TPR_REGION domain-containing protein

Overview
NameTPR_REGION domain-containing protein
Smed IDSMED30002754
Length (bp)2881
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TPR_REGION domain-containing protein (SMED30002754) t-SNE clustered cells

Violin plots show distribution of expression levels for TPR_REGION domain-containing protein (SMED30002754) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TPR_REGION domain-containing protein (SMED30002754) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TPR_REGION domain-containing protein (SMED30002754) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002754

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30002754SMESG000008310.1 SmedASXL_016111SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30002754SMESG000008310.1 dd_Smed_v4_11374_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30002754SMESG000008310.1 dd_Smed_v4_11374_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30002754SMESG000008310.1 dd_Smed_v6_11374_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30002754SMESG000008310.1 OX_Smed_1.0.04547ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TPR_REGION domain-containing protein vs. TrEMBL
Match: A0A267H7U1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030458g1 PE=4 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 9.040e-39
Identity = 116/399 (29.07%), Postives = 198/399 (49.62%), Query Frame = 3
Query:  102 RLWRIWNFIFLVVLYIYLVYDCIFRYIKFKKYSLDLGFGSNYSAVHMNIYLICIISGLTCFPFSLYCILFFNGNYADDNIKVGKDTDNFKIHQENDVTWQPDELTNLEKSKNILWKRLKRHFLPYSFIMHFVSAICFLVPIPFLEAHQIHQKVLKPNEIWHSDLDFLWDIDSWHSDFDNNGRWRTTWLMKPQYFNLIFCLLCLVLKYPNVFWACHKGXXXXXXXXXXXXXXHVIIDYSTTCVLIRVASNPEFVAEKLRITFXXXXXXXXXXXXXXXXXXXTFWCVFEFGFHQFLDNLSRYRHLMLIQCDGSHDGSNMSDITCCKRKDLYLRGYLPHFGAIFGCAIGFIMKTPLFYASISVIYHHTSDPXXXXXXXXXXXFICAWFIAWFGFTLKPNWRF 1298
            ++WRIW  I ++ L  +L+Y    RY  F+  +L       +    MN YL  +I  +   PF LY  L    NYA+D +++G+D D  ++        +       + +      RL+RHF+PY+ ++H ++A C L+P+P LEA +IH      +EIW ++LDF++           + +   T  + P+ FNL+  L  L+++YP+ FW  ++ F+F FS++L +  LH+++ Y  T VL + AS    V  ++ +   + I+L  +  L   V  + F   FEFG+ Q L NL +YR+ +  Q + S   S+ S  +C      +L  Y PH   I    +  + K P+ +  +  +Y     P ML  ++   +++  W   WF    K NW+F
Sbjct:   10 KMWRIWYAILVLALNAFLLYSAFQRYASFRAKALR----EQWDMSPMNFYLAMMIITVFLLPFFLYAALAKTANYAEDGVQIGRDRDCLRV-----AIAETSSGAGAQATVGTCMSRLRRHFMPYTCLLHVLTAFCLLIPMPVLEAAEIHHAKRPSDEIWRTNLDFIY-----------HPKASATNSVCPEVFNLMLALAILLVRYPSTFWFSNRAFAFMFSVILCVCGLHIVLSYEATSVLFK-ASMSNGVVTQVNLLPPAIIALHSIGDLLLLVANIAF---FEFGYAQMLSNLRKYRNYL--QLEASSSVSDRSISSCNDETPCWL-NYAPHLAGILLMVVAVLCKAPVLWDWVG-LYRVHQQPAMLAAVVSGGIYLSLWVSVWFLLGFKANWKF 380          
BLAST of TPR_REGION domain-containing protein vs. TrEMBL
Match: A0A267E669 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030458g3 PE=4 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.362e-38
Identity = 116/399 (29.07%), Postives = 198/399 (49.62%), Query Frame = 3
Query:  102 RLWRIWNFIFLVVLYIYLVYDCIFRYIKFKKYSLDLGFGSNYSAVHMNIYLICIISGLTCFPFSLYCILFFNGNYADDNIKVGKDTDNFKIHQENDVTWQPDELTNLEKSKNILWKRLKRHFLPYSFIMHFVSAICFLVPIPFLEAHQIHQKVLKPNEIWHSDLDFLWDIDSWHSDFDNNGRWRTTWLMKPQYFNLIFCLLCLVLKYPNVFWACHKGXXXXXXXXXXXXXXHVIIDYSTTCVLIRVASNPEFVAEKLRITFXXXXXXXXXXXXXXXXXXXTFWCVFEFGFHQFLDNLSRYRHLMLIQCDGSHDGSNMSDITCCKRKDLYLRGYLPHFGAIFGCAIGFIMKTPLFYASISVIYHHTSDPXXXXXXXXXXXFICAWFIAWFGFTLKPNWRF 1298
