Zyxin

Overview
NameZyxin
Smed IDSMED30002756
Length (bp)864
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zyxin (SMED30002756) t-SNE clustered cells

Violin plots show distribution of expression levels for Zyxin (SMED30002756) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002756

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30002756h1SMcG0022408 dd_Smed_v4_85280_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
testisSMED30002756h1SMcG0016183 Contig1119GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
reproductive organSMED30002756h1SMcG0022408 Contig40526uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30002756h1SMcG0022408 Contig40526newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testisSMED30002756h1SMcG0022408 PL05004A2F03smed_ncbi_20240424PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30002756h1SMcG0022408 Contig1119GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Zyxin vs. Ensembl Human
Match: LIMS1 (LIM zinc finger domain containing 1 [Source:HGNC Symbol;Acc:HGNC:6616])

HSP 1 Score: 60.077 bits (144), Expect = 9.170e-10
Identity = 54/187 (28.88%), Postives = 76/187 (40.64%), Query Frame = 1
Query:  154 DKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            +K   +  +++HE CF C +C    PE  + +     +C    E D                   +F   AP C  C   I G+  IK  N   H  CF C  C++++ D        R +C+ C  R  +   G   C KC  II+E+  I F    +H   F CA CGK L   A R + G L C
Sbjct:   58 EKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYC----EHDFQM----------------LF---APCCHQCGEFIIGR-VIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIDEQPLI-FKNDPYHPDHFNCANCGKELTADA-RELKGELYC 218          
BLAST of Zyxin vs. Ensembl Human
Match: LIMS1 (LIM zinc finger domain containing 1 [Source:HGNC Symbol;Acc:HGNC:6616])

HSP 1 Score: 60.077 bits (144), Expect = 1.026e-9
Identity = 54/187 (28.88%), Postives = 76/187 (40.64%), Query Frame = 1
Query:  154 DKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            +K   +  +++HE CF C +C    PE  + +     +C    E D                   +F   AP C  C   I G+  IK  N   H  CF C  C++++ D        R +C+ C  R  +   G   C KC  II+E+  I F    +H   F CA CGK L   A R + G L C
Sbjct:   83 EKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYC----EHDFQM----------------LF---APCCHQCGEFIIGR-VIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIDEQPLI-FKNDPYHPDHFNCANCGKELTADA-RELKGELYC 243          
BLAST of Zyxin vs. Ensembl Human
Match: LIMS1 (LIM zinc finger domain containing 1 [Source:HGNC Symbol;Acc:HGNC:6616])

HSP 1 Score: 60.077 bits (144), Expect = 1.101e-9
Identity = 54/187 (28.88%), Postives = 76/187 (40.64%), Query Frame = 1
Query:  154 DKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            +K   +  +++HE CF C +C    PE  + +     +C    E D                   +F   AP C  C   I G+  IK  N   H  CF C  C++++ D        R +C+ C  R  +   G   C KC  II+E+  I F    +H   F CA CGK L   A R + G L C
Sbjct:   33 EKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYC----EHDFQM----------------LF---APCCHQCGEFIIGR-VIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIDEQPLI-FKNDPYHPDHFNCANCGKELTADA-RELKGELYC 193          
BLAST of Zyxin vs. Ensembl Human
Match: LIMS1 (LIM zinc finger domain containing 1 [Source:HGNC Symbol;Acc:HGNC:6616])

HSP 1 Score: 59.6918 bits (143), Expect = 1.138e-9
Identity = 54/187 (28.88%), Postives = 76/187 (40.64%), Query Frame = 1
Query:  154 DKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            +K   +  +++HE CF C +C    PE  + +     +C    E D                   +F   AP C  C   I G+  IK  N   H  CF C  C++++ D        R +C+ C  R  +   G   C KC  II+E+  I F    +H   F CA CGK L   A R + G L C
Sbjct:   25 EKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYC----EHDFQM----------------LF---APCCHQCGEFIIGR-VIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIDEQPLI-FKNDPYHPDHFNCANCGKELTADA-RELKGELYC 185          
BLAST of Zyxin vs. Ensembl Human
Match: LIMS1 (LIM zinc finger domain containing 1 [Source:HGNC Symbol;Acc:HGNC:6616])

HSP 1 Score: 59.6918 bits (143), Expect = 1.161e-9
Identity = 54/187 (28.88%), Postives = 76/187 (40.64%), Query Frame = 1
Query:  154 DKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            +K   +  +++HE CF C +C    PE  + +     +C    E D                   +F   AP C  C   I G+  IK  N   H  CF C  C++++ D        R +C+ C  R  +   G   C KC  II+E+  I F    +H   F CA CGK L   A R + G L C
Sbjct:   21 EKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYC----EHDFQM----------------LF---APCCHQCGEFIIGR-VIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIDEQPLI-FKNDPYHPDHFNCANCGKELTADA-RELKGELYC 181          
BLAST of Zyxin vs. Ensembl Celegans
Match: unc-97 (LIM domain-containing protein unc-97 [Source:UniProtKB/Swiss-Prot;Acc:P50464])

HSP 1 Score: 63.1586 bits (152), Expect = 3.482e-11
Identity = 54/201 (26.87%), Postives = 79/201 (39.30%), Query Frame = 1
Query:  151 NDKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTCAGHLLQDENPIPV 753
             D+   +  +++H  CF C +C    P+  Y +     +C    E D        +V+             +P C  C   I G+  IK  N   H  CF C  C K + D        R +C++C  R  +   G   C KC  +I++   I F G +FH   F+C  C   L   A R +NG L C      D   IP+
Sbjct:   31 QDQMVNSSGQVWHSECFVCAQCFEPFPDGIYFEYEGRKYC----EHDF-------HVLF------------SPCCGKCNEFIVGR-VIKAMNASWHPGCFCCEICNKQLADVGFLRNAGRALCRECNEREKAAGHGRYVCHKCHAMIDDGQHIKFRGDSFHPYHFKCKRCNNELTT-ASREVNGELYCL--RCHDTMGIPI 204          
BLAST of Zyxin vs. Ensembl Celegans
Match: unc-97 (LIM domain-containing protein unc-97 [Source:UniProtKB/Swiss-Prot;Acc:P50464])

HSP 1 Score: 63.1586 bits (152), Expect = 3.482e-11
Identity = 54/201 (26.87%), Postives = 79/201 (39.30%), Query Frame = 1
Query:  151 NDKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTCAGHLLQDENPIPV 753
             D+   +  +++H  CF C +C    P+  Y +     +C    E D        +V+             +P C  C   I G+  IK  N   H  CF C  C K + D        R +C++C  R  +   G   C KC  +I++   I F G +FH   F+C  C   L   A R +NG L C      D   IP+
Sbjct:   31 QDQMVNSSGQVWHSECFVCAQCFEPFPDGIYFEYEGRKYC----EHDF-------HVLF------------SPCCGKCNEFIVGR-VIKAMNASWHPGCFCCEICNKQLADVGFLRNAGRALCRECNEREKAAGHGRYVCHKCHAMIDDGQHIKFRGDSFHPYHFKCKRCNNELTT-ASREVNGELYCL--RCHDTMGIPI 204          
BLAST of Zyxin vs. Ensembl Celegans
Match: zyx-1 (Zyxin [Source:UniProtKB/Swiss-Prot;Acc:Q9U3F4])

HSP 1 Score: 50.8322 bits (120), Expect = 3.069e-7
Identity = 47/188 (25.00%), Postives = 70/188 (37.23%), Query Frame = 1
Query:  124 CQKCSYEIKNDKAK-KAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTV-CQDCVIRANSGEDGVPACAKCKKII------EEEHFIPFWGVAFHEKCFRCAICG 663
            C  C  EI  D+    AM++IFH +CF+C +C   +    +        C  C +  L+                         C  C   I  K  ++    + H  CF+C+ CKK +     T +KD  V C  C       +   P CA C K I      +E   +     +FH  C++C  CG
Sbjct:   53 CVGCGKEITGDQPGCNAMNQIFHVDCFKCGQCSKTLAGASFYNIDDKPTCEGCYQNSLEK------------------------CTACNRAISDKL-LRACGGVYHVNCFVCFSCKKSLDGIPFTLDKDNNVHCVPCF-----HDKFAPRCALCSKPIVPQDGEKESVRVVAMDKSFHVDCYKCEDCG 210          
BLAST of Zyxin vs. Ensembl Celegans
Match: zyx-1 (Zyxin [Source:UniProtKB/Swiss-Prot;Acc:Q9U3F4])

HSP 1 Score: 49.2914 bits (116), Expect = 5.521e-7
Identity = 47/188 (25.00%), Postives = 70/188 (37.23%), Query Frame = 1
Query:  124 CQKCSYEIKNDKAK-KAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTV-CQDCVIRANSGEDGVPACAKCKKII------EEEHFIPFWGVAFHEKCFRCAICG 663
            C  C  EI  D+    AM++IFH +CF+C +C   +    +        C  C +  L+                         C  C   I  K  ++    + H  CF+C+ CKK +     T +KD  V C  C       +   P CA C K I      +E   +     +FH  C++C  CG
Sbjct:    8 CVGCGKEITGDQPGCNAMNQIFHVDCFKCGQCSKTLAGASFYNIDDKPTCEGCYQNSLEK------------------------CTACNRAISDKL-LRACGGVYHVNCFVCFSCKKSLDGIPFTLDKDNNVHCVPCF-----HDKFAPRCALCSKPIVPQDGEKESVRVVAMDKSFHVDCYKCEDCG 165          
BLAST of Zyxin vs. Ensembl Celegans
Match: zyx-1 (Zyxin [Source:UniProtKB/Swiss-Prot;Acc:Q9U3F4])

