Phosphatidate cytidylyltransferase

Overview
NamePhosphatidate cytidylyltransferase
Smed IDSMED30002758
Length (bp)1574
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphatidate cytidylyltransferase (SMED30002758) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphatidate cytidylyltransferase (SMED30002758) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphatidate cytidylyltransferase (SMED30002758) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphatidate cytidylyltransferase (SMED30002758) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002758

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30002758h1SMcG0011085 Contig2200GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
photoreceptor neuronSMED30002758h1SMcG0011085 SMED30002758smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Human
Match: CDS2 (CDP-diacylglycerol synthase 2 [Source:HGNC Symbol;Acc:HGNC:1801])

HSP 1 Score: 410.994 bits (1055), Expect = 2.823e-139
Identity = 227/458 (49.56%), Postives = 301/458 (65.72%), Query Frame = 2
Query:  101 EVRRRNIHDEVKDKGDEISEELPKPNFVDIVPETGSGEDIEIMPSLSEIKNIPQGTDSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSKVTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGIL 1474
            E+R+R  H+ V    D+ SE   K   VD       GE      S +E   +P   D + E LN  L ++  +W+N+ +R I+T  MI  F  +++LGPM L+ +V+ +Q+ CF+EII IGY VY S DLPWFRTLSW+FL   NYF +GE +   F  L+ +E            + L+ L  +HRFISF LY  G   FVLSLVKKHY  QF +FGWTHVTLLI+VT SH +++N+F G+IWF+VP+S +ICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGG  +T++F +L S  +  Y  FVCP+EY++   + +++C  + +FR   Y +P  + S+I    V +YP+  H I +  F+S++GPFGGFFASGFKRAFKIKDF + IPGHGGIMDRFDCQ LM  FV  Y  SFIR P+P+ L+QQ  T+  + QL  +  L   L+ +G+L
Sbjct:    3 ELRQRVAHEPVAPPEDKESESEAK---VD-------GETASDSESRAESAPLPVSADDTPEVLNRALSNLSSRWKNWWVRGILTLAMIAFFFIIIYLGPMVLMIIVMCVQIKCFHEIITIGYNVYHSYDLPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQRE------------EPLRILSKYHRFISFTLYLIGFCMFVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMSGYRCFVCPVEYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSVIGWKTVRMYPFQIHSIALSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPSKLIQQFLTLRPDQQLHIFNTLRSHLIDKGML 438          
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Human
Match: CDS1 (CDP-diacylglycerol synthase 1 [Source:HGNC Symbol;Acc:HGNC:1800])

HSP 1 Score: 409.068 bits (1050), Expect = 3.097e-138
Identity = 225/451 (49.89%), Postives = 292/451 (64.75%), Query Frame = 2
Query:  122 HDEVKDKGDEISEELPKPNFVDIVPETGSGEDIEIMPSLSEIKNIPQGTDSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSKVTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGIL 1474
            H E +  G +   E       DI    G   D++     S+I  IP  +D + E L   L  +  +W+N+ IR I+T  MI +F  ++++G   L+ LV+ IQ+ CF+EII IGY VY S DLPWFRTLSW+FL   NYF +GE +   F   + +E Q            LQ L+ +HRFISF LY  G   FVLSLVKKHY  QF +F WTHVTLLI VT SH ++ N+F G+IWFLVP+S +ICNDI AY+FGFFFGRTPLIKLSPKKTWEGFIGG  ST++F  + +  L KY YFVCP+EY     +   EC  + +F+   Y LP +L +++   +V+LYP+  H I +  F+S++GPFGGFFASGFKRAFKIKDF + IPGHGGIMDRFDCQ LM  FV+ Y  SFIR P+P+ +LQQ+  +    QL+ Y+ L   L+ +GIL
Sbjct:   21 HREGEAAGGDHETESTSDKETDIDDRYG---DLDSRTD-SDIPEIPPSSDRTPEILKKALSGLSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYHSYDLPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQ------------LQFLIRYHRFISFALYLAGFCMFVLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYLFGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGFIAAYVLSKYQYFVCPVEYRSDVNSFVTECEPSELFQLQTYSLPPFLKAVLRQERVSLYPFQIHSIALSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPSKVLQQLLVLQPEQQLNIYKTLKTHLIEKGIL 455          
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Human
Match: CDS2 (CDP-diacylglycerol synthase 2 [Source:HGNC Symbol;Acc:HGNC:1801])

HSP 1 Score: 283.108 bits (723), Expect = 3.478e-92
Identity = 138/252 (54.76%), Postives = 182/252 (72.22%), Query Frame = 2
Query:  317 KWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMEC 1072
            +W+N+ +R I+T  MI  F  +++LGPM L+ +V+ +Q+ CF+EII IGY VY S DLPWFRTLSW+FL   NYF +GE +   F  L+ +E            + L+ L  +HRFISF LY  G   FVLSLVKKHY  QF +FGWTHVTLLI+VT SH +++N+F G+IWF+VP+S +ICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGG  +T++F +L S  +  Y  FVCP+EY++   + +++C
Sbjct:   10 RWKNWWVRGILTLAMIAFFFIIIYLGPMVLMIIVMCVQIKCFHEIITIGYNVYHSYDLPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQRE------------EPLRILSKYHRFISFTLYLIGFCMFVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMSGYRCFVCPVEYNNDTNSFTVDC 249          
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Celegans
Match: cdgs-1 (Phosphatidate cytidylyltransferase [Source:UniProtKB/Swiss-Prot;Acc:P53439])

HSP 1 Score: 388.267 bits (996), Expect = 1.535e-130
Identity = 225/462 (48.70%), Postives = 296/462 (64.07%), Query Frame = 2
Query:  101 EVRRRNIHDEVKDKGDEISEELPKPNFVDIVPETGSGEDIEIMPSLSEIKNIPQGTDSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSK----VTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGIL 1474
            E  R    D+ +   DE   E       D   + GS    E +  L++   IPQ   S   F +S L+++P +WRN+ +R + + +MI  F F+V  G   L+FLV LIQ  CF EII+IG  VY+  D PWFR LSW+FL TSNYF FGE LI  + I+L K+            + L  LV +HR +SF LYC G V FVLSL K +Y++QF+LF WTH+TLL+IV+ S FI+ NIF G+IWFL PV+MIIC DIM+YMFGFF+G+TPLIKLSPKKTWEGFIGG  ST++F IL S AL    +FVCP+++       S  C     F+   Y +P   S +  + +    + L P+  H I + +F+S++GPFGGFFASGFKRAFKIKDFGD+IPGHGG+MDRFDCQ+LMG FV  Y +SFIR+P  + LL+QI T+   DQL+ +  L   L + G++
Sbjct:   24 ERLRAPARDDARPTSDESDME---GILQDEDSDAGSKNKEEKLERLTQ--AIPQDKGSLGVFADSMLEALPPRWRNWVVRGLFSIIMISTFTFIVTRGATWLMFLVFLIQFKCFQEIISIGLAVYRLYDFPWFRALSWYFLLTSNYFFFGESLIDYWGIVLKKD------------NFLHFLVAYHRLVSFALYCIGFVSFVLSLRKGYYMRQFSLFAWTHLTLLLIVSQSFFIIQNIFQGLIWFLAPVAMIICCDIMSYMFGFFWGKTPLIKLSPKKTWEGFIGGAFSTVVFGILLSLALYNRPFFVCPVQHYQTD---SSNCTIPLAFQLQDYPVPRPFSFVYKILRKEPIIQLCPFVFHSIALSLFASILGPFGGFFASGFKRAFKIKDFGDVIPGHGGLMDRFDCQLLMGTFVMVYIHSFIRVPDASKLLKQIMTLEPQDQLNIFNLLQSELSKTGLI 465          
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Celegans
Match: cdgs-1 (Phosphatidate cytidylyltransferase [Source:UniProtKB/Swiss-Prot;Acc:P53439])

HSP 1 Score: 388.267 bits (996), Expect = 1.535e-130
Identity = 225/462 (48.70%), Postives = 296/462 (64.07%), Query Frame = 2
Query:  101 EVRRRNIHDEVKDKGDEISEELPKPNFVDIVPETGSGEDIEIMPSLSEIKNIPQGTDSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSK----VTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGIL 1474
            E  R    D+ +   DE   E       D   + GS    E +  L++   IPQ   S   F +S L+++P +WRN+ +R + + +MI  F F+V  G   L+FLV LIQ  CF EII+IG  VY+  D PWFR LSW+FL TSNYF FGE LI  + I+L K+            + L  LV +HR +SF LYC G V FVLSL K +Y++QF+LF WTH+TLL+IV+ S FI+ NIF G+IWFL PV+MIIC DIM+YMFGFF+G+TPLIKLSPKKTWEGFIGG  ST++F IL S AL    +FVCP+++       S  C     F+   Y +P   S +  + +    + L P+  H I + +F+S++GPFGGFFASGFKRAFKIKDFGD+IPGHGG+MDRFDCQ+LMG FV  Y +SFIR+P  + LL+QI T+   DQL+ +  L   L + G++
Sbjct:   24 ERLRAPARDDARPTSDESDME---GILQDEDSDAGSKNKEEKLERLTQ--AIPQDKGSLGVFADSMLEALPPRWRNWVVRGLFSIIMISTFTFIVTRGATWLMFLVFLIQFKCFQEIISIGLAVYRLYDFPWFRALSWYFLLTSNYFFFGESLIDYWGIVLKKD------------NFLHFLVAYHRLVSFALYCIGFVSFVLSLRKGYYMRQFSLFAWTHLTLLLIVSQSFFIIQNIFQGLIWFLAPVAMIICCDIMSYMFGFFWGKTPLIKLSPKKTWEGFIGGAFSTVVFGILLSLALYNRPFFVCPVQHYQTD---SSNCTIPLAFQLQDYPVPRPFSFVYKILRKEPIIQLCPFVFHSIALSLFASILGPFGGFFASGFKRAFKIKDFGDVIPGHGGLMDRFDCQLLMGTFVMVYIHSFIRVPDASKLLKQIMTLEPQDQLNIFNLLQSELSKTGLI 465          
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Celegans
Match: cdgs-1 (Phosphatidate cytidylyltransferase [Source:UniProtKB/Swiss-Prot;Acc:P53439])

HSP 1 Score: 387.111 bits (993), Expect = 2.760e-130
Identity = 224/466 (48.07%), Postives = 300/466 (64.38%), Query Frame = 2
Query:   89 EVEDEVRRRNIHDEVKDKGDEISEELPKPNFVDIVPETGSGEDIEIMPSLSEIKNIPQGTDSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSK----VTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGIL 1474
            E  D  +RR     V ++    + +  +P   D     G  +D + +  L++   IPQ   S   F +S L+++P +WRN+ +R + + +MI  F F+V  G   L+FLV LIQ  CF EII+IG  VY+  D PWFR LSW+FL TSNYF FGE LI  + I+L K+            + L  LV +HR +SF LYC G V FVLSL K +Y++QF+LF WTH+TLL+IV+ S FI+ NIF G+IWFL PV+MIIC DIM+YMFGFF+G+TPLIKLSPKKTWEGFIGG  ST++F IL S AL    +FVCP+++       S  C     F+   Y +P   S +  + +    + L P+  H I + +F+S++GPFGGFFASGFKRAFKIKDFGD+IPGHGG+MDRFDCQ+LMG FV  Y +SFIR+P  + LL+QI T+   DQL+ +  L   L + G++
Sbjct:    8 ENADVRQRRAPESPVTERLRAPARDDARPT-SDESDMEGILQDEDRLERLTQ--AIPQDKGSLGVFADSMLEALPPRWRNWVVRGLFSIIMISTFTFIVTRGATWLMFLVFLIQFKCFQEIISIGLAVYRLYDFPWFRALSWYFLLTSNYFFFGESLIDYWGIVLKKD------------NFLHFLVAYHRLVSFALYCIGFVSFVLSLRKGYYMRQFSLFAWTHLTLLLIVSQSFFIIQNIFQGLIWFLAPVAMIICCDIMSYMFGFFWGKTPLIKLSPKKTWEGFIGGAFSTVVFGILLSLALYNRPFFVCPVQHYQTD---SSNCTIPLAFQLQDYPVPRPFSFVYKILRKEPIIQLCPFVFHSIALSLFASILGPFGGFFASGFKRAFKIKDFGDVIPGHGGLMDRFDCQLLMGTFVMVYIHSFIRVPDASKLLKQIMTLEPQDQLNIFNLLQSELSKTGLI 455          
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Celegans
Match: cdgs-1 (Phosphatidate cytidylyltransferase [Source:UniProtKB/Swiss-Prot;Acc:P53439])