            ++WRIW  I ++ L  +L+Y    RY  F+  +L       +    MN YL  +I  +   PF LY  L    NYA+D +++G+D D  ++        +       + +      RL+RHF+PY+ ++H ++A C L+P+P LEA +IH      +EIW ++LDF++           + +   T  + P+ FNL+  L  L+++YP+ FW  ++ F+F FS++L +  LH+++ Y  T VL + AS    V  ++ +   + I+L  +  L   V  + F   FEFG+ Q L NL +YR+ +  Q + S   S+ S  +C      +L  Y PH   I    +  + K P+ +  +  +Y     P ML  ++   +++  W   WF    K NW+F
Sbjct:   43 KMWRIWYAILVLALNAFLLYSAFQRYASFRAKALR----EQWDMSPMNFYLAMMILTVFLLPFFLYAALAKTANYAEDGVQIGRDRDCLRV-----AIAETSSGAGAQATVGTCMSRLRRHFMPYTCLLHVLTAFCLLIPMPVLEAAEIHHAKRPSDEIWRTNLDFIY-----------HPKASATNSVCPEVFNLMLALAILLVRYPSTFWFSNRAFAFMFSVILCVCGLHIVLSYEATSVLFK-ASMSNGVVTQVNLLPPAIIALHSIGDLLLLVANIAF---FEFGYAQMLSNLRKYRNYL--QLEASSSVSDRSISSCNDETPCWL-NYAPHLAGILLMVVAVLCKAPVLWDWVG-LYRVHQQPAMLAAVVSGGIYLSLWVSVWFLLGFKANWKF 413          
BLAST of TPR_REGION domain-containing protein vs. TrEMBL
Match: A0A267GLJ3 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030458g2 PE=4 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 1.758e-38
Identity = 116/399 (29.07%), Postives = 198/399 (49.62%), Query Frame = 3
Query:  102 RLWRIWNFIFLVVLYIYLVYDCIFRYIKFKKYSLDLGFGSNYSAVHMNIYLICIISGLTCFPFSLYCILFFNGNYADDNIKVGKDTDNFKIHQENDVTWQPDELTNLEKSKNILWKRLKRHFLPYSFIMHFVSAICFLVPIPFLEAHQIHQKVLKPNEIWHSDLDFLWDIDSWHSDFDNNGRWRTTWLMKPQYFNLIFCLLCLVLKYPNVFWACHKGXXXXXXXXXXXXXXHVIIDYSTTCVLIRVASNPEFVAEKLRITFXXXXXXXXXXXXXXXXXXXTFWCVFEFGFHQFLDNLSRYRHLMLIQCDGSHDGSNMSDITCCKRKDLYLRGYLPHFGAIFGCAIGFIMKTPLFYASISVIYHHTSDPXXXXXXXXXXXFICAWFIAWFGFTLKPNWRF 1298
            ++WRIW  I ++ L  +L+Y    RY  F+  +L       +    MN YL  +I  +   PF LY  L    NYA+D +++G+D D  ++        +       + +      RL+RHF+PY+ ++H ++A C L+P+P LEA +IH      +EIW ++LDF++           + +   T  + P+ FNL+  L  L+++YP+ FW  ++ F+F FS++L +  LH+++ Y  T VL + AS    V  ++ +   + I+L  +  L   V  + F   FEFG+ Q L NL +YR+ +  Q + S   S+ S  +C      +L  Y PH   I    +  + K P+ +  +  +Y     P ML  ++   +++  W   WF    K NW+F
Sbjct:   43 KMWRIWYAILVLALNAFLLYSAFQRYASFRAKALR----EQWDMSPMNFYLAMMILTVFLLPFFLYAALAKTANYAEDGVQIGRDRDCLRV-----AIAETSSGAGAQATVGTCMSRLRRHFMPYTCLLHVLTAFCLLIPMPVLEAAEIHHAKRPSDEIWRTNLDFIY-----------HPKASATNSVCPEVFNLMLALAILLVRYPSTFWFSNRAFAFMFSVILCVCGLHIVLSYEATSVLFK-ASMSNDVVTQVNLLPPAIIALHSIGDLLLLVANIAF---FEFGYAQMLSNLRKYRNYL--QLEASSSVSDRSISSCNDETPCWL-NYAPHLAGILLMVVAVLCKAPVLWDWVG-LYRVHQQPAMLAAVVSGGIYLSLWVSVWFLLGFKANWKF 413          
BLAST of TPR_REGION domain-containing protein vs. TrEMBL
Match: A0A1I8HYR5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 3.363e-37
Identity = 117/399 (29.32%), Postives = 196/399 (49.12%), Query Frame = 3
Query:  102 RLWRIWNFIFLVVLYIYLVYDCIFRYIKFKKYSLDLGFGSNYSAVHMNIYLICIISGLTCFPFSLYCILFFNGNYADDNIKVGKDTDNFKIHQENDVTWQPDELTNLEKSKNILWKRLKRHFLPYSFIMHFVSAICFLVPIPFLEAHQIHQKVLKPNEIWHSDLDFLWDIDSWHSDFDNNGRWRTTWLMKPQYFNLIFCLLCLVLKYPNVFWACHKGXXXXXXXXXXXXXXHVIIDYSTTCVLIRVASNPEFVAEKLRITFXXXXXXXXXXXXXXXXXXXTFWCVFEFGFHQFLDNLSRYRHLMLIQCDGSHDGSNMSDITCCKRKDLYLRGYLPHFGAIFGCAIGFIMKTPLFYASISVIYHHTSDPXXXXXXXXXXXFICAWFIAWFGFTLKPNWRF 1298