HSP 1 Score: 50.0618 bits (118), Expect = 6.596e-7
Identity = 48/194 (24.74%), Postives = 72/194 (37.11%), Query Frame = 1
Query:  124 CQKCSYEIKNDKAK-KAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTV-CQDCVIRANSGEDGVPACAKCKKII------EEEHFIPFWGVAFHEKCFRCAICGKCLIKR 681
            C  C  EI  D+    AM++IFH +CF+C +C   +    +        C  C +  L+                         C  C   I  K  ++    + H  CF+C+ CKK +     T +KD  V C  C       +   P CA C K I      +E   +     +FH  C++C  CG  L  +
Sbjct:  145 CVGCGKEITGDQPGCNAMNQIFHVDCFKCGQCSKTLAGASFYNIDDKPTCEGCYQNSLEK------------------------CTACNRAISDKL-LRACGGVYHVNCFVCFSCKKSLDGIPFTLDKDNNVHCVPCF-----HDKFAPRCALCSKPIVPQDGEKESVRVVAMDKSFHVDCYKCEDCGMQLSSK 308          
BLAST of Zyxin vs. Ensembl Fly
Match: Lmpt (gene:FBgn0261565 transcript:FBtr0302785)

HSP 1 Score: 50.8322 bits (120), Expect = 9.528e-7
Identity = 41/171 (23.98%), Postives = 56/171 (32.75%), Query Frame = 1
Query:  184 FHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEE---EHFIPFWGVAFHEKCFRCAICGKCLIKRAL 687
            +HENCF C  C   I    +    ++ +C  C E+   T     N +I S                          +   N+  H  CF C  C   +     T   ++  C +C      GE     C  C K I       FI F    +H  CF CA C   L+ R  
Sbjct:  830 WHENCFCCCVCKTAIGTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSG------------------------GVTYKNEPWHRECFTCTHCNITLAGQRFTSRDEKPYCAECF-----GELFAKRCTACVKPITGIGGTRFISFEDRHWHHDCFVCASCKASLVGRGF 971          
BLAST of Zyxin vs. Ensembl Fly
Match: Zasp52 (gene:FBgn0265991 transcript:FBtr0329911)

HSP 1 Score: 50.8322 bits (120), Expect = 1.022e-6
Identity = 34/120 (28.33%), Postives = 52/120 (43.33%), Query Frame = 1
Query:  361 KAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYR--CKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            + P+C  C   I+G F I    ++     FIC    C++ ++D    +EK    C+ C  +  +     P C+KC   I+ +      G  FH +CF C  CGK    R   L +G   C
Sbjct: 1580 RIPLCNSCNVQIRGPF-ITALGRIWCPDHFICVNGNCRRPLQDIGFVEEKGDLYCEYCFEKYLA-----PTCSKCAGKIKGDCLNAI-GKHFHPECFTCGQCGKIFGNRPFFLEDGNAYC 1692          
BLAST of Zyxin vs. Ensembl Fly
Match: Zasp52 (gene:FBgn0265991 transcript:FBtr0342711)

HSP 1 Score: 50.8322 bits (120), Expect = 1.038e-6
Identity = 34/120 (28.33%), Postives = 52/120 (43.33%), Query Frame = 1
Query:  361 KAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYR--CKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            + P+C  C   I+G F I    ++     FIC    C++ ++D    +EK    C+ C  +  +     P C+KC   I+ +      G  FH +CF C  CGK    R   L +G   C
Sbjct: 1906 RIPLCNSCNVQIRGPF-ITALGRIWCPDHFICVNGNCRRPLQDIGFVEEKGDLYCEYCFEKYLA-----PTCSKCAGKIKGDCLNAI-GKHFHPECFTCGQCGKIFGNRPFFLEDGNAYC 2018          
BLAST of Zyxin vs. Ensembl Fly
Match: Zasp52 (gene:FBgn0265991 transcript:FBtr0392901)

HSP 1 Score: 50.8322 bits (120), Expect = 1.040e-6
Identity = 34/120 (28.33%), Postives = 52/120 (43.33%), Query Frame = 1
Query:  361 KAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYR--CKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            + P+C  C   I+G F I    ++     FIC    C++ ++D    +EK    C+ C  +  +     P C+KC   I+ +      G  FH +CF C  CGK    R   L +G   C
Sbjct: 1964 RIPLCNSCNVQIRGPF-ITALGRIWCPDHFICVNGNCRRPLQDIGFVEEKGDLYCEYCFEKYLA-----PTCSKCAGKIKGDCLNAI-GKHFHPECFTCGQCGKIFGNRPFFLEDGNAYC 2076          
BLAST of Zyxin vs. Ensembl Fly
Match: Zasp52 (gene:FBgn0265991 transcript:FBtr0100388)

HSP 1 Score: 50.8322 bits (120), Expect = 1.042e-6
Identity = 34/120 (28.33%), Postives = 52/120 (43.33%), Query Frame = 1
Query:  361 KAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYR--CKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            + P+C  C   I+G F I    ++     FIC    C++ ++D    +EK    C+ C  +  +     P C+KC   I+ +      G  FH +CF C  CGK    R   L +G   C
Sbjct: 2016 RIPLCNSCNVQIRGPF-ITALGRIWCPDHFICVNGNCRRPLQDIGFVEEKGDLYCEYCFEKYLA-----PTCSKCAGKIKGDCLNAI-GKHFHPECFTCGQCGKIFGNRPFFLEDGNAYC 2128          
BLAST of Zyxin vs. Ensembl Zebrafish
Match: lims1 (LIM and senescent cell antigen-like domains 1 [Source:ZFIN;Acc:ZDB-GENE-050522-236])

HSP 1 Score: 59.6918 bits (143), Expect = 7.663e-10
Identity = 57/202 (28.22%), Postives = 82/202 (40.59%), Query Frame = 1
Query:  112 SHLKCQKC-SYEIKNDKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            ++  C++C S     +K   +  +++HE CF C +C    PE  + +     +C    E D                   +F   AP C  C   I G+  IK  N   H  CF C  C+ ++ D        R +C+ C  R  +   G   C KC  IIEE+  I F    +H   F C+ CGK L   A R + G L C
Sbjct:    6 ANASCERCKSGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYC----EHDFQM----------------LF---APCCHQCGEFIIGR-VIKAMNNSWHPDCFCCDICQAVLADVGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIEEQPLI-FKNDPYHPDHFNCSNCGKELTADA-RELKGELYC 181          
BLAST of Zyxin vs. Ensembl Zebrafish
Match: lims1 (LIM and senescent cell antigen-like domains 1 [Source:ZFIN;Acc:ZDB-GENE-050522-236])

HSP 1 Score: 59.6918 bits (143), Expect = 8.793e-10
Identity = 57/202 (28.22%), Postives = 82/202 (40.59%), Query Frame = 1
Query:  112 SHLKCQKC-SYEIKNDKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            ++  C++C S     +K   +  +++HE CF C +C    PE  + +     +C    E D                   +F   AP C  C   I G+  IK  N   H  CF C  C+ ++ D        R +C+ C  R  +   G   C KC  IIEE+  I F    +H   F C+ CGK L   A R + G L C
Sbjct:   17 ANASCERCKSGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYC----EHDFQM----------------LF---APCCHQCGEFIIGR-VIKAMNNSWHPDCFCCDICQAVLADVGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIEEQPLI-FKNDPYHPDHFNCSNCGKELTADA-RELKGELYC 192          
BLAST of Zyxin vs. Ensembl Zebrafish
Match: lims2 (LIM and senescent cell antigen-like domains 2 [Source:ZFIN;Acc:ZDB-GENE-050522-56])

HSP 1 Score: 52.7582 bits (125), Expect = 1.536e-7
Identity = 48/198 (24.24%), Postives = 76/198 (38.38%), Query Frame = 1
Query:  124 CQKCSYEIK-NDKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            C++C       +K   +  +++HE CF C +C   + +  + +     +C    E D                        AP C  C   + G+  IK  N   H  CF C  C+ ++ D        R +C+ C  R  +   G   C KC  ++EE   + +    +H   F C+ CGK L   A R + G L C
Sbjct:   12 CERCKSSFSPTEKMVNSNGELYHEQCFTCAQCFQQLIQGLFYEFEGRKYC----EHDFQMLF-------------------APCCHQCGEFVVGR-VIKAMNSSWHPDCFCCEVCEAVLADVGFVKSGGRPLCRSCHSRQKALSLGKHVCQKCLCVVEEP--LMYRSDPYHPDHFNCSHCGKELTADA-RELKGELYC 182          
BLAST of Zyxin vs. Ensembl Zebrafish
Match: lims2 (LIM and senescent cell antigen-like domains 2 [Source:ZFIN;Acc:ZDB-GENE-050522-56])

