 dd_Smed_v4_1502_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002766SMESG000060467.1 dd_Smed_v6_1502_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Endoplasmic reticulum resident protein 29 vs. Ensembl Human
Match: ERP29 (endoplasmic reticulum protein 29 [Source:HGNC Symbol;Acc:HGNC:13799])

HSP 1 Score: 156.762 bits (395), Expect = 1.941e-45
Identity = 91/235 (38.72%), Postives = 141/235 (60.00%), Query Frame = 3
Query:  129 CSLTINGSISIHSLIFEKVIQAFDHVLVKFDEPFPYGEKEDVFKEISQVTISISNLITATVGIADYGEKENADLGDRYKITKSDFPAYRLF-NRDLDHPVAYKGEIKVDAIKSFIVEQTGAYIGLNGCLEEFDQIAKEFVNGDA-EVKDKIISLMTNKVKDLKSDKIKHASAEKYLKIATKIRGNGVEFVKTERERLRKLSDGN-VSDNKKLEIKMRLNILHSFQSGAANEKMEL 824
              L   G++ + ++ F KVI     VLVKFD  +PYGEK+D FK +++ + S  +L+ A VGI+DYG+K N +L ++YK+ K  +P + LF + D ++PV Y G +KV AI+ ++  Q G Y+G+ GCL  +D +A EF+     E +  ++    + +  +K  + K   AE+YLKI  KI   G +F  +E  R+ +L + N +SD KK E++  LNIL +FQ   A EK EL
Sbjct:   31 SGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQ-GVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKW--AEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQKKGA-EKEEL 261          
BLAST of Endoplasmic reticulum resident protein 29 vs. Ensembl Human
Match: ERP29 (endoplasmic reticulum protein 29 [Source:HGNC Symbol;Acc:HGNC:13799])

HSP 1 Score: 96.2857 bits (238), Expect = 1.654e-23
Identity = 60/163 (36.81%), Postives = 95/163 (58.28%), Query Frame = 3
Query:  345 DLGDRYKITKSDFPAYRLF-NRDLDHPVAYKGEIKVDAIKSFIVEQTGAYIGLNGCLEEFDQIAKEFVNGDA-EVKDKIISLMTNKVKDLKSDKIKHASAEKYLKIATKIRGNGVEFVKTERERLRKLSDGN-VSDNKKLEIKMRLNILHSFQSGAANEKMEL 824
            +L ++YK+ K  +P + LF + D ++PV Y G +KV AI+ ++  Q G Y+G+ GCL  +D +A EF+     E +  ++    + +  +K  + K A  E+YLKI  KI   G +F  +E  R+ +L + N +SD KK E++  LNIL +FQ   A EK EL
Sbjct:    2 ELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQ-GVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWA--EQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQKKGA-EKEEL 160          
BLAST of Endoplasmic reticulum resident protein 29 vs. Ensembl Fly
Match: wbl (gene:FBgn0004003 transcript:FBtr0340470)

HSP 1 Score: 142.895 bits (359), Expect = 1.780e-40
Identity = 93/256 (36.33%), Postives = 142/256 (55.47%), Query Frame = 3
Query:   81 LLIVNIFFLTNFKNCVCSLTINGSISIHSLIFEKVIQAFDHVLVKFDEPFPYGEKEDVFKEISQ-VTISISNLITATVGIADYGEKENADLGDRYKITKSDFPAYRLFNRDLDHPVAYKGEIKV--DAIKSFIVEQTGAYIGLNGCLEEFDQIAKEFVN-GDAEVKDKIISLMTNKVKDLKSDKIKHASAEKYLKIATKIRGNGVEFVKTERERLRKLSDGNVSDNKKLEIKMRLNILHSFQ----SGAANEKMEL 824
            LL+V I  +       C+    G + +  L FEK ++ F + +VKFD  +PYGEK + F   S+    +  +L+ ATVG+ DYGE EN  LGDRYK+   +FP+  LF  + D  V     + V  D +K+F+   T  YIG +GC++EF+++ K + N  DAE + K+I  +  K + L +D  +  +A  YL    KI   G +F++ E +RL +L  G V++ KK E+  +LNIL  F+    +  A EK EL
Sbjct:    8 LLLVAIHSIPTTWAVTCT----GCVDLDELSFEKTVERFPYSVVKFDIAYPYGEKHEAFTAFSKSAHKATKDLLIATVGVKDYGELENKALGDRYKVDDKNFPSIFLFKGNADEYVQLPSHVDVTLDNLKAFVSANTPLYIGRDGCIKEFNEVLKNYANIPDAE-QLKLIEKLQAKQEQL-TDPEQQQNARAYLIYMRKIHEVGYDFLEEETKRLLRLKAGKVTEAKKEELLRKLNILEVFRVHKVTKTAPEKEEL 257          
BLAST of Endoplasmic reticulum resident protein 29 vs. Ensembl Fly
Match: wbl (gene:FBgn0004003 transcript:FBtr0086510)