HSP 1 Score: 387.111 bits (993), Expect = 2.760e-130
Identity = 224/466 (48.07%), Postives = 300/466 (64.38%), Query Frame = 2
Query:   89 EVEDEVRRRNIHDEVKDKGDEISEELPKPNFVDIVPETGSGEDIEIMPSLSEIKNIPQGTDSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSK----VTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGIL 1474
            E  D  +RR     V ++    + +  +P   D     G  +D + +  L++   IPQ   S   F +S L+++P +WRN+ +R + + +MI  F F+V  G   L+FLV LIQ  CF EII+IG  VY+  D PWFR LSW+FL TSNYF FGE LI  + I+L K+            + L  LV +HR +SF LYC G V FVLSL K +Y++QF+LF WTH+TLL+IV+ S FI+ NIF G+IWFL PV+MIIC DIM+YMFGFF+G+TPLIKLSPKKTWEGFIGG  ST++F IL S AL    +FVCP+++       S  C     F+   Y +P   S +  + +    + L P+  H I + +F+S++GPFGGFFASGFKRAFKIKDFGD+IPGHGG+MDRFDCQ+LMG FV  Y +SFIR+P  + LL+QI T+   DQL+ +  L   L + G++
Sbjct:    8 ENADVRQRRAPESPVTERLRAPARDDARPT-SDESDMEGILQDEDRLERLTQ--AIPQDKGSLGVFADSMLEALPPRWRNWVVRGLFSIIMISTFTFIVTRGATWLMFLVFLIQFKCFQEIISIGLAVYRLYDFPWFRALSWYFLLTSNYFFFGESLIDYWGIVLKKD------------NFLHFLVAYHRLVSFALYCIGFVSFVLSLRKGYYMRQFSLFAWTHLTLLLIVSQSFFIIQNIFQGLIWFLAPVAMIICCDIMSYMFGFFWGKTPLIKLSPKKTWEGFIGGAFSTVVFGILLSLALYNRPFFVCPVQHYQTD---SSNCTIPLAFQLQDYPVPRPFSFVYKILRKEPIIQLCPFVFHSIALSLFASILGPFGGFFASGFKRAFKIKDFGDVIPGHGGLMDRFDCQLLMGTFVMVYIHSFIRVPDASKLLKQIMTLEPQDQLNIFNLLQSELSKTGLI 455          
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Fly
Match: Cds (gene:FBgn0010350 transcript:FBtr0346546)

HSP 1 Score: 439.499 bits (1129), Expect = 9.479e-151
Identity = 237/461 (51.41%), Postives = 314/461 (68.11%), Query Frame = 2
Query:   77 EITMEVEDEVRRRNIHDEVKDKGDEISEELPKPNFVDIVPETGSGEDIEIMPSLSEIKNIPQGTDSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSK-VTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGL 1456
            +  +   D   +RN   +  D  D   E++P+  FVD +                  KN+PQGTD + E L+S L  +P +W+N+ IR I T +MI  FA +++ GP+AL+   +L+Q+ CF EII+IGY VY+   LPWFR+LSW+FL TSNYF +GE L+  F +++ +             + L+ LVT+HRF+SF LY  G VWFVLSLVKK+Y++QF+LF WTHV+LLI+VT S+ I+ NIF G+IWF+VPVSMI+CND+MAY+FGFFFGRTPLIKLSPKKTWEGFIGGG +T++F ILFS  L  Y YF+CP++Y + +G ++M CV + +F P  Y L      +  + K + LYP+  H I + +FSS++GPFGGFFASGFKRAFKIKDFGD+IPGHGGIMDRFDCQ LM  FV  Y +SFIR PSP  LL QI+ +  + Q   YQ L + L
Sbjct:   16 DTAISGSDAANKRNSAADSSDHVDSEEEKIPEEKFVDELA-----------------KNLPQGTDKTPEILDSALKDLPDRWKNWVIRGIFTWIMICGFALIIYGGPLALMITTLLVQVKCFQEIISIGYQVYRIHGLPWFRSLSWYFLLTSNYFFYGENLVDYFGVVINR------------VEYLKFLVTYHRFLSFALYIIGFVWFVLSLVKKYYIKQFSLFAWTHVSLLIVVTQSYLIIQNIFEGLIWFIVPVSMIVCNDVMAYVFGFFFGRTPLIKLSPKKTWEGFIGGGFATVLFGILFSYVLCNYQYFICPIQYSEEQGRMTMSCVPSYLFTPQEYSL-----KLFGIGKTLNLYPFIWHSISLSLFSSIIGPFGGFFASGFKRAFKIKDFGDMIPGHGGIMDRFDCQFLMATFVNVYISSFIRTPSPAKLLTQIYNLKPDQQYQIYQSLKDNL 442          
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Fly
Match: Cds (gene:FBgn0010350 transcript:FBtr0076688)

HSP 1 Score: 439.499 bits (1129), Expect = 9.479e-151
Identity = 237/461 (51.41%), Postives = 314/461 (68.11%), Query Frame = 2
Query:   77 EITMEVEDEVRRRNIHDEVKDKGDEISEELPKPNFVDIVPETGSGEDIEIMPSLSEIKNIPQGTDSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSK-VTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGL 1456
            +  +   D   +RN   +  D  D   E++P+  FVD +                  KN+PQGTD + E L+S L  +P +W+N+ IR I T +MI  FA +++ GP+AL+   +L+Q+ CF EII+IGY VY+   LPWFR+LSW+FL TSNYF +GE L+  F +++ +             + L+ LVT+HRF+SF LY  G VWFVLSLVKK+Y++QF+LF WTHV+LLI+VT S+ I+ NIF G+IWF+VPVSMI+CND+MAY+FGFFFGRTPLIKLSPKKTWEGFIGGG +T++F ILFS  L  Y YF+CP++Y + +G ++M CV + +F P  Y L      +  + K + LYP+  H I + +FSS++GPFGGFFASGFKRAFKIKDFGD+IPGHGGIMDRFDCQ LM  FV  Y +SFIR PSP  LL QI+ +  + Q   YQ L + L
Sbjct:   16 DTAISGSDAANKRNSAADSSDHVDSEEEKIPEEKFVDELA-----------------KNLPQGTDKTPEILDSALKDLPDRWKNWVIRGIFTWIMICGFALIIYGGPLALMITTLLVQVKCFQEIISIGYQVYRIHGLPWFRSLSWYFLLTSNYFFYGENLVDYFGVVINR------------VEYLKFLVTYHRFLSFALYIIGFVWFVLSLVKKYYIKQFSLFAWTHVSLLIVVTQSYLIIQNIFEGLIWFIVPVSMIVCNDVMAYVFGFFFGRTPLIKLSPKKTWEGFIGGGFATVLFGILFSYVLCNYQYFICPIQYSEEQGRMTMSCVPSYLFTPQEYSL-----KLFGIGKTLNLYPFIWHSISLSLFSSIIGPFGGFFASGFKRAFKIKDFGDMIPGHGGIMDRFDCQFLMATFVNVYISSFIRTPSPAKLLTQIYNLKPDQQYQIYQSLKDNL 442          
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Zebrafish
Match: cds2 (CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 [Source:ZFIN;Acc:ZDB-GENE-030717-4])

HSP 1 Score: 416.772 bits (1070), Expect = 1.044e-141
Identity = 230/466 (49.36%), Postives = 297/466 (63.73%), Query Frame = 2
Query:  101 EVRRRNI------HDEVKDKGDEISEELPKPNFVDIVPETGSGEDIEIMPSLSEIKNIPQGTDSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSKVTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGILPG 1480
            E+R+R        H   +DKG E   +           E     D E  P       +P   D + E LN  L  +  +W+N+ +R I+T  MI  F F+++LGPM L+ +V+ +Q+ CF EII IGY VY S DLPWFRTLSW+FL   NYF +GE +   F  L+ +E            + L+ L  +HRFISF LY  G   FVLSLVKKHY  QF +FGWTHVTLLI+VT SH I++N+F G+IWF+VP+S +ICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGG  ST++F IL S  +  Y YFVCP+E+++     +++C  + +F+   Y LPS L SI   + V LYP+  H I +  F+S++GPFGGFFASGFKRAFKIKDF + IPGHGGIMDRFDCQ LM  FV  Y  SFIR P+P+ ++QQ+  +  + QL  +  L   L  +G+LP 
Sbjct:    3 ELRQRGATDKELKHQHSEDKGSETEGK-----------ERDGASDSETKP------EVPVSADDTPEVLNKALSGLSSRWKNWWVRGILTLAMISFFFFIIYLGPMVLMMIVLCVQIKCFQEIITIGYSVYHSYDLPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQRE------------EPLRILSKYHRFISFALYLTGFCMFVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLIIHNLFEGMIWFIVPISCVICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGFFSTIVFGILLSYVMAGYSYFVCPVEFNNDSNRFTVDCQPSELFQLQDYSLPSVLQSITGWTTVKLYPFQIHSIALSSFASIMGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPSKVIQQLLALRPDQQLHIFNSLKAHLTEKGLLPA 439          
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Zebrafish
Match: cds1 (CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 1 [Source:ZFIN;Acc:ZDB-GENE-070705-78])

HSP 1 Score: 414.461 bits (1064), Expect = 1.026e-140
Identity = 227/459 (49.46%), Postives = 304/459 (66.23%), Query Frame = 2
Query:  101 EVRRRNIHDEVKDKGDEISEELPKPNFVDIVPETGSGEDIEIMPSLSEIKNIPQGTDSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSKVTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGILP 1477
            E+RRR   D+  D  + IS++    +     P+ G GE   +  S +E  + P  TD++ + LN  L+ +  +W+N+ IR I++  MI  F  +++LGP+ LI +V+ +Q+ CF+EII IGY VY S +LPWFRTLSW+FL   NYF +GE +   F  L+ +E            + LQ LV +HRFISF LY  G   FVLSLVKKHY  QF +F WTHVTLLI+VT SH ++ N+F G+IWF+VP+S++ICNDIMAY+FGFFFGRTPLIKLSPKKTWEGFIGG  +T++ +  F+  L +Y YFVCP+EYD      ++EC  + +F    Y LP+ + + +    V LYP+  H I +  F+S++GPFGGFFASGFKRAFKIKDF D IPGHGGIMDRFDCQ LM  FV+ Y  SFIR P+P+ +LQQ+  +    QL  +  L   L  +G+LP
Sbjct:    3 ELRRRGGGDQ--DSAENISDKEADGDDRLAFPDEGDGE--MVGDSKAETPDAPPSTDNTPQCLNKALEGLSSRWKNWWIRGILSLTMIIGFFLIIYLGPIMLIIVVMGVQIKCFHEIITIGYRVYHSYELPWFRTLSWYFLICVNYFFYGETVADYFGALVQRE------------EPLQFLVRYHRFISFALYLAGFCMFVLSLVKKHYRLQFYMFAWTHVTLLIVVTQSHLVIQNLFEGMIWFIVPISIVICNDIMAYLFGFFFGRTPLIKLSPKKTWEGFIGGFFATVVLSFFFAYLLSQYQYFVCPVEYDSETNRFAVECEPSNLFMIQEYTLPAVVQNALRWKTVNLYPFQIHSIALSSFASLIGPFGGFFASGFKRAFKIKDFADTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPSKVLQQLLVLQPEQQLGIFNTLRNQLREKGLLP 445          
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Zebrafish
Match: cds1 (CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 1 [Source:ZFIN;Acc:ZDB-GENE-070705-78])

HSP 1 Score: 405.216 bits (1040), Expect = 2.279e-137
Identity = 219/428 (51.17%), Postives = 290/428 (67.76%), Query Frame = 2
Query:  194 PETGSGEDIEIMPSLSEIKNIPQGTDSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSKVTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGILP 1477
            P+ G GE +    S +E  + P  TD++ + LN  L+ +  +W+N+ IR I++  MI  F  +++LGP+ LI +V+ +Q+ CF+EII IGY VY S +LPWFRTLSW+FL   NYF +GE +   F  L+ +E            + LQ LV +HRFISF LY  G   FVLSLVKKHY  QF +F WTHVTLLI+VT SH ++ N+F G+IWF+VP+S++ICNDIMAY+FGFFFGRTPLIKLSPKKTWEGFIGG  +T++ +  F+  L +Y YFVCP+EYD      ++EC  + +F    Y LP+ + + +    V LYP+  H I +  F+S++GPFGGFFASGFKRAFKIKDF D IPGHGGIMDRFDCQ LM  FV+ Y  SFIR P+P+ +LQQ+  +    QL  +  L   L  +G+LP
Sbjct:   11 PDEGDGEMVG--DSKAETPDAPPSTDNTPQCLNKALEGLSSRWKNWWIRGILSLTMIIGFFLIIYLGPIMLIIVVMGVQIKCFHEIITIGYRVYHSYELPWFRTLSWYFLICVNYFFYGETVADYFGALVQRE------------EPLQFLVRYHRFISFALYLAGFCMFVLSLVKKHYRLQFYMFAWTHVTLLIVVTQSHLVIQNLFEGMIWFIVPISIVICNDIMAYLFGFFFGRTPLIKLSPKKTWEGFIGGFFATVVLSFFFAYLLSQYQYFVCPVEYDSETNRFAVECEPSNLFMIQEYTLPAVVQNALRWKTVNLYPFQIHSIALSSFASLIGPFGGFFASGFKRAFKIKDFADTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPSKVLQQLLVLQPEQQLGIFNTLRNQLREKGLLP 424          
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Zebrafish
Match: BX469907.1 (CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 1 [Source:NCBI gene;Acc:100002015])