HSP 1 Score: 52.7582 bits (125), Expect = 1.910e-7
Identity = 49/198 (24.75%), Postives = 78/198 (39.39%), Query Frame = 1
Query:  124 CQKCSYEIK-NDKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            C++C       +K   +  +++HE CF C +C   + +  + +     +C    E D                   +F   AP C  C   + G+  IK  N   H  CF C  C+ ++ D        R +C+ C  R  +   G   C KC  ++EE   + +    +H   F C+ CGK L   A R + G L C
Sbjct:   56 CERCKSSFSPTEKMVNSNGELYHEQCFTCAQCFQQLIQGLFYEFEGRKYC----EHDFQM----------------LF---APCCHQCGEFVVGR-VIKAMNSSWHPDCFCCEVCEAVLADVGFVKSGGRPLCRSCHSRQKALSLGKHVCQKCLCVVEEP--LMYRSDPYHPDHFNCSHCGKELTADA-RELKGELYC 226          
BLAST of Zyxin vs. Ensembl Zebrafish
Match: pdlim7 (PDZ and LIM domain 7 [Source:NCBI gene;Acc:393813])

HSP 1 Score: 51.9878 bits (123), Expect = 3.174e-7
Identity = 36/116 (31.03%), Postives = 56/116 (48.28%), Query Frame = 1
Query:  367 PVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            P+CA C   I+G++ + +  +  H   F+C +CK+L+ +    +EK    C  C     S     P CAKCKKII  E  +    + +H +CF CA C   +  +A  +  G   C
Sbjct:  242 PLCAACSKIIRGRYVVAL-GRSWHPEEFMCCQCKRLLDEGGFFEEKGSIYCSKCYDNRYS-----PNCAKCKKIITGE-IMHALKMTYHVQCFLCAACKLPIRNQAFYMEEGEPYC 350          
BLAST of Zyxin vs. Ensembl Xenopus
Match: lims1 (LIM-type zinc finger domains 1 [Source:NCBI gene;Acc:100216119])

HSP 1 Score: 61.2326 bits (147), Expect = 3.797e-10
Identity = 57/198 (28.79%), Postives = 82/198 (41.41%), Query Frame = 1
Query:  124 CQKC-SYEIKNDKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            C++C S    ++K   +  +++HE CF C +C    PE  + +     +C    E D                   +F   AP C  C   I G+  IK  N   H  CF C  C++++ D        R +C+ C  R  +   G   C KC  II+E+  I F    +H   F CA CGK L   A R + G L C
Sbjct:   73 CERCRSGFAPSEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYC----EHDFQM----------------LF---APCCHQCGEFIIGR-VIKAMNNSWHPECFRCDICQQVLADIGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIDEQPLI-FKNDPYHPDHFNCANCGKELTADA-RELKGELYC 244          
BLAST of Zyxin vs. Ensembl Xenopus
Match: lims1 (LIM-type zinc finger domains 1 [Source:NCBI gene;Acc:100216119])

HSP 1 Score: 61.2326 bits (147), Expect = 3.857e-10
Identity = 57/198 (28.79%), Postives = 82/198 (41.41%), Query Frame = 1
Query:  124 CQKC-SYEIKNDKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            C++C S    ++K   +  +++HE CF C +C    PE  + +     +C    E D                   +F   AP C  C   I G+  IK  N   H  CF C  C++++ D        R +C+ C  R  +   G   C KC  II+E+  I F    +H   F CA CGK L   A R + G L C
Sbjct:   73 CERCRSGFAPSEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYC----EHDFQM----------------LF---APCCHQCGEFIIGR-VIKAMNNSWHPECFRCDICQQVLADIGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIDEQPLI-FKNDPYHPDHFNCANCGKELTADA-RELKGELYC 244          
BLAST of Zyxin vs. Ensembl Xenopus
Match: lims1 (LIM-type zinc finger domains 1 [Source:NCBI gene;Acc:100216119])

HSP 1 Score: 61.2326 bits (147), Expect = 4.399e-10
Identity = 57/198 (28.79%), Postives = 82/198 (41.41%), Query Frame = 1
Query:  124 CQKC-SYEIKNDKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            C++C S    ++K   +  +++HE CF C +C    PE  + +     +C    E D                   +F   AP C  C   I G+  IK  N   H  CF C  C++++ D        R +C+ C  R  +   G   C KC  II+E+  I F    +H   F CA CGK L   A R + G L C
Sbjct:   47 CERCRSGFAPSEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYC----EHDFQM----------------LF---APCCHQCGEFIIGR-VIKAMNNSWHPECFRCDICQQVLADIGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIDEQPLI-FKNDPYHPDHFNCANCGKELTADA-RELKGELYC 218          
BLAST of Zyxin vs. Ensembl Xenopus
Match: lims1 (LIM-type zinc finger domains 1 [Source:NCBI gene;Acc:100216119])

HSP 1 Score: 61.2326 bits (147), Expect = 4.665e-10
Identity = 57/198 (28.79%), Postives = 82/198 (41.41%), Query Frame = 1
Query:  124 CQKC-SYEIKNDKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            C++C S    ++K   +  +++HE CF C +C    PE  + +     +C    E D                   +F   AP C  C   I G+  IK  N   H  CF C  C++++ D        R +C+ C  R  +   G   C KC  II+E+  I F    +H   F CA CGK L   A R + G L C
Sbjct:   68 CERCRSGFAPSEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYC----EHDFQM----------------LF---APCCHQCGEFIIGR-VIKAMNNSWHPECFRCDICQQVLADIGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIDEQPLI-FKNDPYHPDHFNCANCGKELTADA-RELKGELYC 239          
BLAST of Zyxin vs. Ensembl Xenopus
Match: lims1 (LIM-type zinc finger domains 1 [Source:NCBI gene;Acc:100216119])

HSP 1 Score: 60.8474 bits (146), Expect = 4.859e-10
Identity = 56/198 (28.28%), Postives = 80/198 (40.40%), Query Frame = 1
Query:  124 CQKC-SYEIKNDKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            C++C S    ++K   +  +++HE CF C +C    PE  + +     +C    E D                        AP C  C   I G+  IK  N   H  CF C  C++++ D        R +C+ C  R  +   G   C KC  II+E+  I F    +H   F CA CGK L   A R + G L C
Sbjct:   16 CERCRSGFAPSEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYC----EHDFQML-------------------FAPCCHQCGEFIIGR-VIKAMNNSWHPECFRCDICQQVLADIGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIDEQPLI-FKNDPYHPDHFNCANCGKELTADA-RELKGELYC 187          
BLAST of Zyxin vs. Ensembl Mouse
Match: Lims1 (LIM and senescent cell antigen-like domains 1 [Source:MGI Symbol;Acc:MGI:1195263])

HSP 1 Score: 60.077 bits (144), Expect = 6.532e-10
Identity = 54/187 (28.88%), Postives = 76/187 (40.64%), Query Frame = 1
Query:  154 DKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            +K   +  +++HE CF C +C    PE  + +     +C    E D                   +F   AP C  C   I G+  IK  N   H  CF C  C++++ D        R +C+ C  R  +   G   C KC  II+E+  I F    +H   F CA CGK L   A R + G L C
Sbjct:   58 EKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYC----EHDFQM----------------LF---APCCHQCGEFIIGR-VIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIDEQPLI-FKNDPYHPDHFNCANCGKELTADA-RELKGELYC 218          
BLAST of Zyxin vs. Ensembl Mouse
Match: Lims1 (LIM and senescent cell antigen-like domains 1 [Source:MGI Symbol;Acc:MGI:1195263])

HSP 1 Score: 60.077 bits (144), Expect = 6.728e-10
Identity = 54/187 (28.88%), Postives = 76/187 (40.64%), Query Frame = 1
Query:  154 DKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            +K   +  +++HE CF C +C    PE  + +     +C    E D                   +F   AP C  C   I G+  IK  N   H  CF C  C++++ D        R +C+ C  R  +   G   C KC  II+E+  I F    +H   F CA CGK L   A R + G L C
Sbjct:   83 EKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYC----EHDFQM----------------LF---APCCHQCGEFIIGR-VIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIDEQPLI-FKNDPYHPDHFNCANCGKELTADA-RELKGELYC 243          
BLAST of Zyxin vs. Ensembl Mouse
Match: Lims1 (LIM and senescent cell antigen-like domains 1 [Source:MGI Symbol;Acc:MGI:1195263])

HSP 1 Score: 60.077 bits (144), Expect = 6.891e-10
Identity = 54/187 (28.88%), Postives = 76/187 (40.64%), Query Frame = 1
Query:  154 DKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            +K   +  +++HE CF C +C    PE  + +     +C    E D                   +F   AP C  C   I G+  IK  N   H  CF C  C++++ D        R +C+ C  R  +   G   C KC  II+E+  I F    +H   F CA CGK L   A R + G L C
Sbjct:   33 EKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYC----EHDFQM----------------LF---APCCHQCGEFIIGR-VIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIDEQPLI-FKNDPYHPDHFNCANCGKELTADA-RELKGELYC 193          
BLAST of Zyxin vs. Ensembl Mouse
Match: Lims1 (LIM and senescent cell antigen-like domains 1 [Source:MGI Symbol;Acc:MGI:1195263])