HSP 1 Score: 142.895 bits (359), Expect = 1.780e-40
Identity = 93/256 (36.33%), Postives = 142/256 (55.47%), Query Frame = 3
Query:   81 LLIVNIFFLTNFKNCVCSLTINGSISIHSLIFEKVIQAFDHVLVKFDEPFPYGEKEDVFKEISQ-VTISISNLITATVGIADYGEKENADLGDRYKITKSDFPAYRLFNRDLDHPVAYKGEIKV--DAIKSFIVEQTGAYIGLNGCLEEFDQIAKEFVN-GDAEVKDKIISLMTNKVKDLKSDKIKHASAEKYLKIATKIRGNGVEFVKTERERLRKLSDGNVSDNKKLEIKMRLNILHSFQ----SGAANEKMEL 824
            LL+V I  +       C+    G + +  L FEK ++ F + +VKFD  +PYGEK + F   S+    +  +L+ ATVG+ DYGE EN  LGDRYK+   +FP+  LF  + D  V     + V  D +K+F+   T  YIG +GC++EF+++ K + N  DAE + K+I  +  K + L +D  +  +A  YL    KI   G +F++ E +RL +L  G V++ KK E+  +LNIL  F+    +  A EK EL
Sbjct:    8 LLLVAIHSIPTTWAVTCT----GCVDLDELSFEKTVERFPYSVVKFDIAYPYGEKHEAFTAFSKSAHKATKDLLIATVGVKDYGELENKALGDRYKVDDKNFPSIFLFKGNADEYVQLPSHVDVTLDNLKAFVSANTPLYIGRDGCIKEFNEVLKNYANIPDAE-QLKLIEKLQAKQEQL-TDPEQQQNARAYLIYMRKIHEVGYDFLEEETKRLLRLKAGKVTEAKKEELLRKLNILEVFRVHKVTKTAPEKEEL 257          
BLAST of Endoplasmic reticulum resident protein 29 vs. Ensembl Xenopus
Match: nr2e1 (nuclear receptor subfamily 2 group E member 1 [Source:Xenbase;Acc:XB-GENE-483554])

HSP 1 Score: 150.984 bits (380), Expect = 5.718e-43
Identity = 86/238 (36.13%), Postives = 141/238 (59.24%), Query Frame = 3
Query:   90 VNIFFLTNFKNCVCSLTINGSISIHSLIFEKVIQAFDHVLVKFDEPFPYGEKEDVFKEISQVTISISNLITATVGIADYGEKENADLGDRYKITKSDFPAYRLF-NRDLDHPVAYKGEIKVDAIKSFIVEQTGAYIGLNGCLEEFDQIAKEFVNGDAEVKDKIISLMTNKVKDLKSDKIKHASAEKYLKIATKIRGNGVEFVKTERERLRKLSDGN-VSDNKKLEIKMRLNILHSFQS 797
            + +  +T       ++   GS+++  + F KVI     VLVKFD  +PYG ++D FK++++ + S  +L+ A VGI+DYG+K N +L +++ + K  FP Y LF N ++ +PV Y G +K  AI+ ++  Q G Y+G+ GC+E++D +A EF+    + K   + +    +     +  KHA AE+Y+KI +KI   G  F   E ER+ KL + N +S  KK +++ RLNIL SFQ+
Sbjct:   39 LPVLLVTCLVQRCWAMHTKGSLALDHITFYKVIPKSRFVLVKFDTQYPYGVQQDEFKQLAESSSSSKDLLVAHVGISDYGDKLNLELAEKFNLDKEKFPYYYLFVNGNIANPVIYVGPVKTSAIQLWLKTQ-GVYLGMPGCIEQYDALAGEFLLTTEKEKQSNLLIRARALMAEAGESEKHA-AEQYIKIMSKIIDQGENFAHNEYERITKLIEKNQMSQPKKDDLQKRLNILSSFQN 274          
BLAST of Endoplasmic reticulum resident protein 29 vs. Ensembl Mouse
Match: Erp29 (endoplasmic reticulum protein 29 [Source:MGI Symbol;Acc:MGI:1914647])

HSP 1 Score: 157.918 bits (398), Expect = 4.326e-46
Identity = 92/234 (39.32%), Postives = 142/234 (60.68%), Query Frame = 3
Query:  129 CSLTINGSISIHSLIFEKVIQAFDHVLVKFDEPFPYGEKEDVFKEISQVTISISNLITATVGIADYGEKENADLGDRYKITKSDFPAYRLF-NRDLDHPVAYKGEIKVDAIKSFIVEQTGAYIGLNGCLEEFDQIAKEFVNGDA-EVKDKIISLMTNKVKDLKSDKIKHASAEKYLKIATKIRGNGVEFVKTERERLRKLSDGNVSDNKKLEIKMRLNILHSFQSGAANEKMEL 824
              L   G++ + ++ F KVI     VLVKFD  +PYGEK+D FK +++ + S   L+ A VGI+DYG+K N +L ++YK+ K  +P + LF + DL++PV Y G +KV AI+ ++  Q G Y+G+ GCL  +D +A EF+   + E +  I+    + +  +K  + K AS  +YLKI  KI   G +F  +E  R+ KL +  +SD+KK E++  LNIL +F+   A EK EL
Sbjct:   33 SGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSEELLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDLENPVLYNGAVKVGAIQRWLKGQ-GVYLGMPGCLPAYDALAGEFIKASSIEARQAILKQGQDGLLSVKETEKKWAS--QYLKIMGKILDQGEDFPASEMARIGKLIENKMSDSKKEELQKSLNILTAFRKKEA-EKEEL 262          
BLAST of Endoplasmic reticulum resident protein 29 vs. UniProt/SwissProt
Match: sp|P57759|ERP29_MOUSE (Endoplasmic reticulum resident protein 29 OS=Mus musculus OX=10090 GN=Erp29 PE=1 SV=2)