            ++WRIW  I ++ L  +L+Y    RY  F+  +L       +    MN YL  +I  +   PF LY  L    NYA+D +++G+D D  ++                E S       L+RHF+PY+ ++H ++A C L+P+P LEA +IH      +EIW ++LDF++           + +   T  + P+ FNL+  L  L+++YP+ FW  ++ F+F FS++L +  LH+++ Y  T VL + AS    V  ++ +   + I+L  +  L   V  + F   FEFG+ Q L NL +YR+ +  Q + S   S+ S  +C      +L  Y PH   I    +  + K P+ +  +  +Y     P ML  ++   +++  W   WF    K NW+F
Sbjct:   17 KMWRIWYAILVLALNAFLLYSAFQRYASFRAKALR----EQWDMSPMNFYLAMMILTVFLLPFFLYAALAKTANYAEDGVQIGRDRDCLRV-------------AIAETSSGA--AALRRHFMPYTCLLHVLTAFCLLIPMPVLEAAEIHHAKRPSDEIWRTNLDFIY-----------HPKASATNSVCPEVFNLMLALAILLVRYPSTFWFSNRAFAFMFSVILCVCGLHIVLSYEATSVLFK-ASMSNGVVTQVNLLPPAIIALHSIGDLLLLVANIAF---FEFGYAQMLSNLRKYRNYL--QLEASSSVSDRSISSCNDETPCWL-NYAPHLAGILLMVVAVLCKAPVLWDWVG-LYRVHQQPAMLAAVVSGGIYLSLWVSVWFLLGFKANWKF 377          
BLAST of TPR_REGION domain-containing protein vs. TrEMBL
Match: A0A1I8IPE7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 7.310e-34
Identity = 114/399 (28.57%), Postives = 193/399 (48.37%), Query Frame = 3
Query:  102 RLWRIWNFIFLVVLYIYLVYDCIFRYIKFKKYSLDLGFGSNYSAVHMNIYLICIISGLTCFPFSLYCILFFNGNYADDNIKVGKDTDNFKIHQENDVTWQPDELTNLEKSKNILWKRLKRHFLPYSFIMHFVSAICFLVPIPFLEAHQIHQKVLKPNEIWHSDLDFLWDIDSWHSDFDNNGRWRTTWLMKPQYFNLIFCLLCLVLKYPNVFWACHKGXXXXXXXXXXXXXXHVIIDYSTTCVLIRVASNPEFVAEKLRITFXXXXXXXXXXXXXXXXXXXTFWCVFEFGFHQFLDNLSRYRHLMLIQCDGSHDGSNMSDITCCKRKDLYLRGYLPHFGAIFGCAIGFIMKTPLFYASISVIYHHTSDPXXXXXXXXXXXFICAWFIAWFGFTLKPNWRF 1298
            ++WRIW  I ++ L  +L+Y    RY  F+  +L       +    MN YL  +I  +   PF LY  L    NYA+D +++G+D D  ++        +       + +      RL+RHF+PY+ ++H ++A C L+P+P LEA +IH      +EIW ++LDF++           + +   T  + P+ FNL+  L  L+++YP+ FW  ++ F+F FS++L +  LH+       C L    SN   V  ++ +   + I+L  +  L   V  + F   FEFG+ Q L NL +YR+ +  Q + S   S+ S  +C      +L  Y PH   I    +  + K P+ +  +  +Y     P ML  ++   +++  W   WF    K NW+F
Sbjct:   10 KMWRIWYAILVLALNAFLLYSAFQRYASFRAKALR----EQWDMSPMNFYLAMMILTVFLLPFFLYAALAKTANYAEDGVQIGRDRDCLRV-----AIAETSSGAGAQATVGTCMSRLRRHFMPYTCLLHVLTAFCLLIPMPVLEAAEIHHAKRPSDEIWRTNLDFIY-----------HPKASATNSVCPEVFNLMLALAILLVRYPSTFWFSNRAFAFMFSVILCVCGLHI-------CCLKPSMSNG--VVTQVNLLPPAIIALHSIGDLLLLVANIAF---FEFGYAQMLSNLRKYRNYL--QLEASSSVSDRSISSCNDETPCWL-NYAPHLAGILLMVVAVLCKAPVLWDWVG-LYRVHQQPAMLAAVVSGGIYLSLWVSVWFLLGFKANWKF 372          
BLAST of TPR_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000008310.1 (SMESG000008310.1)

HSP 1 Score: 1508.43 bits (3904), Expect = 0.000e+0
Identity = 795/796 (99.87%), Postives = 795/796 (99.87%), Query Frame = 3
Query:   78 MGGKPNCLRLWRIWNFIFLVVLYIYLVYDCIFRYIKFKKYSLDLGFGSNYSAVHMNIYLICIISGLTCFPFSLYCILFFNGNYADDNIKVGKDTDNFKIHQENDVTWQPDELTNLEKSKNILWKRLKRHFLPYSFIMHFVSAICFLVPIPFLEAHQIHQKVLKPNEIWHSDLDFLWDIDSWHSDFDNNGRWRTTWLMKPQYFNLIFCLLCLVLKYPNVFWACHKGXXXXXXXXXXXXXXHVIIDYSTTCVLIRVASNPEFVAEKLRITFXXXXXXXXXXXXXXXXXXXTFWCVFEFGFHQFLDNLSRYRHLMLIQCDGSHDGSNMSDITCCKRKDLYLRGYLPHFGAIFGCAIGFIMKTPLFYASISVIYHHTSDPXXXXXXXXXXXFICAWFIAWFGFTLKPNWRFIFPSCSKAISDVSSTTIANSMTAGVPQPSLHSRELGGRADQPNQVYSCYHGMKSRLVMDERLRNPDCYSEENDLSXXXXXXXYVYLQSTLNPTINHILMSNNMPQLQPGESPLMVSFHDNIDSRNTVXXXXXXXXXXXNIRNQVLISVDPYHGRFQSLNSRTAGGVLKYSDSTTRSFVPEYISLQSESICGTTSKLDSGSSGDTSTLLAGESETTLKSIVDTQQQMHQSVTLNRQNSSKKRIYGQRVTFKDEQLTDTVDCSPNNSEQSSNNTASSDSGIDSNSKQPRNMLSQMNLADLNSVSAIKRSGVNIYDNSIKFIPPSNQLITTNGNSFFGYCDSLENPDSKSTLLYSSSQNPSMANELSATGNERQALSYLSESDQEQRLCSQV 2465