HSP 1 Score: 400.593 bits (1028), Expect = 1.381e-135
Identity = 220/428 (51.40%), Postives = 288/428 (67.29%), Query Frame = 2
Query:  194 PETGSGEDIEIMPSLSEIKNIPQGTDSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSKVTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGILP 1477
            P+ G GE +    S +E  + P  TD++ + LN  L+ +  +W+N+ IR I++  MI  F  +++LGP+ LI +V+ +Q+ CF+EII IGY VY S +LPWFRTLSW+FL   NYF +GE +   F  L+ +E            + LQ LV +HRFISF LY  G   FVLSLVKKHY  QF +F WTHVTLLI+VT SH ++ N+F G+IWF+VP+S++ICNDIMAY+FGFFFGRTPLIKLSPKKTWEGFIGG      FA +F+  L +Y YFVCP+EYD      ++EC  + +F    Y LP+ + + +    V LYP+  H I +  F+S++GPFGGFFASGFKRAFKIKDF D IPGHGGIMDRFDCQ LM  FV+ Y  SFIR P+P+ +LQQ+  +    QL  +  L   L  +G+LP
Sbjct:   18 PDEGDGEMVG--DSKAETPDAPPSTDNTPQCLNKALEGLSSRWKNWWIRGILSLTMIIGFFLIIYLGPIMLIIVVMGVQIKCFHEIITIGYRVYHSYELPWFRTLSWYFLICVNYFFYGETVADYFGALVQRE------------EPLQFLVRYHRFISFALYLAGFCMFVLSLVKKHYRLQFYMFAWTHVTLLIVVTQSHLVIQNLFEGMIWFIVPISIVICNDIMAYLFGFFFGRTPLIKLSPKKTWEGFIGG-----FFATVFAYLLSQYQYFVCPVEYDSETNRFAVECEPSNLFMIQEYTLPAVVQNALRWKTVNLYPFQIHSIALSSFASLIGPFGGFFASGFKRAFKIKDFADTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPSKVLQQLLVLQPEQQLGIFNTLRNQLREKGLLP 426          
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Zebrafish
Match: BX469907.1 (CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 1 [Source:NCBI gene;Acc:100002015])

HSP 1 Score: 400.593 bits (1028), Expect = 1.525e-135
Identity = 220/428 (51.40%), Postives = 288/428 (67.29%), Query Frame = 2
Query:  194 PETGSGEDIEIMPSLSEIKNIPQGTDSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSKVTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGILP 1477
            P+ G GE   +  S +E  + P  TD++ + LN  L+ +  +W+N+ IR I++  MI  F  +++LGP+ LI +V+ +Q+ CF+EII IGY VY S +LPWFRTLSW+FL   NYF +GE +   F  L+ +E            + LQ LV +HRFISF LY  G   FVLSLVKKHY  QF +F WTHVTLLI+VT SH ++ N+F G+IWF+VP+S++ICNDIMAY+FGFFFGRTPLIKLSPKKTWEGFIGG      FA +F+  L +Y YFVCP+EYD      ++EC  + +F    Y LP+ + + +    V LYP+  H I +  F+S++GPFGGFFASGFKRAFKIKDF D IPGHGGIMDRFDCQ LM  FV+ Y  SFIR P+P+ +LQQ+  +    QL  +  L   L  +G+LP
Sbjct:   20 PDEGDGE--MVGDSKAETPDAPPSTDNTPQCLNKALEGLSSRWKNWWIRGILSLTMIIGFFLIIYLGPIMLIIVVMGVQIKCFHEIITIGYRVYHSYELPWFRTLSWYFLICVNYFFYGETVADYFGALVQRE------------EPLQFLVRYHRFISFALYLAGFCMFVLSLVKKHYRLQFYMFAWTHVTLLIVVTQSHLVIQNLFEGMIWFIVPISIVICNDIMAYLFGFFFGRTPLIKLSPKKTWEGFIGG-----FFATVFAYLLSQYQYFVCPVEYDSETNRFAVECEPSNLFMIQEYTLPAVVQNALRWKTVNLYPFQIHSIALSSFASLIGPFGGFFASGFKRAFKIKDFADTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPSKVLQQLLVLQPEQQLGIFNTLRNQLREKGLLP 428          
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Xenopus
Match: akr1c8p (aldo-keto reductase family 1, member C8, pseudogene [Source:Xenbase;Acc:XB-GENE-5757727])

HSP 1 Score: 409.838 bits (1052), Expect = 6.422e-139
Identity = 226/457 (49.45%), Postives = 303/457 (66.30%), Query Frame = 2
Query:  101 EVRRRNIHDEVKDKGDEISEELPKPNFVDIVPETGSGEDIEIMPSLSEIKNIPQGTDSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSKVTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGI 1471
            E+RRR   +  +D G +  E   +  +V+        +DI+     S+I ++    DS+ E L   L  +  +W+N+ IR I +  MI +F FL+++GP+ LI LV  IQ+ CF EII+IG+ VY+S +LPWFRTLSW+FL   NYF +GE L   F  L+ +E            ++LQ L+ +HRFISF  Y  G   FVLSLVKKHY  QF +FGWTHVTLLI VT SH ++ N+F G+IWF+VP+S++ICNDIMAY+FGFFFGRTPLIKLSPKKTWEGFIGG   T+IF  LF+  L ++ YFVCP+EY     + S +C  + +FR   Y +P+YL  ++    V++YP+  H I +  F+S++GPFGGFFASGFKRAFKIKDF D IPGHGGIMDR DCQ LM  FV+ Y  SFIR P+P+ +LQQ+  +    QL+ Y+ L   L+ +G+
Sbjct:    3 ELRRRAPREPDQDSGTD-KETSTEGKYVE--------DDID-----SDIPDVLPFNDSTPEVLKPVLSGLSSRWKNWWIRGIFSLTMISLFFFLIYMGPVMLILLVSAIQVKCFQEIISIGHRVYRSYELPWFRTLSWYFLLCVNYFFYGETLADYFATLVQRE------------EMLQFLIRYHRFISFAFYLIGFCMFVLSLVKKHYRLQFYMFGWTHVTLLITVTQSHLVIQNLFEGMIWFIVPISIVICNDIMAYIFGFFFGRTPLIKLSPKKTWEGFIGGFFMTVIFGFLFAYILAQFQYFVCPVEYSSETNSFSTKCEPSEIFRLHYYIVPAYLQPLLGRRTVSMYPFQIHSIALSSFASLIGPFGGFFASGFKRAFKIKDFADTIPGHGGIMDRSDCQYLMATFVHVYIASFIRGPNPSKVLQQLLVLHPEQQLNIYKALRAHLIEKGM 433          
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Xenopus
Match: akr1c8p (aldo-keto reductase family 1, member C8, pseudogene [Source:Xenbase;Acc:XB-GENE-5757727])

HSP 1 Score: 403.29 bits (1035), Expect = 1.278e-136
Identity = 216/411 (52.55%), Postives = 284/411 (69.10%), Query Frame = 2
Query:  239 SEIKNIPQGTDSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSKVTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGI 1471
            S+I ++    DS+ E L   L  +  +W+N+ IR I +  MI +F FL+++GP+ LI LV  IQ+ CF EII+IG+ VY+S +LPWFRTLSW+FL   NYF +GE L   F  L+ +E            ++LQ L+ +HRFISF  Y  G   FVLSLVKKHY  QF +FGWTHVTLLI VT SH ++ N+F G+IWF+VP+S++ICNDIMAY+FGFFFGRTPLIKLSPKKTWEGFIGG   T+IF  LF+  L ++ YFVCP+EY     + S +C  + +FR   Y +P+YL  ++    V++YP+  H I +  F+S++GPFGGFFASGFKRAFKIKDF D IPGHGGIMDR DCQ LM  FV+ Y  SFIR P+P+ +LQQ+  +    QL+ Y+ L   L+ +G+
Sbjct:   14 SDIPDVLPFNDSTPEVLKPVLSGLSSRWKNWWIRGIFSLTMISLFFFLIYMGPVMLILLVSAIQVKCFQEIISIGHRVYRSYELPWFRTLSWYFLLCVNYFFYGETLADYFATLVQRE------------EMLQFLIRYHRFISFAFYLIGFCMFVLSLVKKHYRLQFYMFGWTHVTLLITVTQSHLVIQNLFEGMIWFIVPISIVICNDIMAYIFGFFFGRTPLIKLSPKKTWEGFIGGFFMTVIFGFLFAYILAQFQYFVCPVEYSSETNSFSTKCEPSEIFRLHYYIVPAYLQPLLGRRTVSMYPFQIHSIALSSFASLIGPFGGFFASGFKRAFKIKDFADTIPGHGGIMDRSDCQYLMATFVHVYIASFIRGPNPSKVLQQLLVLHPEQQLNIYKALRAHLIEKGM 412          
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Xenopus
Match: cds2 (CDP-diacylglycerol synthase 2 [Source:NCBI gene;Acc:100144929])

HSP 1 Score: 400.208 bits (1027), Expect = 3.293e-135
Identity = 224/457 (49.02%), Postives = 297/457 (64.99%), Query Frame = 2
Query:  122 HDEVKDKGDEISEELPKPNFVDIVPETGSGEDIEIMPSLSEIKNIPQGT--DSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSKVTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGILPG*N 1486
             D+ +++G+  SE       V    ET S  +     S ++     QGT  D + E LN  L ++  +W+N+ +R I+T  MI  F  +++LGP+ L+ +V+ +Q+ CF EII IGY VY S DLPWFRTLSW+FL   NYF +GE +   F  L+ +E            + L+ L  +HRFISF LY  G   FVLSLVKKHY  QF +FGWTHVTLLI+VT SH I++N+F G+IWF+VP+S +ICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGG  ST++F +L S  +  Y YFVCP+E+++     +++C  + +F+   Y +P+   S+I    V +YP+  H I +  F+S++GPFGGFFASGFKRAFKIKDF + IPGHGGIMDRFDCQ LM  FV  Y  SFIR P+P+ L+QQ  T+  + Q+  +  L   L   GIL   N
Sbjct:    8 QDQDQEQGEAESE-------VKTDGETASDSE-----SKTDTGGTQQGTPTDDTPEVLNRALANLSSRWKNWWVRGILTLAMISFFFIIIYLGPIVLMMIVMCVQIKCFQEIIMIGYNVYHSYDLPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQRE------------EPLRILSKYHRFISFALYLTGFCMFVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLIIHNLFEGMIWFIVPISCVICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGLLLSYVMAGYSYFVCPVEFNNETNRFTVDCEPSELFQLQEYHIPAMFHSVISWKTVWMYPFQIHSIALSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPSKLIQQFLTLRPDQQIHIFNTLKSHLTENGILANDN 440          
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Xenopus
Match: cds2 (CDP-diacylglycerol synthase 2 [Source:NCBI gene;Acc:100144929])

HSP 1 Score: 399.823 bits (1026), Expect = 1.204e-134
Identity = 223/452 (49.34%), Postives = 296/452 (65.49%), Query Frame = 2
Query:  125 DEVKDKGDEISEELPKPNFVDIVPETGSGEDIEIMPSLSEIKNIPQGT--DSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSKVTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGIL 1474
            D+ +++G+  SE       V    ET S  +     S ++     QGT  D + E LN  L ++  +W+N+ +R I+T  MI  F  +++LGP+ L+ +V+ +Q+ CF EII IGY VY S DLPWFRTLSW+FL   NYF +GE +   F  L+ +E            + L+ L  +HRFISF LY  G   FVLSLVKKHY  QF +FGWTHVTLLI+VT SH I++N+F G+IWF+VP+S +ICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGG  ST++F +L S  +  Y YFVCP+E+++     +++C  + +F+   Y +P+   S+I    V +YP+  H I +  F+S++GPFGGFFASGFKRAFKIKDF + IPGHGGIMDRFDCQ LM  FV  Y  SFIR P+P+ L+QQ  T+  + Q+  +  L   L   GIL
Sbjct:   31 DQDQEQGEAESE-------VKTDGETASDSE-----SKTDTGGTQQGTPTDDTPEVLNRALANLSSRWKNWWVRGILTLAMISFFFIIIYLGPIVLMMIVMCVQIKCFQEIIMIGYNVYHSYDLPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQRE------------EPLRILSKYHRFISFALYLTGFCMFVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLIIHNLFEGMIWFIVPISCVICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGLLLSYVMAGYSYFVCPVEFNNETNRFTVDCEPSELFQLQEYHIPAMFHSVISWKTVWMYPFQIHSIALSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPSKLIQQFLTLRPDQQIHIFNTLKSHLTENGIL 458          
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Xenopus
Match: cds2 (CDP-diacylglycerol synthase 2 [Source:NCBI gene;Acc:100144929])