HSP 1 Score: 60.077 bits (144), Expect = 7.124e-10
Identity = 54/187 (28.88%), Postives = 76/187 (40.64%), Query Frame = 1
Query:  154 DKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            +K   +  +++HE CF C +C    PE  + +     +C    E D                   +F   AP C  C   I G+  IK  N   H  CF C  C++++ D        R +C+ C  R  +   G   C KC  II+E+  I F    +H   F CA CGK L   A R + G L C
Sbjct:   83 EKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYC----EHDFQM----------------LF---APCCHQCGEFIIGR-VIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIDEQPLI-FKNDPYHPDHFNCANCGKELTADA-RELKGELYC 243          
BLAST of Zyxin vs. Ensembl Mouse
Match: Fblim1 (filamin binding LIM protein 1 [Source:MGI Symbol;Acc:MGI:1921452])

HSP 1 Score: 55.4546 bits (132), Expect = 2.436e-8
Identity = 32/111 (28.83%), Postives = 53/111 (47.75%), Query Frame = 1
Query:  370 VCAVCKFGIQGK-FAIKVNNKMLHNTCFICYRCKKLI--KDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRL 693
            VC  C   +  +  A++   +  H  CF C  C++ +  + +YQ D   R +C+ C       +D +  C KC ++++E H I   G AFH  CF C  C +C+   +  L
Sbjct:  184 VCGFCHKPVSPRELAVEAMKRQYHAQCFTCRTCRRQLAGQRFYQKD--GRPLCEPCY------QDTLEKCGKCGEVVQE-HVIRALGKAFHPPCFTCVTCARCISDESFAL 285          
BLAST of Zyxin vs. UniProt/SwissProt
Match: sp|P50464|UNC97_CAEEL (LIM domain-containing protein unc-97 OS=Caenorhabditis elegans OX=6239 GN=unc-97 PE=1 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 4.429e-10
Identity = 54/201 (26.87%), Postives = 79/201 (39.30%), Query Frame = 1
Query:  151 NDKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTCAGHLLQDENPIPV 753
             D+   +  +++H  CF C +C    P+  Y +     +C    E D        +V+             +P C  C   I G+  IK  N   H  CF C  C K + D        R +C++C  R  +   G   C KC  +I++   I F G +FH   F+C  C   L   A R +NG L C      D   IP+
Sbjct:   31 QDQMVNSSGQVWHSECFVCAQCFEPFPDGIYFEYEGRKYC----EHDF-------HVLF------------SPCCGKCNEFIVGR-VIKAMNASWHPGCFCCEICNKQLADVGFLRNAGRALCRECNEREKAAGHGRYVCHKCHAMIDDGQHIKFRGDSFHPYHFKCKRCNNELTT-ASREVNGELYCL--RCHDTMGIPI 204          
BLAST of Zyxin vs. UniProt/SwissProt
Match: sp|Q99JW4|LIMS1_MOUSE (LIM and senescent cell antigen-like-containing domain protein 1 OS=Mus musculus OX=10090 GN=Lims1 PE=1 SV=3)

HSP 1 Score: 59.6918 bits (143), Expect = 5.322e-9
Identity = 54/187 (28.88%), Postives = 76/187 (40.64%), Query Frame = 1
Query:  154 DKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            +K   +  +++HE CF C +C    PE  + +     +C    E D                   +F   AP C  C   I G+  IK  N   H  CF C  C++++ D        R +C+ C  R  +   G   C KC  II+E+  I F    +H   F CA CGK L   A R + G L C
Sbjct:   21 EKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYC----EHDFQM----------------LF---APCCHQCGEFIIGR-VIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIDEQPLI-FKNDPYHPDHFNCANCGKELTADA-RELKGELYC 181          
BLAST of Zyxin vs. UniProt/SwissProt
Match: sp|P48059|LIMS1_HUMAN (LIM and senescent cell antigen-like-containing domain protein 1 OS=Homo sapiens OX=9606 GN=LIMS1 PE=1 SV=4)

HSP 1 Score: 59.6918 bits (143), Expect = 5.574e-9
Identity = 54/187 (28.88%), Postives = 76/187 (40.64%), Query Frame = 1
Query:  154 DKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            +K   +  +++HE CF C +C    PE  + +     +C    E D                   +F   AP C  C   I G+  IK  N   H  CF C  C++++ D        R +C+ C  R  +   G   C KC  II+E+  I F    +H   F CA CGK L   A R + G L C
Sbjct:   21 EKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYC----EHDFQM----------------LF---APCCHQCGEFIIGR-VIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIDEQPLI-FKNDPYHPDHFNCANCGKELTADA-RELKGELYC 181          
BLAST of Zyxin vs. UniProt/SwissProt
Match: sp|Q7Z4I7|LIMS2_HUMAN (LIM and senescent cell antigen-like-containing domain protein 2 OS=Homo sapiens OX=9606 GN=LIMS2 PE=1 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 3.489e-8
Identity = 53/198 (26.77%), Postives = 78/198 (39.39%), Query Frame = 1
Query:  124 CQKCSYEIK-NDKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            CQ+C       ++   +  +++HE+CF C +C    PE  + +     +C    E D                   +F   AP C  C   I G+  IK  N   H  CF C  C   + D        R +C+ C  R  +   G   C +C  +I+E+  + F   A+H   F C  CGK L   A R + G L C
Sbjct:   15 CQRCQARFSPAERIVNSNGELYHEHCFVCAQCFRPFPEGLFYEFEGRKYC----EHDFQM----------------LF---APCCGSCGEFIIGR-VIKAMNNNWHPGCFRCELCDVELADLGFVKNAGRHLCRPCHNREKAKGLGKYICQRCHLVIDEQPLM-FRSDAYHPDHFNCTHCGKELTAEA-RELKGELYC 186          
BLAST of Zyxin vs. UniProt/SwissProt
Match: sp|Q2KJ33|LIMS2_BOVIN (LIM and senescent cell antigen-like-containing domain protein 2 OS=Bos taurus OX=9913 GN=LIMS2 PE=2 SV=2)

HSP 1 Score: 56.9954 bits (136), Expect = 4.473e-8
Identity = 53/198 (26.77%), Postives = 78/198 (39.39%), Query Frame = 1
Query:  124 CQKCSYEI-KNDKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            CQ+C       ++   +  +++HE+CF C +C    PE  + +     +C    E D                   +F   AP C  C   I G+  IK  N   H  CF C  C   + D        R +C+ C  R  +   G   C +C  +I+E+  + F   A+H   F C  CGK L   A R + G L C
Sbjct:   15 CQRCQARFAPAERIVNSNGELYHEHCFVCAQCFRPFPEGLFYEFEGRKYC----EHDFQM----------------LF---APCCGSCGEFIIGR-VIKAMNNNWHPGCFRCELCDVELADLGFVKNAGRHLCRPCHNREKAKGLGKYICQRCHLVIDEQPLM-FKNDAYHPDHFSCTHCGKELTAEA-RELKGELYC 186          
BLAST of Zyxin vs. TrEMBL
Match: A0A0D2WU82 (AGC/DMPK/GEK protein kinase OS=Capsaspora owczarzaki (strain ATCC 30864) OX=595528 GN=CAOG_006515 PE=4 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 5.976e-11
Identity = 50/166 (30.12%), Postives = 70/166 (42.17%), Query Frame = 1
Query:  169 AMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQ--TDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAIC 660
            A+DKI H  CFQC KC  ++   +Y K+ + A+C    E D      PR                   CA CK  I  + AI   +K  H  CF+C  C+K ++D++   TD      CQ         E     C  C K+I  +  + F G  +HE C +C  C
Sbjct: 1400 ALDKIHHPKCFQCAKCSKVLNSGFYDKDGK-AYC----ENDYRLLFCPR-------------------CASCKQFIS-ETAIVAMDKRYHPKCFVCTHCRKPLRDFHMHGTD----FYCQ---------EHYRSICTTCNKVIAADKHVEFLGRRYHEHCLKCVSC 1527          
BLAST of Zyxin vs. TrEMBL
Match: I7M0R9 (LIM domain protein OS=Tetrahymena thermophila (strain SB210) OX=312017 GN=TTHERM_00142270 PE=4 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.790e-9
Identity = 50/195 (25.64%), Postives = 81/195 (41.54%), Query Frame = 1
Query:  124 CQKCSYEIKNDKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRL 708
            C KC+ +I + K     +K +HEN F C+ C   +    Y + + D +C +C  +++                       AP CA C   I        +   LH  CF+C+RCKK +   Y  DE    VC +C+      E  V  C  C++ I +   I   G  +H+ CF+C  C   + +      +G++
Sbjct:    7 CAKCNEQINDAKCVIVGEKFYHENHFTCSSCQADLSTQQYHQENDDYYCIECYSQNI-----------------------APKCAACGLAIIENIVQLADGVELHKECFVCFRCKKQLTAEYVQDEDKHIVCNECL------EQSVDKCDSCQQAILDCK-ISTGGKVYHQSCFKCNKCDLVIEQENHLEQDGQI 171          
BLAST of Zyxin vs. TrEMBL
Match: A0A5S6R0Q5 (Uncharacterized protein OS=Trichuris muris OX=70415 PE=4 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 3.958e-8
Identity = 41/123 (33.33%), Postives = 65/123 (52.85%), Query Frame = 1
Query:  373 CAVCKFGIQGKFAIKV--NNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDC-VIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTCAGHLLQ 732
            C+ C   I G FA+++   +K+ H  CF C +C+K +   +QT+E +R  C +C V R +      P C +C++ I ++HF+   G +FH +CF CA CGK           G+L C   L +
Sbjct:   11 CSRCWEHIMG-FAVRLKGTSKVFHEKCFRCAQCEKPLDKNFQTNE-ERLFCPECFVFRFH------PKCDRCQRDISDKHFMAAIGKSFHNECFSCAKCGKRFENNQYWQCRGQLYCQNDLAE 125          
BLAST of Zyxin vs. TrEMBL
Match: A0A504Y5N2 (LIM domain-containing protein OS=Fasciola gigantica OX=46835 GN=FGIG_04750 PE=4 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 4.046e-8
Identity = 57/211 (27.01%), Postives = 83/211 (39.34%), Query Frame = 1
Query:  124 CQKCSYEIK-NDKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTCAGHLLQDENPIPV 753
            C +C    + N+K  +A +  +H  CF C++C    PE  Y +     +C    E D        +V+             AP C  C + I G+  IK  N   H  CF C  C   + D        R +C +C  R  +     P C KC+  IEE   + +    +H   F C+ CG  L   A R  +G L C      D+  IP+
Sbjct:   40 CMRCGDAFQLNEKVVQAKEHTYHVKCFVCSQCFQPFPEGVYYEFDGRKYC----EHDF-------HVLF------------APCCGKCGYFISGR-VIKAMNNNWHPDCFRCQSCGACLADRGFVKLHGRALCHECNAREKASGLTHPICHKCRATIEEGQELKYRSEVYHAYHFNCSSCGLELSSDA-REKDGELFCL--RCHDKMGIPI 223          
BLAST of Zyxin vs. TrEMBL
Match: A0A1I7X3Z0 (Uncharacterized protein OS=Heterorhabditis bacteriophora OX=37862 PE=4 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 6.441e-8
Identity = 52/201 (25.87%), Postives = 75/201 (37.31%), Query Frame = 1
Query:  151 NDKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTCAGHLLQDENPIPV 753
             D+   +  +++H  CF C +C    P+  Y +     +C    E D                        AP C  C   I G+  IK  N   H  CF C  C K + D        R +C++C  R  +   G   C +C  +IEE   I + G +FH   F+C  C   L   + R + G L C      D   IP+
Sbjct:   34 QDQIVNSTGQVWHSQCFVCAQCFEPFPDGIYFEFEGHKYC----EHDFHVL-------------------YAPCCGKCNEFIVGR-VIKAMNASWHPECFRCELCNKALADIGFLRNAGRALCRECNEREKAAGSGRYVCHRCNAMIEEGQHIKYRGDSFHPYHFKCKRCNVELTTES-REIGGELYCL--RCHDTMGIPI 207          
BLAST of Zyxin vs. Ensembl Cavefish
Match: ENSAMXT00000048761.1 (LIM zinc finger domain containing 1 [Source:NCBI gene;Acc:103034328])