            MGGKPNCLRLWRIWNFIFLVVLYIYLVYDCIFRYIKFKKYSLDLGFGSNYSAVHMNIYLICIISGLTCFPFSLYCILFFNGNYADDNIKVGKDTDNFKIHQENDVTWQPDELTNLEKSKNILWKRLKRHFLPYSFIMHFVSAICFLVPIPFLEAHQIHQKVLKPNEIWHSDLDFLWDIDSWHSDFDNNGRWRTTWLMKPQYFNLIFCLLCLVLKYPNVFWACHKGFSFTFSLLLTLISLHVIIDYSTTCVLIRVASNPEFVAEKLRITFLSPISLMLLSILGSSVLLLTFWCVFEFGFHQFLDNLSRYRHLMLIQCDGSHDGSNMSDITCCKRKDLYLRGYLPHFGAIFGCAIGFIMKTPLFYASISVIYHHTSDPLMLLNLLLAVLFICAWFIAWFGFTLKPNWRFIFPSCSKAISDVSSTTIANSMTAGVPQPSLHSRELGGRADQPNQVYSCYHGMKSRLVMDERLRNPDCYSEENDLSNNAANNNYVYLQSTLNPTINHILMSNNMPQLQPGESPLMVSFHDNIDSRN VSESESSYDSASNIRNQVLISVDPYHGRFQSLNSRTAGGVLKYSDSTTRSFVPEYISLQSESICGTTSKLDSGSSGDTSTLLAGESETTLKSIVDTQQQMHQSVTLNRQNSSKKRIYGQRVTFKDEQLTDTVDCSPNNSEQSSNNTASSDSGIDSNSKQPRNMLSQMNLADLNSVSAIKRSGVNIYDNSIKFIPPSNQLITTNGNSFFGYCDSLENPDSKSTLLYSSSQNPSMANELSATGNERQALSYLSESDQEQRLCSQV
Sbjct:    1 MGGKPNCLRLWRIWNFIFLVVLYIYLVYDCIFRYIKFKKYSLDLGFGSNYSAVHMNIYLICIISGLTCFPFSLYCILFFNGNYADDNIKVGKDTDNFKIHQENDVTWQPDELTNLEKSKNILWKRLKRHFLPYSFIMHFVSAICFLVPIPFLEAHQIHQKVLKPNEIWHSDLDFLWDIDSWHSDFDNNGRWRTTWLMKPQYFNLIFCLLCLVLKYPNVFWACHKGFSFTFSLLLTLISLHVIIDYSTTCVLIRVASNPEFVAEKLRITFLSPISLMLLSILGSSVLLLTFWCVFEFGFHQFLDNLSRYRHLMLIQCDGSHDGSNMSDITCCKRKDLYLRGYLPHFGAIFGCAIGFIMKTPLFYASISVIYHHTSDPLMLLNLLLAVLFICAWFIAWFGFTLKPNWRFIFPSCSKAISDVSSTTIANSMTAGVPQPSLHSRELGGRADQPNQVYSCYHGMKSRLVMDERLRNPDCYSEENDLSNNAANNNYVYLQSTLNPTINHILMSNNMPQLQPGESPLMVSFHDNIDSRNMVSESESSYDSASNIRNQVLISVDPYHGRFQSLNSRTAGGVLKYSDSTTRSFVPEYISLQSESICGTTSKLDSGSSGDTSTLLAGESETTLKSIVDTQQQMHQSVTLNRQNSSKKRIYGQRVTFKDEQLTDTVDCSPNNSEQSSNNTASSDSGIDSNSKQPRNMLSQMNLADLNSVSAIKRSGVNIYDNSIKFIPPSNQLITTNGNSFFGYCDSLENPDSKSTLLYSSSQNPSMANELSATGNERQALSYLSESDQEQRLCSQV 796          
BLAST of TPR_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000008310.1 (SMESG000008310.1)

HSP 1 Score: 1396.72 bits (3614), Expect = 0.000e+0
Identity = 741/742 (99.87%), Postives = 741/742 (99.87%), Query Frame = 3
Query:  240 MNIYLICIISGLTCFPFSLYCILFFNGNYADDNIKVGKDTDNFKIHQENDVTWQPDELTNLEKSKNILWKRLKRHFLPYSFIMHFVSAICFLVPIPFLEAHQIHQKVLKPNEIWHSDLDFLWDIDSWHSDFDNNGRWRTTWLMKPQYFNLIFCLLCLVLKYPNVFWACHKGXXXXXXXXXXXXXXHVIIDYSTTCVLIRVASNPEFVAEKLRITFXXXXXXXXXXXXXXXXXXXTFWCVFEFGFHQFLDNLSRYRHLMLIQCDGSHDGSNMSDITCCKRKDLYLRGYLPHFGAIFGCAIGFIMKTPLFYASISVIYHHTSDPXXXXXXXXXXXFICAWFIAWFGFTLKPNWRFIFPSCSKAISDVSSTTIANSMTAGVPQPSLHSRELGGRADQPNQVYSCYHGMKSRLVMDERLRNPDCYSEENDLSXXXXXXXYVYLQSTLNPTINHILMSNNMPQLQPGESPLMVSFHDNIDSRNTVXXXXXXXXXXXNIRNQVLISVDPYHGRFQSLNSRTAGGVLKYSDSTTRSFVPEYISLQSESICGTTSKLDSGSSGDTSTLLAGESETTLKSIVDTQQQMHQSVTLNRQNSSKKRIYGQRVTFKDEQLTDTVDCSPNNSEQSSNNTASSDSGIDSNSKQPRNMLSQMNLADLNSVSAIKRSGVNIYDNSIKFIPPSNQLITTNGNSFFGYCDSLENPDSKSTLLYSSSQNPSMANELSATGNERQALSYLSESDQEQRLCSQV 2465
            MNIYLICIISGLTCFPFSLYCILFFNGNYADDNIKVGKDTDNFKIHQENDVTWQPDELTNLEKSKNILWKRLKRHFLPYSFIMHFVSAICFLVPIPFLEAHQIHQKVLKPNEIWHSDLDFLWDIDSWHSDFDNNGRWRTTWLMKPQYFNLIFCLLCLVLKYPNVFWACHKGFSFTFSLLLTLISLHVIIDYSTTCVLIRVASNPEFVAEKLRITFLSPISLMLLSILGSSVLLLTFWCVFEFGFHQFLDNLSRYRHLMLIQCDGSHDGSNMSDITCCKRKDLYLRGYLPHFGAIFGCAIGFIMKTPLFYASISVIYHHTSDPLMLLNLLLAVLFICAWFIAWFGFTLKPNWRFIFPSCSKAISDVSSTTIANSMTAGVPQPSLHSRELGGRADQPNQVYSCYHGMKSRLVMDERLRNPDCYSEENDLSNNAANNNYVYLQSTLNPTINHILMSNNMPQLQPGESPLMVSFHDNIDSRN VSESESSYDSASNIRNQVLISVDPYHGRFQSLNSRTAGGVLKYSDSTTRSFVPEYISLQSESICGTTSKLDSGSSGDTSTLLAGESETTLKSIVDTQQQMHQSVTLNRQNSSKKRIYGQRVTFKDEQLTDTVDCSPNNSEQSSNNTASSDSGIDSNSKQPRNMLSQMNLADLNSVSAIKRSGVNIYDNSIKFIPPSNQLITTNGNSFFGYCDSLENPDSKSTLLYSSSQNPSMANELSATGNERQALSYLSESDQEQRLCSQV