HSP 1 Score: 398.667 bits (1023), Expect = 4.055e-134
Identity = 218/428 (50.93%), Postives = 285/428 (66.59%), Query Frame = 2
Query:  209 GEDIEIMPSLSEIKNIPQGT--DSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSKVTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGILPG*N 1486
            GE      S ++     QGT  D + E LN  L ++  +W+N+ +R I+T  MI  F  +++LGP+ L+ +V+ +Q+ CF EII IGY VY S DLPWFRTLSW+FL   NYF +GE +   F  L+ +E            + L+ L  +HRFISF LY  G   FVLSLVKKHY  QF +FGWTHVTLLI+VT SH I++N+F G+IWF+VP+S +ICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGG  ST++F +L S  +  Y YFVCP+E+++     +++C  + +F+   Y +P+   S+I    V +YP+  H I +  F+S++GPFGGFFASGFKRAFKIKDF + IPGHGGIMDRFDCQ LM  FV  Y  SFIR P+P+ L+QQ  T+  + Q+  +  L   L   GIL   N
Sbjct:   52 GETASDSESKTDTGGTQQGTPTDDTPEVLNRALANLSSRWKNWWVRGILTLAMISFFFIIIYLGPIVLMMIVMCVQIKCFQEIIMIGYNVYHSYDLPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQRE------------EPLRILSKYHRFISFALYLTGFCMFVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLIIHNLFEGMIWFIVPISCVICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGLLLSYVMAGYSYFVCPVEFNNETNRFTVDCEPSELFQLQEYHIPAMFHSVISWKTVWMYPFQIHSIALSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPSKLIQQFLTLRPDQQIHIFNTLKSHLTENGILANDN 467          
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Mouse
Match: Cds2 (CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 [Source:MGI Symbol;Acc:MGI:1332236])

HSP 1 Score: 406.371 bits (1043), Expect = 1.007e-137
Identity = 224/460 (48.70%), Postives = 298/460 (64.78%), Query Frame = 2
Query:  101 EVRRRNIHDEV--KDKGDEISEELPKPNFVDIVPETGSGEDIEIMPSLSEIKNIPQGTDSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSKVTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGIL 1474
            E+R+R + ++   +DK  E   +L              GE      S +E   +P   D + E LN  L ++  +W+N+ +R I+T  MI  F  +++LGPM L+ +V+ +Q+ CF+EII IGY VY S DLPWFRTLSW+FL   NYF +GE +   F  L+ +E            + L+ L  +HRFISF LY  G   FVLSLVKKHY  QF +FGWTHVTLLI+VT SH +++N+F G+IWF+VP+S +ICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGG  +T++F +L S  +  Y  FVCP+EY++   + +++C  + +FR   Y +P  + S I    V +YP+  H I +  F+S++GPFGGFFASGFKRAFKIKDF + IPGHGGIMDRFDCQ LM  FV  Y  SFIR P+P+ L+QQ  T+  + QL  +  L   L  +GIL
Sbjct:    3 ELRQRVVREDAPPEDKESESEAKL-------------DGETASDSESRAETAPLPTSVDDTPEVLNRALSNLSSRWKNWWVRGILTLAMIAFFFIIIYLGPMVLMMIVMCVQIKCFHEIITIGYNVYHSYDLPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQRE------------EPLRILSKYHRFISFALYLTGFCMFVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMSGYRCFVCPVEYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSAIGWKTVRMYPFQIHSIALSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPSKLIQQFLTLRPDQQLHIFNTLKSHLTDKGIL 437          
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Mouse
Match: Cds2 (CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 [Source:MGI Symbol;Acc:MGI:1332236])

HSP 1 Score: 403.29 bits (1035), Expect = 1.277e-136
Identity = 217/422 (51.42%), Postives = 284/422 (67.30%), Query Frame = 2
Query:  209 GEDIEIMPSLSEIKNIPQGTDSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSKVTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGIL 1474
            GE      S +E   +P   D + E LN  L ++  +W+N+ +R I+T  MI  F  +++LGPM L+ +V+ +Q+ CF+EII IGY VY S DLPWFRTLSW+FL   NYF +GE +   F  L+ +E            + L+ L  +HRFISF LY  G   FVLSLVKKHY  QF +FGWTHVTLLI+VT SH +++N+F G+IWF+VP+S +ICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGG  +T++F +L S  +  Y  FVCP+EY++   + +++C  + +FR   Y +P  + S I    V +YP+  H I +  F+S++GPFGGFFASGFKRAFKIKDF + IPGHGGIMDRFDCQ LM  FV  Y  SFIR P+P+ L+QQ  T+  + QL  +  L   L  +GIL
Sbjct:   11 GETASDSESRAETAPLPTSVDDTPEVLNRALSNLSSRWKNWWVRGILTLAMIAFFFIIIYLGPMVLMMIVMCVQIKCFHEIITIGYNVYHSYDLPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQRE------------EPLRILSKYHRFISFALYLTGFCMFVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMSGYRCFVCPVEYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSAIGWKTVRMYPFQIHSIALSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPSKLIQQFLTLRPDQQLHIFNTLKSHLTDKGIL 420          
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Mouse
Match: Cds1 (CDP-diacylglycerol synthase 1 [Source:MGI Symbol;Acc:MGI:1921846])

HSP 1 Score: 403.29 bits (1035), Expect = 2.993e-136
Identity = 216/412 (52.43%), Postives = 278/412 (67.48%), Query Frame = 2
Query:  239 SEIKNIPQGTDSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSKVTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGIL 1474
            S++  +P  +D + E L   L  +  +W+N+ IR I+T  MI +F  ++++G   L+ LV+ IQ+ CF+EII IGY VY S DLPWFRTLSW+FL   NYF +GE +   F   + +E Q            LQ L+ +HRFISF LY  G   FVLSLVKKHY  QF +F WTHVTLLI VT SH ++ N+F G+IWFLVP+S +ICNDI AY+FGFFFGRTPLIKLSPKKTWEGFIGG  ST+IF  + +  L KY YFVCP+EY     +   EC  + +F+   Y LP +L +++    V+LYP+  H I +  F+S++GPFGGFFASGFKRAFKIKDF + IPGHGGIMDRFDCQ LM  FV+ Y  SFIR P+P+ +LQQ+  +    QL+ Y+ L   L  +GIL
Sbjct:   56 SDVPEVPPSSDRTPEILKKALSGLSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYHSYDLPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQ------------LQFLIRYHRFISFALYLAGFCMFVLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYLFGFFFGRTPLIKLSPKKTWEGFIGGFFSTVIFGFIAAYVLSKYQYFVCPVEYRSDVNSFVTECEPSELFQLQNYSLPPFLQAVLSRETVSLYPFQIHSIALSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPSKVLQQLLVLQPEQQLNIYRTLKIHLTEKGIL 455          
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Mouse
Match: Cds2 (CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 [Source:MGI Symbol;Acc:MGI:1332236])

HSP 1 Score: 112.464 bits (280), Expect = 3.024e-28
Identity = 79/186 (42.47%), Postives = 105/186 (56.45%), Query Frame = 2
Query:  986 LFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSKVTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFI-----------------------RIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGIL 1474
            L S  +  Y  FVCP+EY++   + +++C  + +FR   Y +P  + S I    V +YP+  H I +  F+S++GPFGGFFASGFKRAFKIKDF + IPGHGGIMDRFDCQ LM  FV  Y  SFI                       R P+P+ L+QQ  T+  + QL  +  L   L  +GIL
Sbjct:    2 LLSYVMSGYRCFVCPVEYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSAIGWKTVRMYPFQIHSIALSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFISTPWVTGPARQLAPAQGCLMFCCRGPNPSKLIQQFLTLRPDQQLHIFNTLKSHLTDKGIL 187          
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Mouse
Match: Cds2 (CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 [Source:MGI Symbol;Acc:MGI:1332236])

HSP 1 Score: 101.293 bits (251), Expect = 5.070e-25
Identity = 53/140 (37.86%), Postives = 79/140 (56.43%), Query Frame = 2
Query:  101 EVRRRNIHDEV--KDKGDEISEELPKPNFVDIVPETGSGEDIEIMPSLSEIKNIPQGTDSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSW 514
            E+R+R + ++   +DK  E   +L              GE      S +E   +P   D + E LN  L ++  +W+N+ +R I+T  MI  F  +++LGPM L+ +V+ +Q+ CF+EII IGY VY S DLPWFRTLSW
Sbjct:    3 ELRQRVVREDAPPEDKESESEAKL-------------DGETASDSESRAETAPLPTSVDDTPEVLNRALSNLSSRWKNWWVRGILTLAMIAFFFIIIYLGPMVLMMIVMCVQIKCFHEIITIGYNVYHSYDLPWFRTLSW 129          
BLAST of Phosphatidate cytidylyltransferase vs. UniProt/SwissProt
Match: sp|P56079|CDS_DROME (Phosphatidate cytidylyltransferase, photoreceptor-specific OS=Drosophila melanogaster OX=7227 GN=Cds PE=1 SV=2)

HSP 1 Score: 439.499 bits (1129), Expect = 9.502e-150
Identity = 237/461 (51.41%), Postives = 314/461 (68.11%), Query Frame = 2
Query:   77 EITMEVEDEVRRRNIHDEVKDKGDEISEELPKPNFVDIVPETGSGEDIEIMPSLSEIKNIPQGTDSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSK-VTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGL 1456
            +  +   D   +RN   +  D  D   E++P+  FVD +                  KN+PQGTD + E L+S L  +P +W+N+ IR I T +MI  FA +++ GP+AL+   +L+Q+ CF EII+IGY VY+   LPWFR+LSW+FL TSNYF +GE L+  F +++ +             + L+ LVT+HRF+SF LY  G VWFVLSLVKK+Y++QF+LF WTHV+LLI+VT S+ I+ NIF G+IWF+VPVSMI+CND+MAY+FGFFFGRTPLIKLSPKKTWEGFIGGG +T++F ILFS  L  Y YF+CP++Y + +G ++M CV + +F P  Y L      +  + K + LYP+  H I + +FSS++GPFGGFFASGFKRAFKIKDFGD+IPGHGGIMDRFDCQ LM  FV  Y +SFIR PSP  LL QI+ +  + Q   YQ L + L
Sbjct:   16 DTAISGSDAANKRNSAADSSDHVDSEEEKIPEEKFVDELA-----------------KNLPQGTDKTPEILDSALKDLPDRWKNWVIRGIFTWIMICGFALIIYGGPLALMITTLLVQVKCFQEIISIGYQVYRIHGLPWFRSLSWYFLLTSNYFFYGENLVDYFGVVINR------------VEYLKFLVTYHRFLSFALYIIGFVWFVLSLVKKYYIKQFSLFAWTHVSLLIVVTQSYLIIQNIFEGLIWFIVPVSMIVCNDVMAYVFGFFFGRTPLIKLSPKKTWEGFIGGGFATVLFGILFSYVLCNYQYFICPIQYSEEQGRMTMSCVPSYLFTPQEYSL-----KLFGIGKTLNLYPFIWHSISLSLFSSIIGPFGGFFASGFKRAFKIKDFGDMIPGHGGIMDRFDCQFLMATFVNVYISSFIRTPSPAKLLTQIYNLKPDQQYQIYQSLKDNL 442          
BLAST of Phosphatidate cytidylyltransferase vs. UniProt/SwissProt
Match: sp|O95674|CDS2_HUMAN (Phosphatidate cytidylyltransferase 2 OS=Homo sapiens OX=9606 GN=CDS2 PE=1 SV=1)