HSP 1 Score: 157.918 bits (398), Expect = 3.026e-45
Identity = 92/234 (39.32%), Postives = 142/234 (60.68%), Query Frame = 3
Query:  129 CSLTINGSISIHSLIFEKVIQAFDHVLVKFDEPFPYGEKEDVFKEISQVTISISNLITATVGIADYGEKENADLGDRYKITKSDFPAYRLF-NRDLDHPVAYKGEIKVDAIKSFIVEQTGAYIGLNGCLEEFDQIAKEFVNGDA-EVKDKIISLMTNKVKDLKSDKIKHASAEKYLKIATKIRGNGVEFVKTERERLRKLSDGNVSDNKKLEIKMRLNILHSFQSGAANEKMEL 824
              L   G++ + ++ F KVI     VLVKFD  +PYGEK+D FK +++ + S   L+ A VGI+DYG+K N +L ++YK+ K  +P + LF + DL++PV Y G +KV AI+ ++  Q G Y+G+ GCL  +D +A EF+   + E +  I+    + +  +K  + K AS  +YLKI  KI   G +F  +E  R+ KL +  +SD+KK E++  LNIL +F+   A EK EL
Sbjct:   33 SGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSEELLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDLENPVLYNGAVKVGAIQRWLKGQ-GVYLGMPGCLPAYDALAGEFIKASSIEARQAILKQGQDGLLSVKETEKKWAS--QYLKIMGKILDQGEDFPASEMARIGKLIENKMSDSKKEELQKSLNILTAFRKKEA-EKEEL 262          
BLAST of Endoplasmic reticulum resident protein 29 vs. UniProt/SwissProt
Match: sp|P30040|ERP29_HUMAN (Endoplasmic reticulum resident protein 29 OS=Homo sapiens OX=9606 GN=ERP29 PE=1 SV=4)

HSP 1 Score: 156.762 bits (395), Expect = 9.324e-45
Identity = 91/235 (38.72%), Postives = 141/235 (60.00%), Query Frame = 3
Query:  129 CSLTINGSISIHSLIFEKVIQAFDHVLVKFDEPFPYGEKEDVFKEISQVTISISNLITATVGIADYGEKENADLGDRYKITKSDFPAYRLF-NRDLDHPVAYKGEIKVDAIKSFIVEQTGAYIGLNGCLEEFDQIAKEFVNGDA-EVKDKIISLMTNKVKDLKSDKIKHASAEKYLKIATKIRGNGVEFVKTERERLRKLSDGN-VSDNKKLEIKMRLNILHSFQSGAANEKMEL 824
              L   G++ + ++ F KVI     VLVKFD  +PYGEK+D FK +++ + S  +L+ A VGI+DYG+K N +L ++YK+ K  +P + LF + D ++PV Y G +KV AI+ ++  Q G Y+G+ GCL  +D +A EF+     E +  ++    + +  +K  + K   AE+YLKI  KI   G +F  +E  R+ +L + N +SD KK E++  LNIL +FQ   A EK EL
Sbjct:   31 SGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQ-GVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKW--AEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQKKGA-EKEEL 261          
BLAST of Endoplasmic reticulum resident protein 29 vs. UniProt/SwissProt
Match: sp|P52555|ERP29_RAT (Endoplasmic reticulum resident protein 29 OS=Rattus norvegicus OX=10116 GN=Erp29 PE=1 SV=2)

HSP 1 Score: 155.992 bits (393), Expect = 1.614e-44
Identity = 89/237 (37.55%), Postives = 141/237 (59.49%), Query Frame = 3
Query:  120 NCVCSLTINGSISIHSLIFEKVIQAFDHVLVKFDEPFPYGEKEDVFKEISQVTISISNLITATVGIADYGEKENADLGDRYKITKSDFPAYRLF-NRDLDHPVAYKGEIKVDAIKSFIVEQTGAYIGLNGCLEEFDQIAKEFVNGDA-EVKDKIISLMTNKVKDLKSDKIKHASAEKYLKIATKIRGNGVEFVKTERERLRKLSDGNVSDNKKLEIKMRLNILHSFQSGAANEKMEL 824
            +    L   G++ + ++ F KVI     VLVKFD  +PYGEK+D FK +++ + S  +L+ A VGI+DYG+K N +L ++YK+ K  +P + LF + D ++PV Y G +KV AI+ ++  Q G Y+G+ GCL  +D +A +F+   + E +  I+    + +  +K    K AS  +YLKI  KI   G +F  +E  R+ KL +  +S+ KK E++  LNIL +F+   A EK EL
Sbjct:   28 HGASGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYSGAVKVGAIQRWLKGQ-GVYLGMPGCLPAYDALAGQFIEASSREARQAILKQGQDGLSGVKETDKKWAS--QYLKIMGKILDQGEDFPASELARISKLIENKMSEGKKEELQRSLNILTAFRKKGA-EKEEL 260          
BLAST of Endoplasmic reticulum resident protein 29 vs. UniProt/SwissProt
Match: sp|P81623|ERP29_BOVIN (Endoplasmic reticulum resident protein 29 OS=Bos taurus OX=9913 GN=ERP29 PE=1 SV=2)