Sbjct:    1 MNIYLICIISGLTCFPFSLYCILFFNGNYADDNIKVGKDTDNFKIHQENDVTWQPDELTNLEKSKNILWKRLKRHFLPYSFIMHFVSAICFLVPIPFLEAHQIHQKVLKPNEIWHSDLDFLWDIDSWHSDFDNNGRWRTTWLMKPQYFNLIFCLLCLVLKYPNVFWACHKGFSFTFSLLLTLISLHVIIDYSTTCVLIRVASNPEFVAEKLRITFLSPISLMLLSILGSSVLLLTFWCVFEFGFHQFLDNLSRYRHLMLIQCDGSHDGSNMSDITCCKRKDLYLRGYLPHFGAIFGCAIGFIMKTPLFYASISVIYHHTSDPLMLLNLLLAVLFICAWFIAWFGFTLKPNWRFIFPSCSKAISDVSSTTIANSMTAGVPQPSLHSRELGGRADQPNQVYSCYHGMKSRLVMDERLRNPDCYSEENDLSNNAANNNYVYLQSTLNPTINHILMSNNMPQLQPGESPLMVSFHDNIDSRNMVSESESSYDSASNIRNQVLISVDPYHGRFQSLNSRTAGGVLKYSDSTTRSFVPEYISLQSESICGTTSKLDSGSSGDTSTLLAGESETTLKSIVDTQQQMHQSVTLNRQNSSKKRIYGQRVTFKDEQLTDTVDCSPNNSEQSSNNTASSDSGIDSNSKQPRNMLSQMNLADLNSVSAIKRSGVNIYDNSIKFIPPSNQLITTNGNSFFGYCDSLENPDSKSTLLYSSSQNPSMANELSATGNERQALSYLSESDQEQRLCSQV 742          
BLAST of TPR_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000068495.1 (SMESG000068495.1)

HSP 1 Score: 235.343 bits (599), Expect = 3.724e-65
Identity = 161/431 (37.35%), Postives = 241/431 (55.92%), Query Frame = 3
Query:   99 LRLWRIWNFIFLVVLYIYLVYDCIFRYIKFKKYSLDLGFGSNYSAVHMNIYLICIISGLTCFPFSLYCILFFNGNYADDNIKVGKDTDNFKIHQENDVTWQ--PDELTNLEKSKNI----LWKRLKRHFLPYSFIMHFVSAICFLVPIPFLEAHQIHQKVLKPNEIWHSDLDFLWDIDSWHSDFDNNGRWRTTWLMKPQYFNLIFCLLCLVLKYPNVFWACHKGXXXXXXXXXXXXXXHVIIDYSTTCVLIRVASNPEFVAEKLRITFXXXXXXXXXXXXXXXXXXXTFWCVFEFGFHQFLDNLSRYRHLMLIQCDGSH--------------------DGSNMSDITCCKRKDLYLRGYLPHFGAIFGCAIGFIMKTPLFYASISVIYHHTSDPXXXXXXXXXXXFICAWFIAWFGFTLKPNWRF--IFP 1307
            L LWRIW FIFL +L+IYL+Y  I  Y++ K  S D  +G N+    MN  L C++  +T  P  L   +    N A+D   +GKD DN     ++D   Q    ++   +  KN+    +   +K+ FLP S ++  +S  C+L+P+PF+EA +I  ++ KPN +WH+DLDFL D D  H DF N  +W     M+P YFN+IFCL  L  +YP+VFW  ++ FS  F L+L L+SLH+++DYS+T +LI++A +P+F++  L +  LSPI + ++SI+GS +LLL    +F +G +Q+  NL R+R  + +Q    H                    + +N SD++ C   D     YL HF AI     G  +K PLF  + S I   T D +M LN+++  +F   W I WFG +L   W+F  IFP
Sbjct:    9 LELWRIWIFIFLAILHIYLIYTSIVDYLRLKALSSDPIYGGNWKPGPMNFQLSCLLCSITLLPIILLSSMIVTDNLANDGHVLGKDIDNNHFIFDSDERGQLIRIDMKKSQSDKNLFSCGVQASIKQQFLPISIVLQIISGFCYLLPLPFIEAQKIQHQINKPNHLWHTDLDFLMDPDIDHEDFTNQNQWNFQLPMRPAYFNMIFCLSQLTFRYPSVFWRTNRKFSLLFYLILILLSLHILVDYSSTSILIKLALSPDFISPAL-LPLLSPIIICVISIVGSMILLLMQITLFNYGLNQYFSNLIRHRQTLRLQFKIEHNKKISDQTGSSNVSSETLNANDTNSSDLSEC---DFQFNKYLSHFFAIIFGLAGMSIKIPLFLQN-SNICSLTGDRVMYLNIIITTIFSTCWLITWFGLSLHNKWQFKVIFP 434          
BLAST of TPR_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000051307.1 (SMESG000051307.1)

HSP 1 Score: 205.682 bits (522), Expect = 8.159e-55
Identity = 162/513 (31.58%), Postives = 263/513 (51.27%), Query Frame = 3