HSP 1 Score: 59.3066 bits (142), Expect = 8.173e-10
Identity = 57/198 (28.79%), Postives = 80/198 (40.40%), Query Frame = 1
Query:  124 CQKC-SYEIKNDKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            C++C S     +K   +  +++HE CF C +C    PE  + +     +C    E D                   +F   AP C  C   I G+  IK  N   H  CF C  C+ ++ D        R +C+ C  R  +   G   C KC  IIEE+  I F    +H   F C+ CGK L   A R + G L C
Sbjct:   21 CERCKSGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYC----EHDFQM----------------LF---APCCHQCGEFIIGR-VIKAMNNSWHPDCFCCDICQAVLADVGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIEEQPLI-FKNDPYHPDHFNCSNCGKELTADA-RELKGELYC 192          
BLAST of Zyxin vs. Ensembl Cavefish
Match: ENSAMXT00000051335.1 (LIM zinc finger domain containing 1 [Source:NCBI gene;Acc:103034328])

HSP 1 Score: 59.3066 bits (142), Expect = 9.543e-10
Identity = 57/198 (28.79%), Postives = 80/198 (40.40%), Query Frame = 1
Query:  124 CQKC-SYEIKNDKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            C++C S     +K   +  +++HE CF C +C    PE  + +     +C    E D                   +F   AP C  C   I G+  IK  N   H  CF C  C+ ++ D        R +C+ C  R  +   G   C KC  IIEE+  I F    +H   F C+ CGK L   A R + G L C
Sbjct:   21 CERCKSGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYC----EHDFQM----------------LF---APCCHQCGEFIIGR-VIKAMNNSWHPDCFCCDICQAVLADVGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIEEQPLI-FKNDPYHPDHFNCSNCGKELTADA-RELKGELYC 192          
BLAST of Zyxin vs. Ensembl Cavefish
Match: fhl1b (four and a half LIM domains protein 1 [Source:NCBI gene;Acc:103032814])

HSP 1 Score: 53.5286 bits (127), Expect = 7.271e-8
Identity = 54/200 (27.00%), Postives = 76/200 (38.00%), Query Frame = 1
Query:  124 CQKCSYEIKND-KAKKAMDKIFHENCFQCTKCC-NMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVC-KFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            C +C   I  D K      + +HE+CF+C KC  N+  E + TK+ R   C KC  ++                        AP C  C K  + G   ++      H  CF CY+CKK I       + D   C  C  +  + +     CA CKK I     + +    +H  CF CA C K L          R+ C
Sbjct:  100 CTECRRPIGTDSKELHHKGRYWHEDCFRCYKCYKNLAKESFSTKDDR-ILCGKCSSRE-----------------------DAPRCHTCYKPILAGTENVEYKGNTFHEECFTCYQCKKPISSQSFLTKNDNIYCTSCHEKKFAKQ-----CAGCKKAITSGG-VNYQDQPWHSACFVCASCQKPLAGTRFTSHEDRVYC 269          

HSP 2 Score: 51.6026 bits (122), Expect = 3.101e-7
Identity = 43/183 (23.50%), Postives = 70/183 (38.25%), Query Frame = 1
Query:  181 IFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKII----EEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTCA 717
             FHE CF C +C   I    +   + + +C  C EK                         A  CA CK  I     +   ++  H+ CF+C  C+K +     T  +DR  C DC   + + +     C+ C+  I    +  + + + G  +H+ CF C  C   L  +     NG + C+
Sbjct:  181 TFHEECFTCYQCKKPISSQSFLTKNDNIYCTSCHEKKF-----------------------AKQCAGCKKAITSG-GVNYQDQPWHSACFVCASCQKPLAGTRFTSHEDRVYCVDCYKNSVAKK-----CSACQNPITGFGKATNVVNYEGGTWHDYCFNCRKCSLNLSDKRFVSKNGDVYCS 334          
BLAST of Zyxin vs. Ensembl Cavefish
Match: fhl1b (four and a half LIM domains protein 1 [Source:NCBI gene;Acc:103032814])

HSP 1 Score: 53.1434 bits (126), Expect = 8.749e-8
Identity = 54/200 (27.00%), Postives = 76/200 (38.00%), Query Frame = 1
Query:  124 CQKCSYEIKND-KAKKAMDKIFHENCFQCTKCC-NMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVC-KFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            C +C   I  D K      + +HE+CF+C KC  N+  E + TK+ R   C KC  ++                        AP C  C K  + G   ++      H  CF CY+CKK I       + D   C  C  +  + +     CA CKK I     + +    +H  CF CA C K L          R+ C
Sbjct:   40 CTECRRPIGTDSKELHHKGRYWHEDCFRCYKCYKNLAKESFSTKDDR-ILCGKCSSRE-----------------------DAPRCHTCYKPILAGTENVEYKGNTFHEECFTCYQCKKPISSQSFLTKNDNIYCTSCHEKKFAKQ-----CAGCKKAITSGG-VNYQDQPWHSACFVCASCQKPLAGTRFTSHEDRVYC 209          

HSP 2 Score: 51.6026 bits (122), Expect = 3.069e-7
Identity = 43/183 (23.50%), Postives = 70/183 (38.25%), Query Frame = 1
Query:  181 IFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKII----EEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTCA 717
             FHE CF C +C   I    +   + + +C  C EK                         A  CA CK  I     +   ++  H+ CF+C  C+K +     T  +DR  C DC   + + +     C+ C+  I    +  + + + G  +H+ CF C  C   L  +     NG + C+
Sbjct:  121 TFHEECFTCYQCKKPISSQSFLTKNDNIYCTSCHEKKF-----------------------AKQCAGCKKAITSG-GVNYQDQPWHSACFVCASCQKPLAGTRFTSHEDRVYCVDCYKNSVAKK-----CSACQNPITGFGKATNVVNYEGGTWHDYCFNCRKCSLNLSDKRFVSKNGDVYCS 274          
BLAST of Zyxin vs. Ensembl Cavefish
Match: fblim1 (filamin binding LIM protein 1 [Source:NCBI gene;Acc:103030386])