HSP 1 Score: 153.68 bits (387), Expect = 1.346e-43
Identity = 90/235 (38.30%), Postives = 140/235 (59.57%), Query Frame = 3
Query:  129 CSLTINGSISIHSLIFEKVIQAFDHVLVKFDEPFPYGEKEDVFKEISQVTISISNLITATVGIADYGEKENADLGDRYKITKSDFPAYRLF-NRDLDHPVAYKGEIKVDAIKSFIVEQTGAYIGLNGCLEEFDQIAKEFVNGDA-EVKDKIISLMTNKVKDLKSDKIKHASAEKYLKIATKIRGNGVEFVKTERERLRKLSDGN-VSDNKKLEIKMRLNILHSFQSGAANEKMEL 824
              L   G++ + ++ F KVI     VLVKFD  +PYGEK+D FK +++ + S  +L+ A VGI+DYG+K N +L ++YK+ K ++P + LF + D ++PV Y G +KV AI+ ++ +  G Y+G+ GCL  +D +A EF+     E +  ++    + +  +K    K   AE+YLKI  KI   G +F  +E  R+ KL + N +SD KK E++  LNIL +FQ     EK EL
Sbjct:   28 SGLHTKGALPLDTITFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKENYPIFYLFQDGDFENPVLYSGAVKVGAIQRWL-KGHGIYLGMPGCLPAYDTLAGEFIRASGVEARQSLLKQGQDNLASVKETDKKW--AEQYLKIMGKILDQGEDFPASEMTRITKLIEKNKMSDGKKEELQKSLNILTAFQK-KGGEKEEL 258          
BLAST of Endoplasmic reticulum resident protein 29 vs. UniProt/SwissProt
Match: sp|P81628|ERP29_CHICK (Endoplasmic reticulum resident protein 29 (Fragment) OS=Gallus gallus OX=9031 GN=ERP29 PE=1 SV=2)