Query:   96 CLRLWRIWNFIFLVVLYIYLVYDCIFRYIKFKKYSLDLGFGSNYSAVHMNIYLICIISGLTCFPFSLYCILFFNGNYADDNIKVGKDTDNFK-IHQENDVTWQPDELTNLEKSKNILWKRLKRHFL---PYSFIMHFVSAICFLVPIPFLEAHQIHQKVLKPNEIWHSDLDFLWDIDSWHSDFDNNGRWRTTWLMKPQYFNLIFCLLCLVLKYPNVFWACHKGXXXXXXXXXXXXXXHVIIDYSTTCVLIRVASNPEFVAEKLRITFXXXXXXXXXXXXXXXXXXXTFWCVFEFGFHQFLDNL----SRYRHLMLIQCDGSHDGSNMSDIT-----CCKRKD--------LYLRGYLPHFGAIFGCAIGFIMKTPLFYASISVIYHHTSDPXXXXXXXXXXXFICAWFIAWFGFTLKPNWRFIFPSCSKAISD---VSSTTIANSMTAGVPQPSLHSRELGGRADQPNQVYSCYHGMKSRLVMDERLRNPDCYSEENDLSXXXXXXXYVYLQS 1562
            C +LW IW   +L+V+ +YL Y+ I  Y+ FK  + D  +G N+      + L CII  L   P  +Y  +   GN+A+D    GKD + F  I  EN    + D + N ++      K LK  F+   P S+++  V+A C+L+P PF++A QI  KVL+PN+IWH+DLD ++D D  H +F    +W     M   YFN  F L  L ++Y  VFW   K F+   S L+   SLH++++Y +  ++I++  NP  V+  LR+   S  +++ LSIL + VLL +F  VF +G  Q+ D +     RYR  +L        GSN  D++     C    +        ++ + +  H  A+    +  ++K+P+ ++S   IY+ TSD L L+++L++ L++ +W I WF F L+  W F   S  K+ +D   ++  TI N+          +S  L  +  + N         K  ++   R    D  S+E D+S+  +++NYVYLQS
Sbjct:    4 CKKLWDIWFLTYLIVINLYLTYNAILNYLNFKVNASDPVYGRNWDTNLTYLILECIIIPLGLLPVIIYTNILPVGNFANDGKSFGKDEEFFHFILNENG---KADIVMNNKERNCCKQKFLKLIFMELPPISYVLQVVAAYCYLIPKPFMDARQIFHKVLRPNQIWHTDLDIIFDPDHQHPEFTYYQQWSYIQPMTVAYFNFGFSLFLLSIQYSRVFWNVSKTFTLVLSFLMLTFSLHLLVEYCSLSMMIKIIENPLIVSSSLRLEL-SVFTVLFLSILANFVLLFSFTTVFHYGILQYGDIMLHRHRRYRRQIL-NSSPHIVGSNQLDMSGPFSPCASENNYSESSIEPIFSKSHYSHILAVCFLVVVIVIKSPVIHSSFKHIYYFTSDSLTLVHMLISCLYVVSWLIVWFAFALRRTWNFKIKSTVKSNADQILLNGNTILNNNGQMQLHQMQNSFLLNPKTSELNLS-------KQEMLTANRNAALDGCSDETDMSSKLSSSNYVYLQS 504          
BLAST of TPR_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000077784.1 (SMESG000077784.1)

HSP 1 Score: 116.316 bits (290), Expect = 1.627e-26
Identity = 131/551 (23.77%), Postives = 249/551 (45.19%), Query Frame = 3
Query:   93 NCLRLWRIWNFIFLVVLYIYLVYDCIFRYIKFKKYSLDLGFGSNYSAVHMNIYLICIISGLTCFPFSLYCILFFNGNYADDNIKVGKDTDNFKIHQENDVTWQPDELTNLEKSKNILWKRLKRHFLPYSFIMHFVSAICFLVPIPFLEAHQIHQKVLKPNEIWHSDLDFLWDIDSWHSDFDNNG--------RWRTT-WLMKPQYFNLIFCLLCLVLKYPNVFWACHKGXXXXXXXXXXXXXXHVIIDYSTTCVLIRVASNPEF---VAEKLRITFXXXXXXXXXXXXXXXXXXXTFWCVFEFGFHQFLDNLSRYRHLMLIQCDGSHDGSNMSDITCCKRKDLYLRGYLPHFGAIFGCAIGFIMKTPLFYASISVIYHH---TSDPXXXXXXXXXXXFICAWFIAWFGFTLKPNWRFIFPSCSKAISDVSSTTIANSMTAGVPQPSLHSRELGGRADQPNQVYSCYHGMK--------SRLVMDERLRNPDCYSEENDLSXXXXXXXYVYLQSTLNPTINHILMSNNMPQLQPGESPLMVSFHDNIDSRNT 1676
            NC RLW++W  I ++V+ + L+   I  Y+ +K  S D  FG+++SA+ +N  L  I+  L+   + +Y  +F  G+ A+D I +G D D+ K   E   ++         K   +   RL  H LPY+  +H   A+   +P+  ++A QI  + + P+ IW +++DFL    S+   F  N          + T    + P++ NLI  LL +V++ P+ FW  +K FS  FS+   +    ++++Y +  ++I++  N +    +   L +       ++++ ++ S +++     +FE+G+ QF+ N+ +YR         S    +++D               P    I    I  I+K P+ Y  IS +  +   +  PL+L+++ +++ +  +    WFG  +K  W+F                  N  T  +PQ       +G     P  +Y C++           S+ ++   +   D  S + + S      NYV + S +NP +  + ++ N+ +   GES   VSF  N  S ++
Sbjct:   10 NCDRLWKLWYSILIIVMQVLLISLAISNYLTYKSQSFDPRFGNHWSALPLNFQLASIVLSLSLLVWLIYSCMFKVGHIANDGIVLGLDLDSIKKALEEISSY---------KGIKLFLTRLITHVLPYNCFIHLSIALLLCLPVALMQAEQIKNEAISPDYIWTTNIDFLISPHSFRI-FKANTVICYKLPCEYPTKPSAIAPEFINLIISLLIIVIRLPSPFWYTNKAFSILFSIFAFITVSCILMEYESLILIIKIIHNYDLDTKIESHLSVWL-----ILIIFLIKSLLMIFMLIIIFEYGYTQFISNMRKYRQYFSSDISDSVSQQSLND------NQYKWYNVSPRIFGILILVIVKILKIPILYVQISYLKINGKISIHPLILISICISLFYFLSCLFLWFGLCVKNKWQFHI----------------NIQTNPLPQIG-----VGKLKSSPEPIYGCFYNAASGSSQTSISKPMLRSSIDGSDVSSHKMNQS-----ANYVLMHSGMNPAMRVLPINENL-EFNAGESD--VSFESNSKSYDS 510          