HSP 1 Score: 51.2174 bits (121), Expect = 6.216e-7
Identity = 41/190 (21.58%), Postives = 68/190 (35.79%), Query Frame = 1
Query:  151 NDKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLI----------------KDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCL 672
            ++ A +A+++ +H +CFQC +C   +    Y   S    C  C +  L+                         C  C   I     I+   +  H  CF+C  C++ I                +DYY+      T+C + +I    G D               + +   G +FHE C+RC +CG  L
Sbjct:  302 SEPAIEALNRTYHSSCFQCRQCHAPLAGKMYYNKSGIPLCEDCYQASLEP------------------------CWACGEVIM-DHVIRALERAYHPPCFVCTTCRQPIGEQRFAQGEVGEVYCLQDYYRKYAPQCTICGELIIPREDGTD--------------SYTVECLGRSFHEDCYRCEVCGVLL 452          
BLAST of Zyxin vs. Ensembl Sea Lamprey
Match: lims2 (LIM and senescent cell antigen-like domains 2 [Source:ZFIN;Acc:ZDB-GENE-050522-56])

HSP 1 Score: 52.7582 bits (125), Expect = 2.273e-8
Identity = 54/204 (26.47%), Postives = 80/204 (39.22%), Query Frame = 1
Query:  112 SHLKCQKCSYEIKNDKAKKAMD---KIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            ++  C++C         ++ ++   ++FHENCF C +C     ++ Y    R     K  E D                   +F   AP C      I G+  IK  N   H  CF C  C +++ D        R +C+ C  R  +   G   C KC  II+E+  + F    +H   F C  CGK L   A R + G L C
Sbjct:   73 ANAACERCKAGFPPSATERIVNSNGELFHENCFVCAQC---FQQFLYEFEGR-----KYCEHDFQM----------------LF---APCCGQSGEFIVGR-VIKAMNNSWHPECFRCNICSEMLADVGFVKNAGRHLCRPCHNREKAKGLGKYICQKCHAIIDEQPLL-FKNDPYHPDHFNCTNCGKELTADA-RELKGELYC 246          
BLAST of Zyxin vs. Ensembl Yeast
Match: RGA2 (GTPase-activating protein for polarity-establishment protein Cdc42p; implicated in control of septin organization, pheromone response, and haploid invasive growth; regulated by Pho85p and Cdc28p; RGA2 has a paralog, RGA1, that arose from the whole genome duplication [Source:SGD;Acc:S000002787])

HSP 1 Score: 45.8246 bits (107), Expect = 4.859e-6
Identity = 30/111 (27.03%), Postives = 47/111 (42.34%), Query Frame = 1
Query:  337 VSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRC-KKLIKDY-YQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFI-PFWGVAFHEKCFRCAIC 660
            +S +  N ++ +C  C   I      ++ +K  H+ CF CY+C KKL  D  +   +    +C DC  +          C  C   I++   I P    A+   CFRC  C
Sbjct:    1 MSADPINDQSSLCVRCNKSIASSQVYELESKKWHDQCFTCYKCDKKLNADSDFLVLDIGTLICYDCSDK----------CTNCGDKIDDTAIILPSSNEAYCSNCFRCCRC 101          
BLAST of Zyxin vs. Ensembl Nematostella
Match: LIMPET (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFX6])

HSP 1 Score: 56.225 bits (134), Expect = 5.033e-9
Identity = 49/200 (24.50%), Postives = 72/200 (36.00%), Query Frame = 1
Query:  121 KCQKCSYEI-KNDKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGI-QGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            +C+ C   I    K      K +HE CF+C++C   +    +T       CH C                         NP + VCA C      G+  +   +K  H+ CFIC  CK+ I         +R +C +C             C KC ++I+    +   G  +H +CF C  C K L         GR  C
Sbjct:  317 RCEACGEPIGPGSKDVDVRSKHWHEGCFKCSQCSKQLMNEGFTLKDEKLICHGC----------------------RGINP-SKVCAACNGDFAPGEKKVGYQSKTFHDKCFICDECKQPIGSKQFIRRDERRLCNNCF-----DSKFAKVCVKCNQVIKTSS-VQHAGSTYHSECFTCHHCDKPLAGSPFTKQEGRNVC 487          

HSP 2 Score: 53.1434 bits (126), Expect = 5.347e-8
Identity = 44/180 (24.44%), Postives = 66/180 (36.67%), Query Frame = 1
Query:  178 KIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIE-EEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            K FH+ CF C +C   I    + +      C+ C +                          A VC  C   I+   +++      H+ CF C+ C K +     T ++ R VCQ+C       E     C  C  +IE    F+ +    FH +CF C  C K L     R+ +G   C
Sbjct:  398 KTFHDKCFICDECKQPIGSKQFIRRDERRLCNNCFDSKF-----------------------AKVCVKCNQVIKTS-SVQHAGSTYHSECFTCHHCDKPLAGSPFTKQEGRNVCQNCYR-----ERYAKRCGACHNLIEGNTKFVAYDEKYFHRECFTCCKCNKPLAGEKFRIRDGEKIC 548          
BLAST of Zyxin vs. Ensembl Nematostella
Match: EDO47660 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLT9])

HSP 1 Score: 48.521 bits (114), Expect = 1.172e-6
Identity = 43/172 (25.00%), Postives = 62/172 (36.05%), Query Frame = 1
Query:  151 NDKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGK 666
            +++   +  +I HE CF C +C    P+  + +     FC    E D  T                +F   AP C  C   + G+  IK      H  CF C  C   + D        R +C+ C     + + G   C KC   I E   I + G   H   + C  CGK
Sbjct:   31 DERMVNSNGQILHERCFVCVQCFQAFPDGLFYEYDGRRFC----EHDFQT----------------LF---APCCKQCGKFVIGR-VIKAMQANWHPDCFRCEICNDCLADTGFVKNAGRALCKKCNADEKTKKTGRYVCRKCHTYIPEGEHIMYMGDPVHPWHYNCFCCGK 178          
BLAST of Zyxin vs. Ensembl Nematostella
Match: EDO41100 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5D2])

HSP 1 Score: 47.3654 bits (111), Expect = 3.899e-6
Identity = 52/246 (21.14%), Postives = 89/246 (36.18%), Query Frame = 1
Query:  121 KCQKCSYEIKNDKAKKAMDKI-----FHENCFQCTKCCNMIPEWYYTKNSRDAFCHK-CVEKDLDTYGNPRNVIIVS----------------------SVSGEVFNPKA--PVCAVC--------------KFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKD-RTVCQDCVIRANSGEDGVPACAKCKKIIEE-EHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTCAG 720
            +C +CS+ I   +     + I     FH  CF C  C  ++ E  Y +++   +C +   E      G    +I                         S++G  F  +   PVC  C              K G + +     +++  H+ CFIC  C++ +K        + ++ C  C +     E     C  C +II+     + + G  +HE CFRCA CG+ +        +    C G
Sbjct:  166 RCARCSHPILRSEPAVVAENIGAEASFHPGCFTCETCNELLVELTYFQHADKVYCGRHFAELQKSRCGGCDELIFTGEYTVAMNKNWHLGHFQCQTCDHSITGRQFIVRGDKPVCTDCFKDSYAHECEACHQKIGPESRDISSDDDRHWHDKCFICDICRRPLKSEGSLHSTETKSCCNKCYVANYQKE-----CCACGQIIDSGASRLEYSGNFWHENCFRCANCGEAIGTSGFVPKDDTFFCPG 406          
BLAST of Zyxin vs. Ensembl Medaka
Match: lims2 (LIM and senescent cell antigen-like-containing domain protein 1 [Source:NCBI gene;Acc:101164852])

HSP 1 Score: 57.3806 bits (137), Expect = 4.940e-9
Identity = 55/198 (27.78%), Postives = 79/198 (39.90%), Query Frame = 1
Query:  124 CQKC-SYEIKNDKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            C++C S     +K   +  +++HE CF C +C    PE  + +     +C    E D                   +F   AP C  C   I G+  IK  N   H  CF C  C+ ++ D        R +C+ C  R  +   G   C KC  II+E+  + F    +H   F C  CGK L   A R + G L C
Sbjct:   79 CERCKSGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYC----EHDFQM----------------LF---APCCHQCGEFIIGR-VIKAMNNSWHPDCFCCVICQAVLADVGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIDEQPLL-FKNDPYHPDHFNCNNCGKELTADA-RELKGELYC 250          
BLAST of Zyxin vs. Ensembl Medaka
Match: lims2 (LIM and senescent cell antigen-like-containing domain protein 1 [Source:NCBI gene;Acc:101164852])

HSP 1 Score: 57.3806 bits (137), Expect = 5.225e-9
Identity = 55/198 (27.78%), Postives = 79/198 (39.90%), Query Frame = 1
Query:  124 CQKC-SYEIKNDKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            C++C S     +K   +  +++HE CF C +C    PE  + +     +C    E D                   +F   AP C  C   I G+  IK  N   H  CF C  C+ ++ D        R +C+ C  R  +   G   C KC  II+E+  + F    +H   F C  CGK L   A R + G L C
Sbjct:   79 CERCKSGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYC----EHDFQM----------------LF---APCCHQCGEFIIGR-VIKAMNNSWHPDCFCCVICQAVLADVGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIDEQPLL-FKNDPYHPDHFNCNNCGKELTADA-RELKGELYC 250          
BLAST of Zyxin vs. Ensembl Medaka
Match: lims2 (LIM and senescent cell antigen-like-containing domain protein 1 [Source:NCBI gene;Acc:101164852])