HSP 1 Score: 144.05 bits (362), Expect = 2.918e-40
Identity = 80/200 (40.00%), Postives = 126/200 (63.00%), Query Frame = 3
Query:  129 CSLTINGSISIHSLIFEKVIQAFDHVLVKFDEPFPYGEKEDVFKEISQVTISISNLITATVGIADYGEKENADLGDRYKITKSDFPAYRLFN-RDLDHPVAYKGEIKVDAIKSFIVEQTGAYIGLNGCLEEFDQIAKEFVNGDAEVKDKIISLMTNKVKDL-KSDKIKHASAEKYLKIATKIRGNGVEFVKTERERLRKL 722
             +L   GS+ + ++ F KVI     VLVKFD  +PYGEK+D FK++++ + S  +L+ A VGI+DYG+K N +LG++YK+ K  +P + LF+  D D+P+ Y G IK  AI+ ++ +  G Y+G+ GCL+E+D +A +F++     K +  SL+    + L K+ + +  SAE+YLKI +KI   G EF   E  R+ KL
Sbjct:   22 SALHTKGSVPLDTITFYKVIPKHKFVLVKFDTQYPYGEKQDEFKKLAESSGSSEDLLVAEVGISDYGDKLNTELGEKYKLDKEKYPIFYLFHDGDFDNPLPYSGHIKAGAIQRWL-KSNGIYLGMPGCLKEYDVLASKFMS--VTDKSERQSLLKKGQQSLEKAKETEKKSAEQYLKIMSKILEQGEEFAANEVVRITKL 218          
BLAST of Endoplasmic reticulum resident protein 29 vs. TrEMBL
Match: A0A3S1B2V0 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_021677 PE=4 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 3.479e-57
Identity = 103/247 (41.70%), Postives = 159/247 (64.37%), Query Frame = 3
Query:   81 LLIVNIFFLTNFKNCVCSLTINGSISIHSLIFEKVIQAFDHVLVKFDEPFPYGEKEDVFKEISQVTISISNLITATVGIADYGEKENADLGDRYKITKSDFPAYRLF-NRDLDHPVA-YKGE-IKVDAIKSFIVEQTGAYIGLNGCLEEFDQIAKEFVNGDAEVKDKIISLMTNKVKDLKSDKIKHASAEKYLKIATKIRGNGVEFVKTERERLRKLSDGNVSDNKKLEIKMRLNILHSFQSGAANE 812
            +L  +   +  F + VC+  + GS++++S +F+KVI+    VLVKFDE +PYGEK+D FKE+++ ++S  +L+ A V +ADYGEK+N DL +R+ ITK  FPAYRLF + +   P A + G+ ++ D+IK+FIV+++G ++G  GCLE FD++  EF+    + +  I+       ++L  D+ K  SA+ Y+K   K+   G  F+K E  R+ KL  G VSDNKK ++  RLNIL SFQ G  +E
Sbjct:   11 MLFASFALIAAFFSNVCADVVQGSVALNSGVFDKVIEKHKAVLVKFDETYPYGEKQDAFKEVAKTSVSQPDLLVAEVHVADYGEKDNQDLAERFGITKEAFPAYRLFTDGNSKEPKASFNGDALQADSIKNFIVKESGLWLGRPGCLETFDKLVPEFIKASDDKRAAILGEAEKSAQELTKDEEK-LSADTYIKTMKKVLDKGNNFIKDEVTRVEKLRSGKVSDNKKKQLGDRLNILASFQLGLKDE 256          
BLAST of Endoplasmic reticulum resident protein 29 vs. TrEMBL
Match: K1R3D5 (Endoplasmic reticulum protein ERp29 OS=Crassostrea gigas OX=29159 GN=CGI_10023702 PE=4 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 1.328e-55
Identity = 101/247 (40.89%), Postives = 153/247 (61.94%), Query Frame = 3
Query:   57 LMEMMRFFLLIVNIFFLTNFKNCVCSLTINGSISIHSLIFEKVIQAFDHVLVKFDEPFPYGEKEDVFKEISQVTISISNLITATVGIADYGEKENADLGDRYKITKSDFPAYRLFNRDLDHPVAYKGEIKV-DAIKSFIVEQTGAYIGLNGCLEEFDQIAKEFVNGDAEVKDKIISLMTNKVKDLKSDKIKHASAEKYLKIATKIRGNGVEFVKTERERLRKLSDGNVSDNKKLEIKMRLNILHSFQ 794
            ++++  +  L +   F T++   V S TI GS+ ++S +F K++  +  VL+KFDE +PYG+K+D FK + + T+S S+L+ A V +ADYGEKENAD+ ++Y + K DFP Y+LF    D PV Y G++K+ D IK F++ ++G ++GL  CLE+FD++  EF     + K  ++           S+K K  SAE Y+K   K+      FV TE +R+ KL DG VSD KK ++  RLNIL SFQ
Sbjct:    1 MLQICAYLSLALVFLFGTSY---VSSETIQGSVLLNSAVFSKIVDKYKAVLIKFDETYPYGDKQDTFKAVVEATLSQSDLLCAEVQVADYGEKENADIAEKYGVKKDDFPVYKLFVEGKDEPVTYTGDVKIADDIKKFLIRESGLWLGLPSCLEDFDKLVAEFQKTPDDKKPDLLKKAEELASKYASEKEKK-SAEIYIKTLKKLVETP-SFVDTEIKRVEKLKDGKVSDKKKEQLNERLNILTSFQ 242          
BLAST of Endoplasmic reticulum resident protein 29 vs. TrEMBL
Match: A0A2C9JDB0 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106054200 PE=4 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 2.602e-55