The following BLAST results are available for this feature:
BLAST of TPR_REGION domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPR_REGION domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPR_REGION domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPR_REGION domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPR_REGION domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPR_REGION domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPR_REGION domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPR_REGION domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267H7U19.040e-3929.07Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267E6691.362e-3829.07Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267GLJ31.758e-3829.07Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8HYR53.363e-3729.32Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8IPE77.310e-3428.57Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of TPR_REGION domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPR_REGION domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPR_REGION domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPR_REGION domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPR_REGION domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPR_REGION domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008310.10.000e+099.87SMESG000008310.1[more]
SMESG000008310.10.000e+099.87SMESG000008310.1[more]
SMESG000068495.13.724e-6537.35SMESG000068495.1[more]
SMESG000051307.18.159e-5531.58SMESG000051307.1[more]
SMESG000077784.11.627e-2623.77SMESG000077784.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002754 ID=SMED30002754|Name=TPR_REGION domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2881bp
AACTGAAATTTAGAAAAGAAATTTTCAAGTTCTCGATGTTTCAACATAAC
ATGAATTTCTCCTAAACTGTGATTATAATGGGCGGAAAACCTAATTGTCT
TAGACTCTGGAGAATTTGGAATTTTATATTTTTAGTGGTCTTGTACATTT
ATCTTGTTTATGATTGTATTTTTCGATATATCAAATTCAAAAAATATTCA
TTGGATCTTGGATTTGGATCAAATTATTCCGCTGTTCACATGAATATTTA
TCTAATATGCATCATTTCAGGCCTAACGTGTTTTCCTTTCAGTTTGTATT
GCATATTATTTTTCAATGGCAACTATGCAGACGACAATATTAAAGTAGGA
AAGGACACTGATAATTTTAAAATCCATCAAGAGAATGACGTTACCTGGCA
ACCTGATGAATTGACTAATTTAGAAAAGTCTAAAAACATTCTTTGGAAAA
GACTAAAACGACATTTTTTGCCTTATTCTTTTATAATGCATTTTGTGAGT
GCCATATGTTTTCTAGTGCCTATACCTTTCCTAGAAGCACATCAGATCCA
TCAAAAAGTTCTTAAACCAAATGAAATATGGCATAGTGATCTGGATTTTT
TGTGGGATATCGACAGTTGGCATTCGGATTTCGATAACAACGGACGGTGG
AGAACTACATGGTTAATGAAGCCTCAATATTTCAATCTCATATTTTGTCT
GCTATGTTTAGTATTGAAATATCCTAATGTCTTTTGGGCATGTCACAAAG
GATTTTCATTCACATTCTCCTTGCTATTGACCCTCATAAGTCTTCATGTA
ATCATTGACTATAGCACCACTTGTGTACTTATTAGAGTGGCATCTAACCC
AGAGTTTGTGGCCGAGAAATTAAGGATCACTTTTTTGTCCCCGATATCTT
TGATGCTGCTCTCGATATTAGGATCAAGCGTTTTATTACTAACATTTTGG
TGCGTATTTGAGTTCGGATTTCATCAATTTCTCGATAATTTATCGCGTTA
TCGGCATCTAATGCTGATACAGTGCGACGGATCTCATGACGGAAGCAATA
TGTCTGACATAACGTGCTGTAAGCGAAAAGATCTTTATTTACGAGGCTAT
CTTCCACATTTCGGTGCTATCTTTGGATGTGCTATTGGATTCATTATGAA
GACTCCTCTTTTTTATGCCAGTATTAGTGTTATTTATCATCACACTAGTG
ATCCTTTAATGCTGTTAAATCTACTTTTGGCAGTCCTATTCATATGTGCT
TGGTTCATAGCTTGGTTCGGTTTCACCCTGAAACCGAATTGGAGATTCAT