HSP 1 Score: 410.994 bits (1055), Expect = 1.356e-138
Identity = 227/458 (49.56%), Postives = 301/458 (65.72%), Query Frame = 2
Query:  101 EVRRRNIHDEVKDKGDEISEELPKPNFVDIVPETGSGEDIEIMPSLSEIKNIPQGTDSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSKVTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGIL 1474
            E+R+R  H+ V    D+ SE   K   VD       GE      S +E   +P   D + E LN  L ++  +W+N+ +R I+T  MI  F  +++LGPM L+ +V+ +Q+ CF+EII IGY VY S DLPWFRTLSW+FL   NYF +GE +   F  L+ +E            + L+ L  +HRFISF LY  G   FVLSLVKKHY  QF +FGWTHVTLLI+VT SH +++N+F G+IWF+VP+S +ICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGG  +T++F +L S  +  Y  FVCP+EY++   + +++C  + +FR   Y +P  + S+I    V +YP+  H I +  F+S++GPFGGFFASGFKRAFKIKDF + IPGHGGIMDRFDCQ LM  FV  Y  SFIR P+P+ L+QQ  T+  + QL  +  L   L+ +G+L
Sbjct:    3 ELRQRVAHEPVAPPEDKESESEAK---VD-------GETASDSESRAESAPLPVSADDTPEVLNRALSNLSSRWKNWWVRGILTLAMIAFFFIIIYLGPMVLMIIVMCVQIKCFHEIITIGYNVYHSYDLPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQRE------------EPLRILSKYHRFISFTLYLIGFCMFVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMSGYRCFVCPVEYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSVIGWKTVRMYPFQIHSIALSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPSKLIQQFLTLRPDQQLHIFNTLRSHLIDKGML 438          
BLAST of Phosphatidate cytidylyltransferase vs. UniProt/SwissProt
Match: sp|Q92903|CDS1_HUMAN (Phosphatidate cytidylyltransferase 1 OS=Homo sapiens OX=9606 GN=CDS1 PE=1 SV=2)

HSP 1 Score: 409.068 bits (1050), Expect = 1.487e-137
Identity = 225/451 (49.89%), Postives = 292/451 (64.75%), Query Frame = 2
Query:  122 HDEVKDKGDEISEELPKPNFVDIVPETGSGEDIEIMPSLSEIKNIPQGTDSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSKVTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGIL 1474
            H E +  G +   E       DI    G   D++     S+I  IP  +D + E L   L  +  +W+N+ IR I+T  MI +F  ++++G   L+ LV+ IQ+ CF+EII IGY VY S DLPWFRTLSW+FL   NYF +GE +   F   + +E Q            LQ L+ +HRFISF LY  G   FVLSLVKKHY  QF +F WTHVTLLI VT SH ++ N+F G+IWFLVP+S +ICNDI AY+FGFFFGRTPLIKLSPKKTWEGFIGG  ST++F  + +  L KY YFVCP+EY     +   EC  + +F+   Y LP +L +++   +V+LYP+  H I +  F+S++GPFGGFFASGFKRAFKIKDF + IPGHGGIMDRFDCQ LM  FV+ Y  SFIR P+P+ +LQQ+  +    QL+ Y+ L   L+ +GIL
Sbjct:   21 HREGEAAGGDHETESTSDKETDIDDRYG---DLDSRTD-SDIPEIPPSSDRTPEILKKALSGLSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYHSYDLPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQ------------LQFLIRYHRFISFALYLAGFCMFVLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYLFGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGFIAAYVLSKYQYFVCPVEYRSDVNSFVTECEPSELFQLQTYSLPPFLKAVLRQERVSLYPFQIHSIALSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPSKVLQQLLVLQPEQQLNIYKTLKTHLIEKGIL 455          
BLAST of Phosphatidate cytidylyltransferase vs. UniProt/SwissProt
Match: sp|Q99L43|CDS2_MOUSE (Phosphatidate cytidylyltransferase 2 OS=Mus musculus OX=10090 GN=Cds2 PE=1 SV=1)

HSP 1 Score: 406.371 bits (1043), Expect = 7.046e-137
Identity = 224/460 (48.70%), Postives = 298/460 (64.78%), Query Frame = 2
Query:  101 EVRRRNIHDEV--KDKGDEISEELPKPNFVDIVPETGSGEDIEIMPSLSEIKNIPQGTDSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSKVTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGIL 1474
            E+R+R + ++   +DK  E   +L              GE      S +E   +P   D + E LN  L ++  +W+N+ +R I+T  MI  F  +++LGPM L+ +V+ +Q+ CF+EII IGY VY S DLPWFRTLSW+FL   NYF +GE +   F  L+ +E            + L+ L  +HRFISF LY  G   FVLSLVKKHY  QF +FGWTHVTLLI+VT SH +++N+F G+IWF+VP+S +ICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGG  +T++F +L S  +  Y  FVCP+EY++   + +++C  + +FR   Y +P  + S I    V +YP+  H I +  F+S++GPFGGFFASGFKRAFKIKDF + IPGHGGIMDRFDCQ LM  FV  Y  SFIR P+P+ L+QQ  T+  + QL  +  L   L  +GIL
Sbjct:    3 ELRQRVVREDAPPEDKESESEAKL-------------DGETASDSESRAETAPLPTSVDDTPEVLNRALSNLSSRWKNWWVRGILTLAMIAFFFIIIYLGPMVLMMIVMCVQIKCFHEIITIGYNVYHSYDLPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQRE------------EPLRILSKYHRFISFALYLTGFCMFVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMSGYRCFVCPVEYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSAIGWKTVRMYPFQIHSIALSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPSKLIQQFLTLRPDQQLHIFNTLKSHLTDKGIL 437          
BLAST of Phosphatidate cytidylyltransferase vs. UniProt/SwissProt
Match: sp|A0JNC1|CDS2_BOVIN (Phosphatidate cytidylyltransferase 2 OS=Bos taurus OX=9913 GN=CDS2 PE=2 SV=1)

HSP 1 Score: 404.445 bits (1038), Expect = 4.135e-136
Identity = 224/458 (48.91%), Postives = 295/458 (64.41%), Query Frame = 2
Query:  101 EVRRRNIHDEVKDKGDEISEELPKPNFVDIVPETGSGEDIEIMPSLSEIKNIPQGTDSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSKVTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGIL 1474
            E+R+R   +      D+ SE   K +          GE      S  E    P   D + E LN  L ++  +W+N+ +R I+T  MI  F  +++LGPM L+ +V+ +Q+ CF+EII IGY VY S DLPWFRTLSW+FL   NYF +GE +   F  L+ +E            + L+ L  +HRFISF LY  G   FVLSLVKKHY  QF +FGWTHVTLLI+VT SH +++N+F G+IWF+VP+S +ICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGG  +T++F +L S  +  Y  FVCP+EY++   + +++C  + +FR   Y +P  + SII    V +YP+  H I +  F+S++GPFGGFFASGFKRAFKIKDF + IPGHGGIMDRFDCQ LM  FV  Y  SFIR P+P+ L+QQ  T+  + QL  +  L   L  +G+L
Sbjct:    3 ELRQRVAREPEAPPEDKESESEAKAD----------GETASDSESRVEAVTQPPSADDTPEVLNRALSNLSSRWKNWWVRGILTLAMIAFFFIIIYLGPMVLMMIVMCVQIKCFHEIITIGYNVYHSYDLPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQRE------------EPLRILSKYHRFISFTLYLTGFCMFVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMSGYRCFVCPVEYNNDTNSFTVDCEPSGLFRLQEYNIPGVIQSIIGWKTVRMYPFQIHSIALSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPSKLVQQFLTLRPDQQLHIFNTLKSHLTDKGML 438          
BLAST of Phosphatidate cytidylyltransferase vs. TrEMBL
Match: A0A267EJ28 (Phosphatidate cytidylyltransferase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030952g1 PE=3 SV=1)

HSP 1 Score: 507.679 bits (1306), Expect = 5.666e-174
Identity = 263/462 (56.93%), Postives = 341/462 (73.81%), Query Frame = 2
Query:   95 EDEVRRRNIHDEVKDKGDEISEELPKPNFVDIVPETGSGEDIEIMPSLSEIKNIPQGTDSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSKVTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGILPG 1480
             DEVRRR +     D  D+                    E        +  ++I QGTD S   L   L  +P +W+N+ +R IM+ +MI +F+ +V+LGP+A++ L+++IQ+MCF EIINIGY+VYKSQDLPWFRTLSWFFLFTSNYF FGE +I  FRILL ++              LQ L+T+HRFISFCLYC GIV FV+SLVKKHYLQQFTLFGWTH+ LL++VTSSHF++ N+FNG+IW L+P SMIICNDIMAYMFGFFFG+TPLIKLSPKKTWEGFIGGG+ST++F++L S  LI++D+FVCPLEYD+V  A+SM CVR+ +F    + +P  +  ++ +S +  YP++ H IIM  F+S VGPFGGFFASGFKRAFKIKDFGDLIPGHGG+ DRFDCQ++MG FVY Y+ +FI + SP+ LL+Q++++  +DQL FY+ LT+GL +RG+L G
Sbjct:   27 SDEVRRRKVAS--ADSADD--------------------EPAAAPVDPAVAQSIGQGTDQSPGILQRLLAPLPPRWQNWVVRGIMSIVMIVIFSVIVYLGPLAMVVLILIIQMMCFYEIINIGYVVYKSQDLPWFRTLSWFFLFTSNYFFFGESMIDQFRILLQRD------------QFLQPLLTYHRFISFCLYCGGIVGFVVSLVKKHYLQQFTLFGWTHMALLVLVTSSHFMIRNVFNGVIWLLLPSSMIICNDIMAYMFGFFFGKTPLIKLSPKKTWEGFIGGGLSTILFSVLLSHFLIQFDFFVCPLEYDEVSDAVSMNCVRHWIFERSTFHIP-VVGKLLFLSSIPWYPFYWHSIIMATFASFVGPFGGFFASGFKRAFKIKDFGDLIPGHGGMTDRFDCQIIMGTFVYVYFQTFIMVTSPHHLLRQVYSLRPDDQLKFYEALTDGLTKRGLLNG 453          
BLAST of Phosphatidate cytidylyltransferase vs. TrEMBL
Match: A0A267FTP3 (Phosphatidate cytidylyltransferase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030952g3 PE=3 SV=1)

HSP 1 Score: 507.679 bits (1306), Expect = 6.049e-174
Identity = 263/462 (56.93%), Postives = 341/462 (73.81%), Query Frame = 2
Query:   95 EDEVRRRNIHDEVKDKGDEISEELPKPNFVDIVPETGSGEDIEIMPSLSEIKNIPQGTDSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSKVTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGILPG 1480
             DEVRRR +     D  D+                    E        +  ++I QGTD S   L   L  +P +W+N+ +R IM+ +MI +F+ +V+LGP+A++ L+++IQ+MCF EIINIGY+VYKSQDLPWFRTLSWFFLFTSNYF FGE +I  FRILL ++              LQ L+T+HRFISFCLYC GIV FV+SLVKKHYLQQFTLFGWTH+ LL++VTSSHF++ N+FNG+IW L+P SMIICNDIMAYMFGFFFG+TPLIKLSPKKTWEGFIGGG+ST++F++L S  LI++D+FVCPLEYD+V  A+SM CVR+ +F    + +P  +  ++ +S +  YP++ H IIM  F+S VGPFGGFFASGFKRAFKIKDFGDLIPGHGG+ DRFDCQ++MG FVY Y+ +FI + SP+ LL+Q++++  +DQL FY+ LT+GL +RG+L G
Sbjct:   27 SDEVRRRKVAS--ADSADD--------------------EPAAAPVDPAVAQSIGQGTDQSPGILQRLLAPLPPRWQNWVVRGIMSIVMIVIFSVIVYLGPLAMVVLILIIQMMCFYEIINIGYVVYKSQDLPWFRTLSWFFLFTSNYFFFGESMIDQFRILLQRD------------QFLQPLLTYHRFISFCLYCGGIVGFVVSLVKKHYLQQFTLFGWTHMALLVLVTSSHFMIRNVFNGVIWLLLPSSMIICNDIMAYMFGFFFGKTPLIKLSPKKTWEGFIGGGLSTILFSVLLSHFLIQFDFFVCPLEYDEVSDAVSMNCVRHWIFERSTFHIP-VVGKLLFLSSIPWYPFYWHSIIMATFASFVGPFGGFFASGFKRAFKIKDFGDLIPGHGGMTDRFDCQIIMGTFVYVYFQTFIMVTSPHHLLRQVYSLRPDDQLKFYEALTDGLTKRGLLNG 453          
BLAST of Phosphatidate cytidylyltransferase vs. TrEMBL
Match: A0A430Q5T9 (Phosphatidate cytidylyltransferase OS=Schistosoma bovis OX=6184 GN=DC041_0004769 PE=3 SV=1)