Identity = 97/224 (43.30%), Postives = 144/224 (64.29%), Query Frame = 3
Query:  147 GSISIHSLIFEKVIQAFDHVLVKFDEPFPYGEKEDVFKEISQVTISISNLITATVGIADYGEKENADLGDRYKITKSDFPAYRLF-NRDLDHPVAYKGEIK-VDAIKSFIVEQTGAYIGLNGCLEEFDQIAKEFVNGDAEVKDKIISLMTNKVKDLKSDKIKHASAEKYLKIATKIRGNGVEFVKTERERLRKLSDGNVSDNKKLEIKMRLNILHSFQSGAANE 812
            GS++++S +F+K+IQ    VLVKFDE +PYG+K+DVFKE+++ +     L+ A V +ADYG+K+N+DL ++Y + K +FPAYRLF N  LD P+ Y   ++  D IK+F++ +TG ++G  GCLEEFD+I  EF     + +  I+       + L +D  +  SA+ Y+K   KI   G +FVKTE  R+ KL  G VSD KK ++  RLNIL +FQ    +E
Sbjct:   29 GSVALNSGVFDKIIQKHKAVLVKFDETYPYGKKQDVFKEVAKSSTQQPELLIAEVQVADYGDKDNSDLAEKYGVKKENFPAYRLFLNGKLDDPIKYTASVENADDIKNFVIRETGLWLGRPGCLEEFDKIVNEFFTAPKDKQAAIVEQAEKAAEKL-TDTAEKTSADTYIKTMKKILEKGTDFVKTEVSRIEKLRSGKVSDKKKEQLSDRLNILTTFQLNVKDE 251          
BLAST of Endoplasmic reticulum resident protein 29 vs. TrEMBL
Match: A0A210Q0W1 (Endoplasmic reticulum resident protein 29 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT02072 PE=4 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 3.358e-52
Identity = 98/248 (39.52%), Postives = 152/248 (61.29%), Query Frame = 3
Query:   57 LMEMMRFFLLIVNIFFLTNFKNCVCSLTINGSISIHSLIFEKVIQAFDHVLVKFDEPFPYGEKEDVFKEISQVTISISNLITATVGIADYGEKENADLGDRYKITKSDFPAYRLF-NRDLDHPVAYKGEIK-VDAIKSFIVEQTGAYIGLNGCLEEFDQIAKEFVNGDAEVKDKIISLMTNKVKDLKSDKIKHASAEKYLKIATKIRGNGVEFVKTERERLRKLSDGNVSDNKKLEIKMRLNILHSFQ 794
            +ME    FL  + + F+      + +  + GSI ++S +FEK+++    VLVKFDE +PYGEK+D FKE++  T+S  +++ + V + DYGEKENADL  R+ +TK DFP Y LF + D ++P  + G  K  D +K F+++++G ++GL  CLE++D+  K+F+   A+ +  I++         ++D+    SAE Y+K   KI   G  FV +E  R+ KL DG VSD KK ++  RLNIL SFQ
Sbjct:    1 MMETKSMFLTGLAVVFM--LFQIIHADGVKGSIQLNSGVFEKILRKHKAVLVKFDETYPYGEKQDAFKEVAAATLSQDDILVSEVQVQDYGEKENADLAKRFGVTKEDFPVYLLFLSGDAENPKKFLGNAKSADDVKKFLMKESGLWLGLPSCLEDYDKKVKDFLQASADKRPGILATAEGDASK-ETDESTKRSAEIYVKTMKKILEKGDTFVNSEITRVEKLKDGKVSDKKKEQLNERLNILTSFQ 245          
BLAST of Endoplasmic reticulum resident protein 29 vs. TrEMBL
Match: A0A401S6Z8 (Uncharacterized protein OS=Chiloscyllium punctatum OX=137246 GN=chiPu_0004573 PE=4 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 3.841e-52
Identity = 104/242 (42.98%), Postives = 153/242 (63.22%), Query Frame = 3
Query:   78 FLLIVNIFFLTNFKNCVCSLTINGSISIHSLIFEKVIQAFDHVLVKFDEPFPYGEKEDVFKEISQVTISISNLITATVGIADYGEKENADLGDRYKITKSDFPAYRLF-NRDLDHPVAYKGEIKVDAIKSFIVEQTGAYIGLNGCLEEFDQIAKEFVNGDA-EVKDKIISLMTNKVKDLKSDKIKHASAEKYLKIATKIRGNGVEFVKTERERLRK-LSDGNVSDNKKLEIKMRLNILHSFQ 794
            FLL V   FL  F       T+ GS+ + ++ F KVI    +VLVK D  +PYGEK+D FK++++ + S   L+ A VGI+DYGEKEN++LG +YK+ K D+P Y LF N DL++PV Y GEIK DAI+ ++ +  G ++G+ GCLEE+D +A EF +  A E + KI+  +   ++++   + K  SAE+Y KI +K+   G  FV +E  R+ K L +  +S  KK+E + R NIL SFQ
Sbjct:    8 FLLFVAAAFLHLFIPTWALHTV-GSLPLDTVTFYKVIPKQKYVLVKIDTQYPYGEKQDEFKKLAENSASSKELLVAEVGISDYGEKENSELGTKYKVEKDDYPVYLLFTNGDLENPVHYTGEIKQDAIQQWL-KSKGVWVGMLGCLEEYDSLAAEFRSTSAQEERQKIMEKVKAMIQEMPESEQK--SAEQYHKIMSKVLAQGDSFVHSEIARIGKLLEESKMSSAKKVEFQKRQNILSSFQ 245          
BLAST of Endoplasmic reticulum resident protein 29 vs. Ensembl Nematostella
Match: EDO43544 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYL9])