HSP 1 Score: 56.9954 bits (136), Expect = 5.507e-9
Identity = 55/198 (27.78%), Postives = 79/198 (39.90%), Query Frame = 1
Query:  124 CQKC-SYEIKNDKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            C++C S     +K   +  +++HE CF C +C    PE  + +     +C    E D                   +F   AP C  C   I G+  IK  N   H  CF C  C+ ++ D        R +C+ C  R  +   G   C KC  II+E+  + F    +H   F C  CGK L   A R + G L C
Sbjct:   21 CERCKSGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYC----EHDFQM----------------LF---APCCHQCGEFIIGR-VIKAMNNSWHPDCFCCVICQAVLADVGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIDEQPLL-FKNDPYHPDHFNCNNCGKELTADA-RELKGELYC 192          
BLAST of Zyxin vs. Ensembl Medaka
Match: pxna (paxillin [Source:NCBI gene;Acc:101171569])

HSP 1 Score: 56.9954 bits (136), Expect = 9.664e-9
Identity = 52/199 (26.13%), Postives = 77/199 (38.69%), Query Frame = 1
Query:  121 KCQKCSYEIKNDKAKKAMDKIFHENCFQCTKCCNMI-PEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            +C  C+  I  DK   A+DK +H   F C +C +   PE ++ K+ + AFC K                       + F+  AP C  C   I   + I   N + H  CF+C  C     +    D   +  C+     ++  E     C+ C+K I     I   G  FH + F CA C K L K   +  N +  C
Sbjct:  959 RCHYCNGPIL-DKVVTALDKTWHPEHFFCAQCGSFFGPEGFHEKDGK-AFCRK-----------------------DYFDMFAPKCGGCARAILENY-ISALNSLWHPECFVCRECFTPFINGSFFDHDGQPYCE-----SHYHERRGSLCSGCQKPITGR-CITAMGKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYC 1125          
BLAST of Zyxin vs. Ensembl Medaka
Match: pxna (paxillin [Source:NCBI gene;Acc:101171569])

HSP 1 Score: 56.6102 bits (135), Expect = 1.085e-8
Identity = 52/199 (26.13%), Postives = 77/199 (38.69%), Query Frame = 1
Query:  121 KCQKCSYEIKNDKAKKAMDKIFHENCFQCTKCCNMI-PEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTC 714
            +C  C+  I  DK   A+DK +H   F C +C +   PE ++ K+ + AFC K                       + F+  AP C  C   I   + I   N + H  CF+C  C     +    D   +  C+     ++  E     C+ C+K I     I   G  FH + F CA C K L K   +  N +  C
Sbjct:  761 RCHYCNGPIL-DKVVTALDKTWHPEHFFCAQCGSFFGPEGFHEKDGK-AFCRK-----------------------DYFDMFAPKCGGCARAILENY-ISALNSLWHPECFVCRECFTPFINGSFFDHDGQPYCE-----SHYHERRGSLCSGCQKPITGR-CITAMGKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYC 927          
BLAST of Zyxin vs. Planmine SMEST
Match: SMESG000023302.1 (SMESG000023302.1)

HSP 1 Score: 452.21 bits (1162), Expect = 3.463e-163
Identity = 219/219 (100.00%), Postives = 219/219 (100.00%), Query Frame = 1
Query:   97 MHRDESHLKCQKCSYEIKNDKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTCAGHLLQDENPIPV 753
            MHRDESHLKCQKCSYEIKNDKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTCAGHLLQDENPIPV
Sbjct:    1 MHRDESHLKCQKCSYEIKNDKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTCAGHLLQDENPIPV 219          
BLAST of Zyxin vs. Planmine SMEST
Match: SMESG000023302.1 (SMESG000023302.1)

HSP 1 Score: 330.487 bits (846), Expect = 1.906e-115
Identity = 162/166 (97.59%), Postives = 162/166 (97.59%), Query Frame = 1
Query:   97 MHRDESHLKCQKCSYEIKNDKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIE 594
            MHRDESHLKCQKCSYEIKNDKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACA CK  I 
Sbjct:    1 MHRDESHLKCQKCSYEIKNDKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAYCKTKIR 166          

HSP 2 Score: 56.225 bits (134), Expect = 4.747e-15
Identity = 25/31 (80.65%), Postives = 26/31 (83.87%), Query Frame = 2
Query:  704 DSLVQDTYCKTKIRFQFKRITICHFYWTFFP 796
            D +    YCKTKIRFQFKRITICHFYWTFFP
Sbjct:  153 DGVPACAYCKTKIRFQFKRITICHFYWTFFP 183          

HSP 3 Score: 42.743 bits (99), Expect = 4.747e-15
Identity = 36/120 (30.00%), Postives = 48/120 (40.00%), Query Frame = 1
Query:  373 CAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCV---------------IRANSGE---DGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIK 678
            C  C + I+   A K  +K+ H  CF C +C  +I ++Y T       C  CV               + + SGE      P CA CK  I+ +  I       H  CF C  C K LIK
Sbjct:   10 CQKCSYEIKNDKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKK-LIK 128          
BLAST of Zyxin vs. Planmine SMEST
Match: SMESG000047648.1 (SMESG000047648.1)

HSP 1 Score: 62.003 bits (149), Expect = 2.012e-11
Identity = 52/191 (27.23%), Postives = 78/191 (40.84%), Query Frame = 1
Query:  154 DKAKKAMDKIFHENCFQCTKCCNMIPEWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMN-GRLTCAGH 723
            D    A+++ +H +CF C  C   I   +   + +   C +C  +     G   + I V+S           +CA CK  I     I   +K  H +CF+C  C   I   Y     D+  C++C       ++    C  C   I +  F  F G  +H  CFRC ICGK L+ + L   N G + C  H
Sbjct:   11 DTIISALNQKWHPDCFTCNICNERITGDFSGVDQK-PVCFRCHAR---MSGIRTDSIKVTS--------SDIICAKCKNKINNGSIITAGHKNYHKSCFVCENCNAPIHGEY-LPRNDKIYCKNC-----HSKNFAEKCHTCHFPITDSEFTVFDGSHYHHSCFRCTICGKTLVGQVLSRSNTGGVCCVDH 183          
BLAST of Zyxin vs. Planmine SMEST
Match: SMESG000023063.1 (SMESG000023063.1)

HSP 1 Score: 54.6842 bits (130), Expect = 2.326e-9
Identity = 33/118 (27.97%), Postives = 49/118 (41.53%), Query Frame = 1
Query:  370 VCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTCAGH 723
            VC  C   I     +   ++  H  CF C+RC+K I   + T   +   C      A   E   P C KC + I  E ++ +    +H+ CF C ICG  L+ +   L   +  C  H
Sbjct:    7 VCCKCNNEINKGSIVTALSRKWHPECFKCFRCEKPISGQFNTPPGNTDPC----CAACYKELFSPKCKKCGEAIANEKYVNYEADCYHQACFNCNICGDSLVDKPFILKEDQPACTKH 120          
BLAST of Zyxin vs. Planmine SMEST
Match: SMESG000066861.1 (SMESG000066861.1)