HSP 1 Score: 506.908 bits (1304), Expect = 5.226e-173
Identity = 262/422 (62.09%), Postives = 329/422 (77.96%), Query Frame = 2
Query:  224 IMPSLSEIKNIPQGTDSS---FEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSKVTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGILPG 1480
            I P     + + QGT       +FLN FL   P +W N+T+R     L+I  F  L++LGP+AL+ +V+ IQL CF EIINIGY+VY+S DLPWFR LSW+FLFTSNY+LFGE LI  FR+LLAKE            D LQ  +THH+FISF LYC GIV FVLSLVK+HY++QFTLFGWTHVTLLI VTSS+F + NIFNG+IWFL+PV ++ICNDIMAY+FGFF+G+TPLIKLSPKKTWEGFIGGG+ST++F+IL S  L+KYDYFVCP+E+DD KG+L+M C RNPVF   IY+LP YL   +P+ ++T YP+ +HC+I+ +++SVVGPFGGFFASGFKRAFKIKDFGD  PGHGG++DRFDCQ+++G FV FYYNSF+R  SP SLL +I+ +P N Q+ FY+ LT+GL +RG+LP 
Sbjct:   59 IRPDFEAAEKLHQGTSHVPPIIDFLNKFL---PPRWVNWTVRLFTGLLLISGFTLLIYLGPLALVLMVLAIQLACFYEIINIGYLVYRSHDLPWFRLLSWYFLFTSNYYLFGESLIARFRLLLAKE------------DFLQPWITHHQFISFSLYCAGIVAFVLSLVKRHYIKQFTLFGWTHVTLLIFVTSSYFCIENIFNGLIWFLLPVCLVICNDIMAYVFGFFYGKTPLIKLSPKKTWEGFIGGGLSTILFSILLSYILLKYDYFVCPIEWDDTKGSLTMNCSRNPVFIAQIYDLPKYL-FFLPIRQITWYPFLQHCLIISIYTSVVGPFGGFFASGFKRAFKIKDFGDFFPGHGGVVDRFDCQLIIGTFVLFYYNSFVRTYSPVSLLPKIYILPPNAQILFYRLLTDGLYKRGLLPN 464          
BLAST of Phosphatidate cytidylyltransferase vs. TrEMBL
Match: A0A095AP07 (Phosphatidate cytidylyltransferase OS=Schistosoma haematobium OX=6185 GN=MS3_04292 PE=3 SV=1)

HSP 1 Score: 506.908 bits (1304), Expect = 6.309e-173
Identity = 262/422 (62.09%), Postives = 328/422 (77.73%), Query Frame = 2
Query:  224 IMPSLSEIKNIPQGTDSS---FEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSKVTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGILPG 1480
            I P     + + QGT        FLN FL   P +W N+T+R     L+I  F  L++LGP+AL+ +V+ IQL CF EIINIGY+VY+S DLPWFR LSW+FLFTSNY+LFGE LI  FR+LLAKE            D LQ  +THH+FISF LYC GIV FVLSLVK+HY++QFTLFGWTHVTLLI VTSS+F + NIFNG+IWFL+PV ++ICNDIMAY+FGFF+G+TPLIKLSPKKTWEGFIGGG+ST++F+IL S  L+KYDYFVCP+E+DD KG+L+M C RNPVF   IY+LP YL   +P+ ++T YP+ +HC+I+ +++SVVGPFGGFFASGFKRAFKIKDFGD  PGHGG++DRFDCQ+++G FV FYYNSF+R  SP SLL +I+ +P N Q+ FY+ LT+GL +RG+LP 
Sbjct:   58 IRPDFEAAEKLHQGTSHVPPIINFLNKFL---PPRWVNWTVRLFTGLLLISGFTLLIYLGPLALVLMVLAIQLACFYEIINIGYLVYRSHDLPWFRLLSWYFLFTSNYYLFGESLIARFRLLLAKE------------DFLQPWITHHQFISFSLYCAGIVAFVLSLVKRHYIKQFTLFGWTHVTLLIFVTSSYFCIENIFNGLIWFLLPVCLVICNDIMAYVFGFFYGKTPLIKLSPKKTWEGFIGGGLSTILFSILLSYILLKYDYFVCPIEWDDTKGSLTMNCTRNPVFIAQIYDLPKYL-FFLPIRQITWYPFLQHCLIISIYTSVVGPFGGFFASGFKRAFKIKDFGDFFPGHGGVVDRFDCQLIIGTFVLFYYNSFVRTYSPVSLLPKIYILPPNAQILFYRLLTDGLYKRGLLPN 463          
BLAST of Phosphatidate cytidylyltransferase vs. TrEMBL
Match: G4VKI9 (Phosphatidate cytidylyltransferase OS=Schistosoma mansoni OX=6183 GN=Smp_144030 PE=3 SV=1)

HSP 1 Score: 504.597 bits (1298), Expect = 5.209e-172
Identity = 272/484 (56.20%), Postives = 348/484 (71.90%), Query Frame = 2
Query:   86 MEVEDEVRRRNIHDEVK----------------DKGDEISEELPKPNFVDIVPETGSGEDIEIMPSLSEIKNIPQGTDSS---FEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSKVTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGILPG 1480
            M  +D++ R+   D V+                D  D++S    + +  D   E    +   I P     + + QGT        FLN  L   P +W N+T+R     L+I  F  L++LGP+AL+ +V+ IQL CF EIINIGY+VY+S DLPWFR LSW+FLFTSNY+LFGE LI  FR+LLAKE            D LQ  +THH+FISF LYC GIV FVLSLVK+HY++QFTLFGWTHVTLLI VTSS+F + NIFNG+IWFL+PV ++ICNDIMAY+FGFF+G+TPLIKLSPKKTWEGFIGGG+ST++F+IL S  L+KYDYFVCP+E+DD KG+L+M C RNPVF   IY+LP YL   +P+ ++T YP+ +HC+I+ +++SVVGPFGGFFASGFKRAFKIKDFGDL PGHGG++DRFDCQ+++G FV FYYNSF+R  SP SLL +I+ +P N Q+ FY+ LT+GL +RG+LP 
Sbjct:    1 MSDDDQIVRQRTGDVVEPTSITASSTTSNTINIDTQDDVSNTKKQTSDDDDDDE----QIDPIRPDFEAAEKLHQGTSHVPPIIGFLNKLL---PPRWVNWTVRLFTGLLLISGFTLLIYLGPLALVLMVLAIQLACFYEIINIGYLVYRSHDLPWFRLLSWYFLFTSNYYLFGESLITRFRLLLAKE------------DFLQPWITHHQFISFSLYCAGIVAFVLSLVKRHYIKQFTLFGWTHVTLLIFVTSSYFCIENIFNGLIWFLLPVCLVICNDIMAYIFGFFYGKTPLIKLSPKKTWEGFIGGGLSTILFSILLSYILLKYDYFVCPIEWDDTKGSLTMNCTRNPVFIAQIYDLPKYL-FFLPIRQITWYPFLQHCLIISIYTSVVGPFGGFFASGFKRAFKIKDFGDLFPGHGGVVDRFDCQLIIGTFVLFYYNSFVRTYSPVSLLPKIYVLPPNAQILFYRLLTDGLNKRGLLPN 464          
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Cavefish
Match: cds1 (phosphatidate cytidylyltransferase 1 [Source:NCBI gene;Acc:103029818])

HSP 1 Score: 412.149 bits (1058), Expect = 6.346e-140
Identity = 230/462 (49.78%), Postives = 303/462 (65.58%), Query Frame = 2
Query:  101 EVRRRNIHDEVKDKGDEISEELPKPNFVDIVPETGSGE---DIEIMPSLSEIKNIPQGTDSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSKVTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGILP 1477
            E+RRR       D  + IS++         +P  G GE   D +     ++  + P  TD++ + LN  L+ +  +W+N+ IR I++  MI  F  +++LGP+ LIF+V+ IQ+ CF EII IGY VY+S DLPWFRTLSW+FL   NYF +GE +   F  L+ +E            + LQ LV +HRFISF LY  G   FVLSLVKKHY  QF +F WTHVTLLI+VT SH ++ N+F G+IWF+VP+S++ICNDIMAY+FGFFFGRTPLIKLSPKKTWEGFIGG  ST+  + LF+  L +Y YFVCP+EY+      ++EC  + +F    Y LP  + +I+    V LYP+  H I +  F+S++GPFGGFFASGFKRAFKIKDF D IPGHGGIMDRFDCQ LM  FV+ Y  SFIR P+P+ +LQQ+  +    QL+ +  L   L  +G+LP
Sbjct:    3 ELRRRGAGGGDPDSAENISDKEADGEDRLGLPSEGEGEMEGDCK-----ADTPDAPPPTDNTPQCLNKALEGLSSRWKNWWIRGILSLTMIIGFFLIIYLGPLMLIFVVMSIQIKCFQEIIQIGYRVYRSYDLPWFRTLSWYFLICVNYFFYGETVADYFGALVQRE------------EPLQFLVRYHRFISFALYLAGFCMFVLSLVKKHYRLQFYMFAWTHVTLLIVVTQSHLVIQNLFEGMIWFIVPISIVICNDIMAYLFGFFFGRTPLIKLSPKKTWEGFIGGFFSTVFLSFLFAYLLSQYQYFVCPVEYNSETNRFAVECEPSDLFVIQEYTLPVMVQNILRWKTVNLYPFQIHSIALSSFASLIGPFGGFFASGFKRAFKIKDFADTIPGHGGIMDRFDCQYLMATFVHVYIASFIRGPNPSKVLQQLLVLQPEQQLNIFNTLRNHLREKGMLP 447          
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Cavefish
Match: cds2 (CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 [Source:ZFIN;Acc:ZDB-GENE-030717-4])

HSP 1 Score: 365.54 bits (937), Expect = 3.480e-122
Identity = 212/419 (50.60%), Postives = 274/419 (65.39%), Query Frame = 2
Query:  239 SEIKNIPQGTDSSFEFLNSFLDSIPIK-WRNYTIR------FIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSKVTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGIL 1474
            + +  +P   D + E LN  L  +  + W+N  +R      F    L++ V + L FL   A    V+++Q+ CF+EII IGY VY S  LPWFRTLSW+FL   NYF +GE +   F  L+ +E            + L+ L  +HRFISF LY  G   FVLSLVKKHY  QF +FGWTHVTLLI+VT SH I++N+F G+IWF+VP+S +ICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGG  +T++F IL S  +  Y YFVCP+E+ +   + +++C  + +F+   Y LP+ L SI   + V LYP+  H I +  F+S++GPFGGFFASGFKRAFKIKDF + IPGHGGIMDRFDCQ LM  FV  Y  SFIR P+P  ++QQ+  +  + QL  Y  L   L  RG+L
Sbjct:    4 TGVPEVPVPADDTPEVLNKALSGLSSRCWKNLKVRGATISIFYRNQLILYVISDL-FLWLCAR--QVLIVQIKCFHEIITIGYSVYHSYHLPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQRE------------EPLRILSKYHRFISFALYLTGFCMFVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLIIHNLFEGMIWFIVPISCVICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGILLSYVMAGYRYFVCPVEFSNDSNSFTVDCEPSELFQLQDYTLPTVLESITGWTTVKLYPFQIHSIALSAFASIMGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPTKVIQQLLALRPDQQLYIYNSLKTHLTERGLL 407          
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Sea Lamprey
Match: cds2 (CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 [Source:ZFIN;Acc:ZDB-GENE-030717-4])