HSP 1 Score: 51.6026 bits (122), Expect = 1.567e-7
Identity = 34/98 (34.69%), Postives = 55/98 (56.12%), Query Frame = 3
Query:  504 GCLEEFDQIAKEFVNGDAEVKDKIISLMTNKVKDLKSDKIKHASAEKYLKIATKIRGNGVEFVKTERERLRKLSDGNVSDNKKLEIKMRLNILHSFQS 797
            G L+EFD++A+EFV+ D   +++I+  +  K     S K     A  Y  + T+I   G   V+ E ERL +L  G+V  +K  E++ + NILH F++
Sbjct:  272 GRLDEFDKLAEEFVS-DWHRREQILRTVREKTATHPSKKY----AAYYAIVMTRIINEGSHMVQMEIERLERLIAGHVHASKSDELERKKNILHHFRA 364          
BLAST of Endoplasmic reticulum resident protein 29 vs. Planmine SMEST
Match: SMESG000060467.1 (SMESG000060467.1)

HSP 1 Score: 517.309 bits (1331), Expect = 0.000e+0
Identity = 255/255 (100.00%), Postives = 255/255 (100.00%), Query Frame = 3
Query:   60 MEMMRFFLLIVNIFFLTNFKNCVCSLTINGSISIHSLIFEKVIQAFDHVLVKFDEPFPYGEKEDVFKEISQVTISISNLITATVGIADYGEKENADLGDRYKITKSDFPAYRLFNRDLDHPVAYKGEIKVDAIKSFIVEQTGAYIGLNGCLEEFDQIAKEFVNGDAEVKDKIISLMTNKVKDLKSDKIKHASAEKYLKIATKIRGNGVEFVKTERERLRKLSDGNVSDNKKLEIKMRLNILHSFQSGAANEKMEL 824
            MEMMRFFLLIVNIFFLTNFKNCVCSLTINGSISIHSLIFEKVIQAFDHVLVKFDEPFPYGEKEDVFKEISQVTISISNLITATVGIADYGEKENADLGDRYKITKSDFPAYRLFNRDLDHPVAYKGEIKVDAIKSFIVEQTGAYIGLNGCLEEFDQIAKEFVNGDAEVKDKIISLMTNKVKDLKSDKIKHASAEKYLKIATKIRGNGVEFVKTERERLRKLSDGNVSDNKKLEIKMRLNILHSFQSGAANEKMEL
Sbjct:    1 MEMMRFFLLIVNIFFLTNFKNCVCSLTINGSISIHSLIFEKVIQAFDHVLVKFDEPFPYGEKEDVFKEISQVTISISNLITATVGIADYGEKENADLGDRYKITKSDFPAYRLFNRDLDHPVAYKGEIKVDAIKSFIVEQTGAYIGLNGCLEEFDQIAKEFVNGDAEVKDKIISLMTNKVKDLKSDKIKHASAEKYLKIATKIRGNGVEFVKTERERLRKLSDGNVSDNKKLEIKMRLNILHSFQSGAANEKMEL 255          
BLAST of Endoplasmic reticulum resident protein 29 vs. Planmine SMEST
Match: SMESG000060467.1 (SMESG000060467.1)

HSP 1 Score: 512.686 bits (1319), Expect = 0.000e+0
Identity = 253/253 (100.00%), Postives = 253/253 (100.00%), Query Frame = 3
Query:   66 MMRFFLLIVNIFFLTNFKNCVCSLTINGSISIHSLIFEKVIQAFDHVLVKFDEPFPYGEKEDVFKEISQVTISISNLITATVGIADYGEKENADLGDRYKITKSDFPAYRLFNRDLDHPVAYKGEIKVDAIKSFIVEQTGAYIGLNGCLEEFDQIAKEFVNGDAEVKDKIISLMTNKVKDLKSDKIKHASAEKYLKIATKIRGNGVEFVKTERERLRKLSDGNVSDNKKLEIKMRLNILHSFQSGAANEKMEL 824
            MMRFFLLIVNIFFLTNFKNCVCSLTINGSISIHSLIFEKVIQAFDHVLVKFDEPFPYGEKEDVFKEISQVTISISNLITATVGIADYGEKENADLGDRYKITKSDFPAYRLFNRDLDHPVAYKGEIKVDAIKSFIVEQTGAYIGLNGCLEEFDQIAKEFVNGDAEVKDKIISLMTNKVKDLKSDKIKHASAEKYLKIATKIRGNGVEFVKTERERLRKLSDGNVSDNKKLEIKMRLNILHSFQSGAANEKMEL
Sbjct:    1 MMRFFLLIVNIFFLTNFKNCVCSLTINGSISIHSLIFEKVIQAFDHVLVKFDEPFPYGEKEDVFKEISQVTISISNLITATVGIADYGEKENADLGDRYKITKSDFPAYRLFNRDLDHPVAYKGEIKVDAIKSFIVEQTGAYIGLNGCLEEFDQIAKEFVNGDAEVKDKIISLMTNKVKDLKSDKIKHASAEKYLKIATKIRGNGVEFVKTERERLRKLSDGNVSDNKKLEIKMRLNILHSFQSGAANEKMEL 253          
The following BLAST results are available for this feature:
BLAST of Endoplasmic reticulum resident protein 29 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ERP291.941e-4538.72endoplasmic reticulum protein 29 [Source:HGNC Symb... [more]
ERP291.654e-2336.81endoplasmic reticulum protein 29 [Source:HGNC Symb... [more]
back to top
BLAST of Endoplasmic reticulum resident protein 29 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Endoplasmic reticulum resident protein 29 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
wbl1.780e-4036.33gene:FBgn0004003 transcript:FBtr0340470[more]
wbl1.780e-4036.33gene:FBgn0004003 transcript:FBtr0086510[more]
back to top
BLAST of Endoplasmic reticulum resident protein 29 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Endoplasmic reticulum resident protein 29 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nr2e15.718e-4336.13nuclear receptor subfamily 2 group E member 1 [Sou... [more]
back to top
BLAST of Endoplasmic reticulum resident protein 29 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Erp294.326e-4639.32endoplasmic reticulum protein 29 [Source:MGI Symbo... [more]
back to top
BLAST of Endoplasmic reticulum resident protein 29 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P57759|ERP29_MOUSE3.026e-4539.32Endoplasmic reticulum resident protein 29 OS=Mus m... [more]
sp|P30040|ERP29_HUMAN9.324e-4538.72Endoplasmic reticulum resident protein 29 OS=Homo ... [more]
sp|P52555|ERP29_RAT1.614e-4437.55Endoplasmic reticulum resident protein 29 OS=Rattu... [more]
sp|P81623|ERP29_BOVIN1.346e-4338.30Endoplasmic reticulum resident protein 29 OS=Bos t... [more]
sp|P81628|ERP29_CHICK2.918e-4040.00Endoplasmic reticulum resident protein 29 (Fragmen... [more]
back to top
BLAST of Endoplasmic reticulum resident protein 29 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S1B2V03.479e-5741.70Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
K1R3D51.328e-5540.89Endoplasmic reticulum protein ERp29 OS=Crassostrea... [more]
A0A2C9JDB02.602e-5543.30Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A210Q0W13.358e-5239.52Endoplasmic reticulum resident protein 29 OS=Mizuh... [more]
A0A401S6Z83.841e-5242.98Uncharacterized protein OS=Chiloscyllium punctatum... [more]
back to top
BLAST of Endoplasmic reticulum resident protein 29 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Endoplasmic reticulum resident protein 29 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Endoplasmic reticulum resident protein 29 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Endoplasmic reticulum resident protein 29 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO435441.567e-734.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Endoplasmic reticulum resident protein 29 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Endoplasmic reticulum resident protein 29 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000060467.10.000e+0100.00SMESG000060467.1[more]
SMESG000060467.10.000e+0100.00SMESG000060467.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002766 ID=SMED30002766|Name=Endoplasmic reticulum resident protein 29|organism=Schmidtea mediterranea sexual|type=transcript|length=980bp
GTTTAAATAATTATACGTGTGTTTCATATATTCGCAGATTTCATTGAATC
TGAATTTTAATGGAAATGATGCGATTTTTTCTTTTAATAGTCAATATATT
CTTCTTGACAAATTTCAAGAATTGCGTTTGCAGCCTCACGATAAATGGAT
CCATTTCAATTCATTCATTAATATTTGAAAAAGTAATTCAAGCTTTTGAT
CATGTATTGGTAAAGTTCGATGAGCCATTTCCATATGGTGAAAAAGAGGA
TGTATTCAAAGAAATCTCACAGGTAACTATCAGCATTTCAAACCTTATTA
CTGCCACTGTTGGGATAGCGGATTATGGAGAAAAGGAAAATGCTGATTTA
GGAGACAGATATAAAATAACTAAATCCGATTTTCCAGCTTATCGTTTATT
CAATAGAGATCTTGACCACCCAGTTGCTTATAAAGGAGAAATTAAAGTTG
ACGCTATCAAATCATTTATAGTTGAGCAAACCGGGGCTTACATAGGTTTG
AATGGATGCCTTGAAGAATTCGATCAAATCGCCAAGGAATTTGTAAATGG
CGATGCCGAAGTTAAGGATAAAATTATTAGCCTAATGACCAATAAAGTAA
AAGATCTGAAATCCGACAAAATCAAACATGCATCCGCAGAAAAATATTTG
AAGATTGCAACAAAGATCCGTGGCAATGGAGTCGAATTTGTGAAAACAGA
GCGAGAAAGACTGAGAAAATTAAGTGATGGAAATGTATCTGACAACAAAA
AACTTGAAATAAAAATGCGGTTGAATATTTTGCACAGCTTCCAATCAGGT
GCAGCCAATGAAAAAATGGAGCTGTAGTTGGTTGGAGGACGCGTTGAAAG
CTCCCCACCTGTATTTTCGTATTTTCAAGTTCTTATTTGTTCCAATTAAT
TAATAATATTTGATTATAAAATAATATTGTTCCATTTGTATCTGTTGTTA
ATAAATCGGGTTTTCTTGTTTGAAAAAAAA
back to top