HSP 1 Score: 55.4546 bits (132), Expect = 1.172e-8
Identity = 52/202 (25.74%), Postives = 81/202 (40.10%), Query Frame = 1
Query:  124 CQKCSYEIKNDKAKKAMDKIFHENCFQCTKCCNMIP-EWYYTKNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGIQGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANSGEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLMNGRLTCAGHL 726
            C +C+  I   +  KA+D  +H +CF C+ C   +     + K  R+A+C KC       Y + +N I           P    C  CK  I     +K   +  H   F C  C   +   ++  + D   C  C  +      GVP C+ CK+ +EE   I   G A+H + F C+ C K  +     + N  + C  H 
Sbjct:   90 CHRCNQFILEGRVIKAIDHSWHASCFNCSSCGESLSNSSTFKKFERNAYCQKC-------YNDVKNRI-----------PGVHYCYKCKGPIVLDGHLKSEGEFYHPYHFKCKTCLNELDRNFREKDGD-FYCLRCFDKM-----GVPICSVCKRPVEER-VIYAMGKAYHVEHFVCSFCSKPFLGSRYFIHNKEVFCELHF 266          
The following BLAST results are available for this feature:
BLAST of Zyxin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LIMS19.170e-1028.88LIM zinc finger domain containing 1 [Source:HGNC S... [more]
LIMS11.026e-928.88LIM zinc finger domain containing 1 [Source:HGNC S... [more]
LIMS11.101e-928.88LIM zinc finger domain containing 1 [Source:HGNC S... [more]
LIMS11.138e-928.88LIM zinc finger domain containing 1 [Source:HGNC S... [more]
LIMS11.161e-928.88LIM zinc finger domain containing 1 [Source:HGNC S... [more]
back to top
BLAST of Zyxin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-973.482e-1126.87LIM domain-containing protein unc-97 [Source:UniP... [more]
unc-973.482e-1126.87LIM domain-containing protein unc-97 [Source:UniP... [more]
zyx-13.069e-725.00Zyxin [Source:UniProtKB/Swiss-Prot;Acc:Q9U3F4][more]
zyx-15.521e-725.00Zyxin [Source:UniProtKB/Swiss-Prot;Acc:Q9U3F4][more]
zyx-16.596e-724.74Zyxin [Source:UniProtKB/Swiss-Prot;Acc:Q9U3F4][more]
back to top
BLAST of Zyxin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lmpt9.528e-723.98gene:FBgn0261565 transcript:FBtr0302785[more]
Zasp521.022e-628.33gene:FBgn0265991 transcript:FBtr0329911[more]
Zasp521.038e-628.33gene:FBgn0265991 transcript:FBtr0342711[more]
Zasp521.040e-628.33gene:FBgn0265991 transcript:FBtr0392901[more]
Zasp521.042e-628.33gene:FBgn0265991 transcript:FBtr0100388[more]
back to top
BLAST of Zyxin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lims17.663e-1028.22LIM and senescent cell antigen-like domains 1 [Sou... [more]
lims18.793e-1028.22LIM and senescent cell antigen-like domains 1 [Sou... [more]
lims21.536e-724.24LIM and senescent cell antigen-like domains 2 [Sou... [more]
lims21.910e-724.75LIM and senescent cell antigen-like domains 2 [Sou... [more]
pdlim73.174e-731.03PDZ and LIM domain 7 [Source:NCBI gene;Acc:393813][more]
back to top
BLAST of Zyxin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lims13.797e-1028.79LIM-type zinc finger domains 1 [Source:NCBI gene;A... [more]
lims13.857e-1028.79LIM-type zinc finger domains 1 [Source:NCBI gene;A... [more]
lims14.399e-1028.79LIM-type zinc finger domains 1 [Source:NCBI gene;A... [more]
lims14.665e-1028.79LIM-type zinc finger domains 1 [Source:NCBI gene;A... [more]
lims14.859e-1028.28LIM-type zinc finger domains 1 [Source:NCBI gene;A... [more]
back to top
BLAST of Zyxin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lims16.532e-1028.88LIM and senescent cell antigen-like domains 1 [Sou... [more]
Lims16.728e-1028.88LIM and senescent cell antigen-like domains 1 [Sou... [more]
Lims16.891e-1028.88LIM and senescent cell antigen-like domains 1 [Sou... [more]
Lims17.124e-1028.88LIM and senescent cell antigen-like domains 1 [Sou... [more]
Fblim12.436e-828.83filamin binding LIM protein 1 [Source:MGI Symbol;A... [more]
back to top
BLAST of Zyxin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P50464|UNC97_CAEEL4.429e-1026.87LIM domain-containing protein unc-97 OS=Caenorhabd... [more]
sp|Q99JW4|LIMS1_MOUSE5.322e-928.88LIM and senescent cell antigen-like-containing dom... [more]
sp|P48059|LIMS1_HUMAN5.574e-928.88LIM and senescent cell antigen-like-containing dom... [more]
sp|Q7Z4I7|LIMS2_HUMAN3.489e-826.77LIM and senescent cell antigen-like-containing dom... [more]
sp|Q2KJ33|LIMS2_BOVIN4.473e-826.77LIM and senescent cell antigen-like-containing dom... [more]
back to top
BLAST of Zyxin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0D2WU825.976e-1130.12AGC/DMPK/GEK protein kinase OS=Capsaspora owczarza... [more]
I7M0R91.790e-925.64LIM domain protein OS=Tetrahymena thermophila (str... [more]
A0A5S6R0Q53.958e-833.33Uncharacterized protein OS=Trichuris muris OX=7041... [more]
A0A504Y5N24.046e-827.01LIM domain-containing protein OS=Fasciola gigantic... [more]
A0A1I7X3Z06.441e-825.87Uncharacterized protein OS=Heterorhabditis bacteri... [more]
back to top
BLAST of Zyxin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000048761.18.173e-1028.79LIM zinc finger domain containing 1 [Source:NCBI g... [more]
ENSAMXT00000051335.19.543e-1028.79LIM zinc finger domain containing 1 [Source:NCBI g... [more]
fhl1b7.271e-827.00four and a half LIM domains protein 1 [Source:NCBI... [more]
fhl1b8.749e-827.00four and a half LIM domains protein 1 [Source:NCBI... [more]
fblim16.216e-721.58filamin binding LIM protein 1 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Zyxin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
lims22.273e-826.47LIM and senescent cell antigen-like domains 2 [Sou... [more]
back to top
BLAST of Zyxin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RGA24.859e-627.03GTPase-activating protein for polarity-establishme... [more]
back to top
BLAST of Zyxin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
LIMPET5.033e-924.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476601.172e-625.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411003.899e-621.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Zyxin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lims24.940e-927.78LIM and senescent cell antigen-like-containing dom... [more]
lims25.225e-927.78LIM and senescent cell antigen-like-containing dom... [more]
lims25.507e-927.78LIM and senescent cell antigen-like-containing dom... [more]
pxna9.664e-926.13paxillin [Source:NCBI gene;Acc:101171569][more]
pxna1.085e-826.13paxillin [Source:NCBI gene;Acc:101171569][more]
back to top
BLAST of Zyxin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023302.13.463e-163100.00SMESG000023302.1[more]
SMESG000023302.11.906e-11597.59SMESG000023302.1[more]
SMESG000047648.12.012e-1127.23SMESG000047648.1[more]
SMESG000023063.12.326e-927.97SMESG000023063.1[more]
SMESG000066861.11.172e-825.74SMESG000066861.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002756 ID=SMED30002756|Name=Zyxin|organism=Schmidtea mediterranea sexual|type=transcript|length=864bp
ATTTTTTTCATTTAACAAAGTATATAAAAGCTTTGAAAATTAATTTATAG
AAATCAATTTTTTCAATTAATTTTATCGAGTTCGTTCATTTCGAAAATGC
ACCGTGATGAATCCCACCTAAAGTGTCAAAAATGTAGTTATGAAATAAAA
AACGACAAAGCGAAAAAGGCAATGGATAAAATCTTTCACGAAAACTGTTT
CCAATGCACAAAATGCTGCAACATGATTCCCGAATGGTATTATACGAAAA
ATAGCAGAGACGCATTCTGTCATAAATGCGTAGAAAAAGACCTTGATACT
TACGGGAATCCAAGAAATGTGATTATTGTTTCATCTGTATCCGGAGAGGT
CTTTAATCCTAAAGCTCCCGTCTGTGCAGTATGTAAATTTGGCATACAAG
GAAAATTCGCCATTAAAGTCAACAATAAAATGTTACATAATACGTGTTTT
ATTTGCTATCGTTGCAAGAAACTAATTAAAGACTATTATCAAACGGATGA
AAAAGATCGCACAGTTTGTCAAGATTGTGTCATCAGGGCCAATAGTGGAG
AAGACGGAGTACCTGCTTGCGCAAAATGCAAAAAAATTATCGAAGAAGAA
CATTTTATTCCATTCTGGGGAGTAGCGTTTCATGAGAAATGTTTCCGATG
TGCAATTTGCGGTAAGTGCTTAATCAAAAGAGCTCTCCGACTAATGAACG
GCCGACTCACTTGTGCAGGACACTTATTGCAAGACGAAAATCCGATTCCA
GTTTAAAAGGATAACTATTTGCCATTTCTATTGGACTTTTTTTCCATTCA
TCAAACTTCATTATATTTAACTATATTTCTTGAAAATATTATTTATTTTA
AAATTTTGAAAAAA
back to top

protein sequence of SMED30002756-orf-1

>SMED30002756-orf-1 ID=SMED30002756-orf-1|Name=SMED30002756-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=220bp
MHRDESHLKCQKCSYEIKNDKAKKAMDKIFHENCFQCTKCCNMIPEWYYT
KNSRDAFCHKCVEKDLDTYGNPRNVIIVSSVSGEVFNPKAPVCAVCKFGI
QGKFAIKVNNKMLHNTCFICYRCKKLIKDYYQTDEKDRTVCQDCVIRANS
GEDGVPACAKCKKIIEEEHFIPFWGVAFHEKCFRCAICGKCLIKRALRLM
NGRLTCAGHLLQDENPIPV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR001781Znf_LIM
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0003779actin binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0007010cytoskeleton organization
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001781Zinc finger, LIM-typeSMARTSM00132lim_4coord: 157..209
e-value: 2.3E-6
score: 37.1
coord: 92..144
e-value: 3.9E-8
score: 43.0
coord: 9..61
e-value: 0.0022
score: 23.4
IPR001781Zinc finger, LIM-typePFAMPF00412LIMcoord: 93..147
e-value: 5.9E-8
score: 32.8
coord: 158..211
e-value: 3.5E-9
score: 36.8
coord: 10..64
e-value: 4.4E-7
score: 30.0
IPR001781Zinc finger, LIM-typePROSITEPS00478LIM_DOMAIN_1coord: 158..192
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 156..216
score: 11.593
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 8..68
score: 11.573
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 91..151
score: 10.405
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 154..215
e-value: 1.5E-11
score: 46.1
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 82..153
e-value: 1.6E-9
score: 39.5
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 6..81
e-value: 8.4E-10
score: 41.0
NoneNo IPR availablePANTHERPTHR24216FAMILY NOT NAMEDcoord: 89..212
coord: 9..147
NoneNo IPR availableCDDcd08368LIMcoord: 158..209
e-value: 1.5472E-5
score: 39.2231
NoneNo IPR availableCDDcd08368LIMcoord: 93..144
e-value: 1.08034E-4
score: 36.9119
NoneNo IPR availableCDDcd08368LIMcoord: 10..61
e-value: 1.18151E-4
score: 36.9119