HSP 1 Score: 392.119 bits (1006), Expect = 7.150e-133
Identity = 208/404 (51.49%), Postives = 279/404 (69.06%), Query Frame = 2
Query:  263 GTDSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSKVTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGIL 1474
            G D++ E LN  L  +  +WRN+ +R I++  MIG F  +++LGP+ L+ +V+ +Q+ CF+EII IGY VY S +LPWFRTLSW+FL   NYF +GE +   F  L+ +E            + L+ L  +HRFISF LY  G   FVLSLVKK Y  QF +FGWTHVTLLI+VT SH ++ N+F G+IWF+VP+SM+ICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGG  +T++F ++ S  +    YFVCP+ Y+      +++C  + +F    Y +P+ + S+I    V LYP+  H I +  F+S++GPFGGFFASGFKRAFKIKDF D IPGHGGIMDRFDCQ LM  FV+ Y  SFI+ P+P  LLQQ+  +  + Q+  +Q L + L+ +G++
Sbjct:   46 GADNTPEVLNKALSGMSSRWRNWWVRGILSLAMIGFFFIIIYLGPLVLMLIVLGVQIKCFHEIITIGYNVYHSYELPWFRTLSWYFLLCVNYFFYGETVADYFFSLVQRE------------EPLRLLFRYHRFISFTLYLTGFCMFVLSLVKKQYRLQFYMFGWTHVTLLIVVTQSHLVIQNLFEGMIWFIVPISMVICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLILSYLMAGIPYFVCPVAYNSETSRFTVDCHPSELFHLHEYSVPAVVQSVIGWKTVRLYPFQIHSIALSTFASLMGPFGGFFASGFKRAFKIKDFADTIPGHGGIMDRFDCQYLMATFVHVYMASFIKGPNPAKLLQQLLVLRPDQQIQIFQALRDSLMGKGLI 437          
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001308.1 (pep scaffold:Pmarinus_7.0:GL489389:717:4774:-1 gene:ENSPMAG00000001178.1 transcript:ENSPMAT00000001308.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 172.17 bits (435), Expect = 1.018e-51
Identity = 82/149 (55.03%), Postives = 108/149 (72.48%), Query Frame = 2
Query:  689 GIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLE----YDDVKGALSMECVRNPVFRPVIYELPSYL 1123
            G+  FVLSLVK++   QF +FGWTH+TLL+IVT SH +++N+F G+IWF+ P+ ++ICNDI AY+FGFFFGRTPLI++SPKKTWEGFIGG +STL+F IL S  L  + YFVC +E          A +MEC  + +FR   Y  P+ L
Sbjct:    2 GLCMFVLSLVKRYTRLQFYMFGWTHITLLLIVTQSHLVIHNLFEGMIWFVFPMCVVICNDIAAYIFGFFFGRTPLIEVSPKKTWEGFIGGYISTLVFGILLSHVLCGHRYFVCAVEPSGGTAARAAAFTMECEPSEMFRLTRYHAPALL 150          
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Yeast
Match: CDS1 (Phosphatidate cytidylyltransferase (CDP-diglyceride synthetase); an enzyme that catalyzes that conversion of CTP + phosphate into diphosphate + CDP-diaclglyerol, a critical step in the synthesis of all major yeast phospholipids; human homolog CDS1 can complement yeast cds1 null mutant [Source:SGD;Acc:S000000233])

HSP 1 Score: 231.876 bits (590), Expect = 8.606e-71
Identity = 161/465 (34.62%), Postives = 241/465 (51.83%), Query Frame = 2
Query:  113 RNIHDEVKDKGDEISEELPKPNFVDIVPETGSGEDIEIMPSLSEIKNIPQGTDSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSKVTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFI---RIPSPNSLLQQIFTMPRNDQ--LDFYQRLTEGLVRRGILPG*NYR 1492
             ++ D      D++ EEL K     + P T               K     T  S ++             N+ IR + T +MI  F   +  G    I L++  Q+  F E I +     + ++LP  +TL+W+ LFT+ Y+L G+ L   F+    +              +L  +VT+H+FI +CLY  G V FV SL K     QF     TH+ LL++V  +H I+ N+ NG+ WFL+P  ++I NDI AY+ G  FG+T LI++SPKKT EGF+G    T + +I+ ++ L  Y Y  CP+E        ++ C  NPVF P +Y LP      + ++ +T+ P + H + +  F+S+  PFGGFFASG KR FK+KDFG  IPGHGGI DR DCQ +MG+F   YY +FI   RI + +++L  I  M  ND+  ++    L   L ++GI+   N+ 
Sbjct:   18 ESVTDATSKAIDKLQEELHKDASESVTPVT---------------KESTAATKESRKY-------------NFFIRTVWTFVMISGFFITLASGHAWCIVLILGCQIATFKECIAVTSASGREKNLPLTKTLNWYLLFTTIYYLDGKSLFKFFQATFYE------------YPVLNFIVTNHKFICYCLYLMGFVLFVCSLRKGFLKFQFGSLCVTHMVLLLVVFQAHLIIKNVLNGLFWFLLPCGLVIVNDIFAYLCGITFGKTKLIEISPKKTLEGFLGAWFFTALASIILTRILSPYTYLTCPVEDLHTNFFSNLTCELNPVFLPQVYRLPPIFFDKVQINSITVKPIYFHALNLATFASLFAPFGGFFASGLKRTFKVKDFGHSIPGHGGITDRVDCQFIMGSFANLYYETFISEHRI-TVDTVLSTIL-MNLNDKQIIELIDILIRFLSKKGIISAKNFE 440          
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Nematostella
Match: EDO39612 (Phosphatidate cytidylyltransferase [Source:UniProtKB/TrEMBL;Acc:A7S9P1])

HSP 1 Score: 384.8 bits (987), Expect = 9.484e-130
Identity = 219/471 (46.50%), Postives = 300/471 (63.69%), Query Frame = 2
Query:   86 MEVEDEVRRRNIHDEVKDKGDEISEELPKPNFVDIVPETGSGEDIEIMPSLSEIKNIPQGT--DSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGAL-SMECVRNPVFRPVIYELPS---YLSSIIPVSK--VTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGIL 1474
            MEV     RR   D     G   +E  P         E    E +E  P  SE K   + T   +  + L   L ++  KWRN+ IR   + +M+  F  +++ GP+ LI L+  +Q+ CF+EII+IG+  Y+  +LPWFR+LSW+FL  SNYF +GE +    R    K   +      ++ +++++   +HR ISF LY  GI+ FVLSL K  Y  QF+LFGWTHVTLLI+VT SH IM  +F G+IWF +PV+M+ICNDI AY+FGFFFGRTPLIK+SPKKTWEGFIGGG +T+I+  +    +I+Y++FVCP+EYD+    +  M C  +P+F    Y LP    +L S+I + +  V +YP   H +I+ +FSS++ PFGGFFASGFKRAFK+KDF D IPGHGGI+DRFDCQ LM  FV+ Y+ +FIR P P+ LLQQ+ T+  + QL  ++RL E L  RG+L
Sbjct:    1 MEVNTNGARRRAKD-----GLPTTETSPA--------ENKEQERMETSPITSEDKEKQEATMAPAKEQELPGVLGNLQPKWRNWWIRGAFSAVMLSGFGLIMYTGPLGLIILIQCLQIKCFHEIISIGHKKYQKHNLPWFRSLSWYFLLGSNYFFYGESITDFIR---GKGVHN------ESDEVVKAYFPYHRLISFMLYTIGIILFVLSLKKDFYKVQFSLFGWTHVTLLIVVTQSHLIMQTLFEGLIWFFLPVTMVICNDIWAYIFGFFFGRTPLIKISPKKTWEGFIGGGFATIIYGWIACYFMIRYEFFVCPVEYDETSSFMFKMSCQPSPIFVLTPYSLPGPLRFLISLIGIRQEVVWMYPMHLHSLILALFSSIIAPFGGFFASGFKRAFKVKDFSDTIPGHGGILDRFDCQFLMATFVHVYHFTFIRAPQPHKLLQQVLTLKPSQQLVIFKRLQEALSARGLL 449          
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Medaka
Match: cds2 (phosphatidate cytidylyltransferase 2 [Source:NCBI gene;Acc:101157624])

HSP 1 Score: 407.912 bits (1047), Expect = 3.614e-138
Identity = 226/468 (48.29%), Postives = 302/468 (64.53%), Query Frame = 2
Query:   77 EITMEVEDEVRRRNIHDEVKDKGDEISEELPKPNFVDIVPETGSGEDIEIMPSLSEIKNIPQGTDSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSKVTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGILPG 1480
             +  E E  ++++   D+  D   E+  E       D V ++ S  D       S I  +P   D + E LN  L  +  +W+N+ +R + T  MI  F F+++LGPM L+ +V+ +Q+ CF+EII IGY VY S DLPWFRTLSW+FL   NYF +GE +   F  L+ +E            + L+ L  +HRFISF LY  G   FVLSLVKKHY  QF +FGWTHVTLLI+VT SH I++N+F G+IWF+VP+S +ICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGG  +T++F I+ S  +  Y YFVCP+E+++   +  ++C    +F+   Y LPS L S+   + V LYP+  H + +  F+S++GPFGGFFASGFKRAFKIKDF + IPGHGGIMDRFDCQ LM  FV  Y  SFIR P+P+ ++QQ+  +  + QL  +  L   LV +G+LP 
Sbjct:    7 RVAKETESTLQQQPSEDKTSD--SELKAE------KDGVSDSESKVD-------SGIPEVPVSADDTPEVLNKALSGLSSRWKNWWVRGLFTLAMITFFFFIIYLGPMVLMMIVLCVQIKCFHEIIMIGYSVYHSYDLPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQRE------------EPLRILSKYHRFISFALYLTGFCMFVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLIIHNLFEGMIWFIVPISCVICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGFFATIVFGIVLSYFMSGYRYFVCPVEFNNDSNSFQVDCQPPELFQLQEYTLPSVLESVTGWTTVHLYPFQIHSVALSSFASIMGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPSKVIQQLLALRPDQQLHIFNSLKAHLVEKGLLPA 447          
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Medaka
Match: cds1 (phosphatidate cytidylyltransferase 2 [Source:NCBI gene;Acc:101161564])

HSP 1 Score: 405.216 bits (1040), Expect = 2.997e-137
Identity = 222/459 (48.37%), Postives = 300/459 (65.36%), Query Frame = 2
Query:  101 EVRRRNIHDEVKDKGDEISEELPKPNFVDIVPETGSGE-DIEIMPSLSEIKNIPQGTDSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSKVTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGIL 1474
            E+RRR   D   D  D IS+     +    +P    GE D++      ++      TD++ E LN  L+ +P +W+NY IR +++  MI  F  ++++GP+ALIF+V+ +Q+ CF EII IGY VY S  LPWFRTLSW+FL   NYF +GE +   F  L+ +E            + L+ L  +HRFISF LY  G   FVLSLVKKHY  QF +F WTHVTLLI+VT SH ++ N+F G+IWF+VP+S++ICNDIMAY+FGFFFGRTPLIKLSPKKTWEGFIGG   T++F  + +  L ++ +FVCP+E++    + ++EC  + +F    Y LP+ L + +    V LYP+  H I +  F+S++GPFGGFFASGFKRAFKIKDF + IPGHGGIMDRFDCQ LM  FV+ Y  SFIR P+P+ +LQQ+  +    QL+ +  L   L  RG+L
Sbjct:    3 ELRRRGGGD--PDSTDNISDREAGGDDRPDLPGDAEGEGDVDSKADTPDVPLSTADTDNTPECLNKALEGLPPRWKNYWIRGVLSLAMISGFFLIIYMGPIALIFVVMCVQIKCFQEIITIGYRVYHSYHLPWFRTLSWYFLVCVNYFFYGETVADYFGALVQRE------------EPLKFLARYHRFISFALYLAGFCMFVLSLVKKHYRLQFYMFAWTHVTLLIVVTQSHLVIQNLFEGMIWFIVPISIVICNDIMAYLFGFFFGRTPLIKLSPKKTWEGFIGGYFGTVVFGFILAFLLSQFQHFVCPVEFNSETNSFAVECEPSDIFVVQEYTLPAVLQNTLRWKTVNLYPFQIHSIFLSSFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPSKVLQQLLKLQPEQQLNIFHSLHAHLRDRGML 447          
BLAST of Phosphatidate cytidylyltransferase vs. Planmine SMEST
Match: SMESG000068325.1 (SMESG000068325.1)

HSP 1 Score: 904.049 bits (2335), Expect = 0.000e+0
Identity = 464/465 (99.78%), Postives = 464/465 (99.78%), Query Frame = 2
Query:   86 MEVEDEVRRRNIHDEVKDKGDEISEELPKPNFVDIVPETGSGEDIEIMPSLSEIKNIPQGTDSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSKVTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGILPG 1480
            MEVEDEVRRRNIHDEVKDKGDEISEELPKPNFVDIVPETGSGEDIEIMPSLSEIKNIPQGTDSSFEFLNSFLDSIP KWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSKVTLYPYFKHCIIMGVFSSVVGPFGGFFASGFKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGILPG
Sbjct:    1 MEVEDEVRRRNIHDEVKDKGDEISEELPKPNFVDIVPETGSGEDIEIMPSLSEIKNIPQGTDSSFEFLNSFLDSIPSKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSKVTLYPYFKHCIIMGVFSSVVGPFGGFFASGFKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGILPG 465          
BLAST of Phosphatidate cytidylyltransferase vs. Planmine SMEST
Match: SMESG000068325.1 (SMESG000068325.1)