protein sequence of SMED30002766-orf-1

>SMED30002766-orf-1 ID=SMED30002766-orf-1|Name=SMED30002766-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=256bp
MEMMRFFLLIVNIFFLTNFKNCVCSLTINGSISIHSLIFEKVIQAFDHVL
VKFDEPFPYGEKEDVFKEISQVTISISNLITATVGIADYGEKENADLGDR
YKITKSDFPAYRLFNRDLDHPVAYKGEIKVDAIKSFIVEQTGAYIGLNGC
LEEFDQIAKEFVNGDAEVKDKIISLMTNKVKDLKSDKIKHASAEKYLKIA
TKIRGNGVEFVKTERERLRKLSDGNVSDNKKLEIKMRLNILHSFQSGAAN
EKMEL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036249Thioredoxin-like_sf
IPR036356ERp29_C_sf
IPR016855ERp29
IPR012336Thioredoxin-like_fold
IPR011679ERp29_C
IPR012883ERp29_N
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0005788endoplasmic reticulum lumen
Vocabulary: biological process
TermDefinition
GO:0009306protein secretion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 17..146
e-value: 2.6E-33
score: 117.1
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 38..143
IPR012883ERp29, N-terminalPFAMPF07912ERp29_Ncoord: 27..147
e-value: 1.1E-37
score: 129.0
IPR036356Endoplasmic reticulum resident protein 29, C-terminal domain superfamilyGENE3DG3DSA:1.20.1150.12coord: 147..255
e-value: 8.6E-26
score: 92.3
IPR036356Endoplasmic reticulum resident protein 29, C-terminal domain superfamilySUPERFAMILYSSF47933ERP29 C domain-likecoord: 148..251
IPR011679Endoplasmic reticulum resident protein 29, C-terminalPFAMPF07749ERp29coord: 149..244
e-value: 4.5E-21
score: 75.5
IPR016855Endoplasmic reticulum resident protein 29PANTHERPTHR12211ENDOPLASMIC RETICULUM PROTEIN ERP29coord: 6..251
NoneNo IPR availablePANTHERPTHR12211:SF0ENDOPLASMIC RETICULUM RESIDENT PROTEIN 29coord: 6..251
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..24
score: 0.616