TTTTCCAAGTTGTTCAAAAGCGATTTCCGATGTATCATCAACAACTATTG
CAAACAGCATGACAGCAGGGGTACCCCAACCGAGTCTCCATTCAAGGGAG
TTAGGTGGGAGAGCTGATCAACCTAATCAAGTCTATTCTTGCTATCATGG
CATGAAGTCCAGATTAGTTATGGATGAAAGATTGAGGAATCCCGATTGTT
ACAGTGAAGAAAATGATTTATCAAATAATGCTGCAAATAACAATTACGTC
TATTTACAAAGTACTCTGAATCCGACTATAAATCACATTTTAATGTCAAA
TAATATGCCTCAACTCCAACCAGGAGAATCTCCACTTATGGTTTCCTTCC
ACGACAACATAGATTCTAGGAATACGGTATCAGAAAGTGAATCCTCCTAT
GATTCTGCATCAAATATAAGAAATCAAGTTTTGATTTCTGTGGATCCTTA
TCATGGTCGTTTTCAGTCCCTGAATTCCCGTACAGCTGGAGGTGTTCTCA
AATATTCAGACAGTACTACTCGGTCATTTGTACCTGAATATATTTCCTTA
CAATCTGAAAGTATTTGTGGGACTACTTCAAAATTAGATAGCGGATCTTC
CGGAGATACAAGTACTCTTTTAGCCGGTGAAAGTGAAACAACACTTAAAT
CAATTGTTGATACTCAACAACAGATGCACCAATCTGTTACTCTTAATCGA
CAAAATTCCAGTAAGAAAAGAATTTATGGTCAGAGAGTAACTTTTAAAGA
TGAGCAACTAACCGACACGGTAGACTGTAGTCCGAACAATAGTGAACAAA
GTTCTAACAATACTGCGTCAAGTGACAGCGGAATCGACAGTAATTCCAAA
CAACCAAGAAATATGCTTTCACAGATGAATTTAGCAGATCTCAACAGTGT
TAGTGCAATAAAACGGTCCGGTGTAAACATTTACGATAATAGCATAAAAT
TTATTCCACCTTCAAATCAGTTAATAACTACAAATGGCAATTCATTTTTT
GGATATTGTGACTCTTTGGAGAATCCTGATTCCAAATCAACCCTTCTATA
TTCGAGTTCACAAAATCCATCTATGGCAAATGAGCTCTCTGCAACCGGAA
ATGAGAGGCAAGCATTATCATATCTGTCAGAAAGTGACCAAGAACAGAGG
CTTTGTAGTCAAGTTTGACATCAATTTCCAGTTCCAGTTTTAATGCCTTT
ATTAATATCTTTACCTTCCAAATTGGAAGAAATTTTAAATTACCGAATGA
ATTCAATGAATGTCATTTCACTGATTTGATTTTATATAGTAATTGTTTAT
ACATTATACATATCTTAGTATAAATATATATATAATATCGTAGTTCTATA
CAGAATATTCTTTCATTTTTTGCATTTTACTTGTGCTATATGTGTGTGTA
ATGCTGTACTTGTAACATGATGATTCTTTTTCTCTAATTTTGTACTTTTA
TCGTGGAACTCACCGACACCTTCATATTCACTGGTGTCATCTTATCATGG
AGGTTTTCCACATTTTATCGTTGTAAAATTAGATAGACAATTGTAAAATA
ATATAAAATTTGAAATTGAAAATAAATTCAC
back to top

protein sequence of SMED30002754-orf-1

>SMED30002754-orf-1 ID=SMED30002754-orf-1|Name=SMED30002754-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=797bp
MGGKPNCLRLWRIWNFIFLVVLYIYLVYDCIFRYIKFKKYSLDLGFGSNY
SAVHMNIYLICIISGLTCFPFSLYCILFFNGNYADDNIKVGKDTDNFKIH
QENDVTWQPDELTNLEKSKNILWKRLKRHFLPYSFIMHFVSAICFLVPIP
FLEAHQIHQKVLKPNEIWHSDLDFLWDIDSWHSDFDNNGRWRTTWLMKPQ
YFNLIFCLLCLVLKYPNVFWACHKGFSFTFSLLLTLISLHVIIDYSTTCV
LIRVASNPEFVAEKLRITFLSPISLMLLSILGSSVLLLTFWCVFEFGFHQ
FLDNLSRYRHLMLIQCDGSHDGSNMSDITCCKRKDLYLRGYLPHFGAIFG
CAIGFIMKTPLFYASISVIYHHTSDPLMLLNLLLAVLFICAWFIAWFGFT
LKPNWRFIFPSCSKAISDVSSTTIANSMTAGVPQPSLHSRELGGRADQPN
QVYSCYHGMKSRLVMDERLRNPDCYSEENDLSNNAANNNYVYLQSTLNPT
INHILMSNNMPQLQPGESPLMVSFHDNIDSRNTVSESESSYDSASNIRNQ
VLISVDPYHGRFQSLNSRTAGGVLKYSDSTTRSFVPEYISLQSESICGTT
SKLDSGSSGDTSTLLAGESETTLKSIVDTQQQMHQSVTLNRQNSSKKRIY
GQRVTFKDEQLTDTVDCSPNNSEQSSNNTASSDSGIDSNSKQPRNMLSQM
NLADLNSVSAIKRSGVNIYDNSIKFIPPSNQLITTNGNSFFGYCDSLENP
DSKSTLLYSSSQNPSMANELSATGNERQALSYLSESDQEQRLCSQV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 660..690
NoneNo IPR availablePANTHERPTHR21579:SF13PROTEIN TINCARcoord: 9..429
NoneNo IPR availablePANTHERPTHR21579FAMILY NOT NAMEDcoord: 9..429
NoneNo IPR availableTMHMMTMhelixcoord: 272..294
NoneNo IPR availableTMHMMTMhelixcoord: 55..77
NoneNo IPR availableTMHMMTMhelixcoord: 230..252
NoneNo IPR availableTMHMMTMhelixcoord: 377..399
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
NoneNo IPR availableTMHMMTMhelixcoord: 130..152
NoneNo IPR availableTMHMMTMhelixcoord: 201..223
NoneNo IPR availableTMHMMTMhelixcoord: 340..362