HSP 1 Score: 867.07 bits (2239), Expect = 0.000e+0
Identity = 452/465 (97.20%), Postives = 452/465 (97.20%), Query Frame = 2
Query:   86 MEVEDEVRRRNIHDEVKDKGDEISEELPKPNFVDIVPETGSGEDIEIMPSLSEIKNIPQGTDSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSKVTLYPYFKHCIIMXXXXXXXXXXXXXXXXXXKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGILPG 1480
            MEVEDEVRRRNIHDEVKDKGDEISEELPKPNFVDIVPETGSGEDIEIMPSLSEIKNIPQGTDSSFEFLNSFLDSIP KWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKE            DLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSKVTLYPYFKHCIIMGVFSSVVGPFGGFFASGFKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGILPG
Sbjct:    1 MEVEDEVRRRNIHDEVKDKGDEISEELPKPNFVDIVPETGSGEDIEIMPSLSEIKNIPQGTDSSFEFLNSFLDSIPSKWRNYTIRFIMTCLMIGVFAFLVFLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSNYFLFGEGLIGNFRILLAKE------------DLLQSLVTHHRFISFCLYCCGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWFLVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAILFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSIIPVSKVTLYPYFKHCIIMGVFSSVVGPFGGFFASGFKRAFKIKDFGDLIPGHGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFYQRLTEGLVRRGILPG 453          
The following BLAST results are available for this feature:
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CDS22.823e-13949.56CDP-diacylglycerol synthase 2 [Source:HGNC Symbol;... [more]
CDS13.097e-13849.89CDP-diacylglycerol synthase 1 [Source:HGNC Symbol;... [more]
CDS23.478e-9254.76CDP-diacylglycerol synthase 2 [Source:HGNC Symbol;... [more]
back to top
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cdgs-11.535e-13048.70Phosphatidate cytidylyltransferase [Source:UniPro... [more]
cdgs-11.535e-13048.70Phosphatidate cytidylyltransferase [Source:UniPro... [more]
cdgs-12.760e-13048.07Phosphatidate cytidylyltransferase [Source:UniPro... [more]
cdgs-12.760e-13048.07Phosphatidate cytidylyltransferase [Source:UniPro... [more]
back to top
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Cds9.479e-15151.41gene:FBgn0010350 transcript:FBtr0346546[more]
Cds9.479e-15151.41gene:FBgn0010350 transcript:FBtr0076688[more]
back to top
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cds21.044e-14149.36CDP-diacylglycerol synthase (phosphatidate cytidyl... [more]
cds11.026e-14049.46CDP-diacylglycerol synthase (phosphatidate cytidyl... [more]
cds12.279e-13751.17CDP-diacylglycerol synthase (phosphatidate cytidyl... [more]
BX469907.11.381e-13551.40CDP-diacylglycerol synthase (phosphatidate cytidyl... [more]
BX469907.11.525e-13551.40CDP-diacylglycerol synthase (phosphatidate cytidyl... [more]
back to top
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
akr1c8p6.422e-13949.45aldo-keto reductase family 1, member C8, pseudogen... [more]
akr1c8p1.278e-13652.55aldo-keto reductase family 1, member C8, pseudogen... [more]
cds23.293e-13549.02CDP-diacylglycerol synthase 2 [Source:NCBI gene;Ac... [more]
cds21.204e-13449.34CDP-diacylglycerol synthase 2 [Source:NCBI gene;Ac... [more]
cds24.055e-13450.93CDP-diacylglycerol synthase 2 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cds21.007e-13748.70CDP-diacylglycerol synthase (phosphatidate cytidyl... [more]
Cds21.277e-13651.42CDP-diacylglycerol synthase (phosphatidate cytidyl... [more]
Cds12.993e-13652.43CDP-diacylglycerol synthase 1 [Source:MGI Symbol;A... [more]
Cds23.024e-2842.47CDP-diacylglycerol synthase (phosphatidate cytidyl... [more]
Cds25.070e-2537.86CDP-diacylglycerol synthase (phosphatidate cytidyl... [more]
back to top
BLAST of Phosphatidate cytidylyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P56079|CDS_DROME9.502e-15051.41Phosphatidate cytidylyltransferase, photoreceptor-... [more]
sp|O95674|CDS2_HUMAN1.356e-13849.56Phosphatidate cytidylyltransferase 2 OS=Homo sapie... [more]
sp|Q92903|CDS1_HUMAN1.487e-13749.89Phosphatidate cytidylyltransferase 1 OS=Homo sapie... [more]
sp|Q99L43|CDS2_MOUSE7.046e-13748.70Phosphatidate cytidylyltransferase 2 OS=Mus muscul... [more]
sp|A0JNC1|CDS2_BOVIN4.135e-13648.91Phosphatidate cytidylyltransferase 2 OS=Bos taurus... [more]
back to top
BLAST of Phosphatidate cytidylyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EJ285.666e-17456.93Phosphatidate cytidylyltransferase OS=Macrostomum ... [more]
A0A267FTP36.049e-17456.93Phosphatidate cytidylyltransferase OS=Macrostomum ... [more]
A0A430Q5T95.226e-17362.09Phosphatidate cytidylyltransferase OS=Schistosoma ... [more]
A0A095AP076.309e-17362.09Phosphatidate cytidylyltransferase OS=Schistosoma ... [more]
G4VKI95.209e-17256.20Phosphatidate cytidylyltransferase OS=Schistosoma ... [more]
back to top
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cds16.346e-14049.78phosphatidate cytidylyltransferase 1 [Source:NCBI ... [more]
cds23.480e-12250.60CDP-diacylglycerol synthase (phosphatidate cytidyl... [more]
back to top
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cds27.150e-13351.49CDP-diacylglycerol synthase (phosphatidate cytidyl... [more]
ENSPMAT00000001308.11.018e-5155.03pep scaffold:Pmarinus_7.0:GL489389:717:4774:-1 gen... [more]
back to top
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CDS18.606e-7134.62Phosphatidate cytidylyltransferase (CDP-diglycerid... [more]
back to top
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO396129.484e-13046.50Phosphatidate cytidylyltransferase [Source:UniPro... [more]
back to top
BLAST of Phosphatidate cytidylyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cds23.614e-13848.29phosphatidate cytidylyltransferase 2 [Source:NCBI ... [more]
cds12.997e-13748.37phosphatidate cytidylyltransferase 2 [Source:NCBI ... [more]
back to top
BLAST of Phosphatidate cytidylyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000068325.10.000e+099.78SMESG000068325.1[more]
SMESG000068325.10.000e+097.20SMESG000068325.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002758 ID=SMED30002758|Name=Phosphatidate cytidylyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1574bp
CTAAAATTAAGTGTGTGTTTAAATTTATCAACTTCATTTATAATTTGATT
CTGATTTTTTATTAGCAATATTTATTGAGATTACAATGGAAGTGGAAGAT
GAAGTTAGACGAAGAAATATACATGATGAAGTTAAAGATAAAGGAGATGA
AATTTCTGAAGAATTACCAAAACCAAACTTTGTTGATATTGTTCCAGAAA
CGGGATCTGGGGAAGATATAGAAATTATGCCTTCTTTAAGTGAAATAAAA
AATATACCGCAAGGCACAGATTCATCATTTGAATTTTTGAACAGTTTCTT
AGATTCTATACCTATTAAATGGAGAAATTACACGATTCGCTTTATTATGA
CATGCTTGATGATTGGAGTATTCGCGTTTCTAGTTTTTTTGGGTCCTATG
GCGTTGATATTTCTGGTAATTCTGATTCAATTGATGTGTTTCAATGAAAT
AATCAACATTGGCTATATTGTTTACAAGTCTCAAGATCTTCCATGGTTTC
GAACATTATCATGGTTCTTCTTATTTACATCAAATTATTTCCTATTCGGA
GAAGGCTTAATTGGGAATTTTCGTATATTATTGGCAAAAGAAACTCAGGA
TCTCATCAACCATTGGATGAAAACCCAGGATTTGCTACAATCACTTGTTA
CTCACCATCGCTTTATATCGTTCTGCCTCTACTGTTGTGGAATAGTCTGG
TTCGTCCTCAGCTTGGTGAAGAAGCATTATCTGCAACAGTTTACACTGTT
TGGATGGACTCATGTGACATTGCTGATCATAGTTACTTCTTCTCATTTTA
TAATGAACAATATATTCAATGGAATCATTTGGTTTCTAGTACCAGTCTCG
ATGATTATATGTAACGACATTATGGCTTATATGTTCGGATTTTTCTTCGG
AAGAACTCCACTAATTAAATTATCTCCTAAAAAAACATGGGAAGGATTTA
TTGGTGGTGGAGTTTCTACTTTGATTTTTGCTATTCTTTTTTCTCAGGCT
TTGATCAAATACGACTATTTTGTATGTCCACTCGAGTATGACGATGTAAA
AGGTGCTCTGTCTATGGAATGCGTTAGGAACCCGGTATTTCGACCGGTCA
TATATGAATTACCGTCATATTTATCCAGTATTATTCCAGTGAGCAAGGTT
ACTCTTTATCCGTATTTCAAACACTGTATCATTATGGGTGTTTTTTCGTC
GGTTGTTGGACCATTCGGAGGATTTTTCGCCAGTGGCTTCAAACGTGCTT
TTAAAATTAAAGATTTTGGAGATTTAATTCCGGGTCACGGTGGAATTATG
GATAGATTCGATTGTCAAGTTTTAATGGGAGCATTCGTATATTTCTATTA
CAACTCATTCATTCGAATTCCAAGCCCGAATTCTTTGTTACAGCAAATAT
TTACGATGCCTCGCAATGATCAATTGGACTTTTATCAAAGACTTACAGAA
GGCTTAGTTCGTCGCGGCATTTTACCGGGGTGAAACTATCGCACTAACTC
ACGCATATTAATATTTATTCGTTCCAATTAACATTAAGTGGCTGATAGTG
ATATATATATATATATATATATAT
back to top

protein sequence of SMED30002758-orf-1

>SMED30002758-orf-1 ID=SMED30002758-orf-1|Name=SMED30002758-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=124bp
MVSNIIMVLLIYIKLFPIRRRLNWEFSYIIGKRNSGSHQPLDENPGFATI
TCYSPSLYIVLPLLLWNSLVRPQLGEEALSATVYTVWMDSCDIADHSYFF
SFYNEQYIQWNHLVSSTSLDDYM*
back to top

protein sequence of SMED30002758-orf-2

>SMED30002758-orf-2 ID=SMED30002758-orf-2|Name=SMED30002758-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=466bp
MEVEDEVRRRNIHDEVKDKGDEISEELPKPNFVDIVPETGSGEDIEIMPS
LSEIKNIPQGTDSSFEFLNSFLDSIPIKWRNYTIRFIMTCLMIGVFAFLV
FLGPMALIFLVILIQLMCFNEIINIGYIVYKSQDLPWFRTLSWFFLFTSN
YFLFGEGLIGNFRILLAKETQDLINHWMKTQDLLQSLVTHHRFISFCLYC
CGIVWFVLSLVKKHYLQQFTLFGWTHVTLLIIVTSSHFIMNNIFNGIIWF
LVPVSMIICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGGVSTLIFAI
LFSQALIKYDYFVCPLEYDDVKGALSMECVRNPVFRPVIYELPSYLSSII
PVSKVTLYPYFKHCIIMGVFSSVVGPFGGFFASGFKRAFKIKDFGDLIPG
HGGIMDRFDCQVLMGAFVYFYYNSFIRIPSPNSLLQQIFTMPRNDQLDFY
QRLTEGLVRRGILPG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR016720PC_Trfase_euk
IPR000374PC_trans
Vocabulary: molecular function
TermDefinition
GO:0004605phosphatidate cytidylyltransferase activity
GO:0016772transferase activity, transferring phosphorus-containing groups
GO:0016740transferase activity
GO:0016779nucleotidyltransferase activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0016024CDP-diacylglycerol biosynthetic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePFAMPF01148CTP_transf_1coord: 84..425
e-value: 1.7E-81
score: 273.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..20
NoneNo IPR availablePANTHERPTHR13773:SF16PHOSPHATIDATE CYTIDYLYLTRANSFERASE 1coord: 50..463
NoneNo IPR availableTMHMMTMhelixcoord: 81..103
NoneNo IPR availableTMHMMTMhelixcoord: 250..272
NoneNo IPR availableTMHMMTMhelixcoord: 218..240
NoneNo IPR availableTMHMMTMhelixcoord: 363..385
NoneNo IPR availableTMHMMTMhelixcoord: 143..165
NoneNo IPR availableTMHMMTMhelixcoord: 108..130
NoneNo IPR availableTMHMMTMhelixcoord: 285..307
NoneNo IPR availableTMHMMTMhelixcoord: 189..211
IPR016720Phosphatidate cytidylyltransferase, eukaryotaPIRSFPIRSF018269CDP-DAG_synth_ecoord: 38..464
e-value: 4.4E-155
score: 514.4
IPR016720Phosphatidate cytidylyltransferase, eukaryotaPANTHERPTHR13773PHOSPHATIDATE CYTIDYLYLTRANSFERASEcoord: 50..463
IPR000374Phosphatidate cytidylyltransferasePROSITEPS01315CDScoord: 383..409